Summary

1. Notes


2. Result Statistics

Figure 1. False discovery rate (FDR) curve. X axis is the number of peptide-spectrum matches (PSM) being kept. Y axis is the corresponding FDR.



Figure 2. PSM score distribution. (a) Distribution of PEAKS peptide score; (b) Scatterplot of PEAKS peptide score versus precursor mass error.

(a)
(b)

Figure 3. De novo result validation. Distribution of residue local confidence: (a) Residues in de novo sequences validated by confident database peptide assignment; (b) Residues in "de novo only" sequences.

(a)
(b)
Table 1. Statistics of data.
# of MS scans8667
# of MS/MS scans173300
Table 2. Result filtration parameters.
Peptide -10lgP≥15
Peptide Ascore≥0
Protein -10lgP≥23
Proteins unique peptides≥2
De novo ALC Score≥50%
Table 3. Statistics of filtered result.
Peptide-Spectrum Matches38906
Peptide sequences19263
Protein groups802
Proteins802
Proteins (#Unique Peptides)629 (>2); 173 (=2); 0 (=1);
FDR (Peptide-Spectrum Matches)20.2%
FDR (Peptide Sequences)36.6%
FDR (Protein)52.6%
De Novo Only Spectra25922
Table 4. PTM profile.
Name ∆Mass Position #PSM -10lgP Area AScore
Methylation(KR)14.02KR3574127.531.51E5168.11
Carbamidomethyl57.02C3517200.001.78E61000.00
Deamidation.98NQ2605144.192.31E522.71
Oxidation15.99M1990160.678.38E51000.00
Methylation(others)14.02DEHST1188115.731.83E58.69
Phosphorylation79.97STY78697.992.18E50.00
Acetylation42.01N-term73184.448.18E41000.00
Pyro-glu from Q-17.03N-term674142.351.97E51000.00
Dehydration-18.01DSTY61182.015.56E48.14
Acetylation42.01K46472.221.99E450.00
Acetylation42.01Protein N-term432133.322.38E51000.00
Carbamylation43.01K,N-term37181.47 0.00
Dihydroxy31.99CFKPRWY28890.463.17E551.17
Sodium21.98DE,C-term26143.621.39E526.52
Formylation27.99K,N-term24553.682.3E551.38
Didehydro-2.02STY,C-term22798.53 0.00
Amidation-.98C-term20453.75 1000.00
Dimethylation(KR)28.03KR19484.055.05E561.82
Carboxylation43.99DKW15641.86 30.10
Biotin226.08K,N-term13142.351.14E560.72
Dethiomethyl-48.00M12679.123.36E51000.00
Sulfation79.96STY9772.42 1000.00
Ethyl28.03DE,N-term,C-term8092.726.77E412.60
Pyroglutamic13.98P7953.922.47E561.69
Ammonia loss-17.03N7794.701.27E571.03
Lysaminoadipicsealde-1.03K7768.58 1000.00
Oxidation15.99HW7582.536.12E41000.00
Hexose162.05NSY6968.504.61E50.00
Deamidation.98R5775.341.72E51000.00
Carboxylation43.99E5637.409.98E51000.00
Amidine41.03N-term5181.085.77E4118.43
Carboxymethyl58.01C4894.954.88E547.09
Propionamide71.04K,N-term3954.941.81E563.99
Guanidination42.02K3896.821.2E5200.29
MethylamineST13.03ST3167.83 15.73
Sulphone31.99M2871.488.59E51000.00
Methyl+Deamidated15.00NQ2760.836.74E420.75
Ubiquitin114.04KST2679.252.88E50.00
Diethylation56.06N-term2573.865.91E4157.13
Cation:Li6.01DE,C-term23100.727.38E40.00
Pyro-glu from E-18.01N-term2365.974.47E41000.00
O-Diisopropylphosphate164.06KSTY,N-term1559.034.3E421.19
Met->Aha-4.99M1569.287.44E41000.00
HexNAc203.08N1323.347.77E41000.00
Oxidation15.99DKNPY1246.401.5E50.00
Acetyl42.01HST1232.673.17E537.82
Methylation(C-term)14.02C-term1247.955.43E51000.00
SMA127.06N-term1259.702.66E51000.00
EtOH44.03KR1232.433.89E40.00
Propionald+4040.03HK1158.34 0.00
glycidamide87.03K,N-term1051.94 84.20
Myristoylation210.20CK,N-term1030.03 34.72
Formylation27.99Protein N-term1030.394.42E51000.00
ISD_z+2_ion-15.01N-term1059.613.21E51000.00
Propargylamine37.03DE,C-term1070.73 71.27
Phosphorylation79.97R920.81 1000.00
Trifluoro53.97L828.744.59E425.70
azole-20.03S839.029.18E4110.48
Cation:K37.96DE,C-term850.623.87E587.25
Oxolactone13.98W845.048.54E41000.00
Kynurenin3.99W781.301.77E51000.00
Iodination125.90HY767.521.06E584.28
Aminoadipic14.96K735.196.92E449.13
Carboxymethyl58.01K,N-term739.801.68E526.08
ser_thr_DAET87.05ST757.854.07E567.70
DSP88.00K,N-term737.965.71E471.03
Ammonium17.03DE,C-term748.181.04E53.36
Menadione-Q170.04K749.501.23E51000.00
O-Ethylphosphate108.00KY,N-term631.113.97E413.67
Arg2HPG282.05R652.947.1E51000.00
B-methylthiol45.99DN634.335.58E442.68
Pyridylacetyl119.04N-term636.303.06E413.05
S-Eth44.01S645.067.9E44.52
MDA5454.01K628.941.28E50.00
Deoxy-15.99DST619.422.22E512.28
HNE156.12HK674.571.9E5167.97
Maleimide97.02K629.112.25E51000.00
Argglutamicsealde-43.05R623.585.07E41000.00
Cation:Ni[II]55.92DE,C-term537.111.69E46.08
Carboxyethyl72.02K542.331.59E51000.00
Methylphosphonate77.99STY552.78 4.08
PET121.04ST534.635.85E414.04
Lipoyl188.03K563.203.11E41000.00
Aminotyrosine15.01Y556.11 23.15
G-H139.99R530.202.08E539.47
Phosphopropargyl117.00T529.303.35E51000.00
O-Isopropylmethylphosphonate120.03SY427.271.42E417.29
PEITC163.05K,N-term457.829.01E410.11
Glu129.04E440.526.15E41000.00
NDA175.04K,N-term426.82 1000.00
O-Diethylphosphate136.03ST436.49 7.77
Thio-phospho95.94ST422.644.81E453.33
AEBS183.04KSY429.69 72.73
Cation:Cu61.92D,C-term437.682.09E524.24
Malonyl86.00S428.641.12E51000.00
PyridoxalPhosphate229.01K441.874.79E51000.00
PyMIC134.05N-term432.524.85E41000.00
GPIanchor123.01C-term417.532.33E41000.00

3. Experiment Control

Figure 4. Precursor mass error of peptide-spectrum matches (PSM) in filtered result. (a) Distribution of precursor mass error in ppm; (b) Scatterplot of precursor m/z versus precursor mass error in ppm.

(a)
(b)

Table 5. Number of identified peptides in each sample by the number of missed cleavages

Missed Cleavages01234+
Atenuado11648573215573260

4. Other Information

Table 6. Search parameters.
Search Engine Name: PEAKS
Parent Mass Error Tolerance: 0.07 Da
Fragment Mass Error Tolerance: 0.07 Da
Precursor Mass Search Type: monoisotopic
Enzyme: Trypsin
Max Missed Cleavages: 3
Non-specific Cleavage: none
Fixed Modifications:
  Carbamidomethylation: 57.02
Variable Modifications:
  Oxidation (M): 15.99
  Acetylation (K): 42.01
  Acetylation (Protein N-term): 42.01
  Acetylation (N-term): 42.01
  Amidation: -0.98
  Beta-methylthiolation: 45.99
  Biotinylation: 226.08
  Carbamylation: 43.01
  and 304 more...
Max Variable PTM Per Peptide: 3
Database: Paracoccidioides_Pb18
Taxon: All
Searched Entry: 7000
FDR Estimation: Enabled
De novo score (ALC%) threshold: 15
Peptide hit threshold (-10logP): 30.0
Peaks run ID: 5
Different data refine parameters are used for this search:
Table 7. Instrument parameters.
Fractions: AEV 2_3_RA2_01_1224.d, AEV_1_3_RA2_01_1232.d, AEV_3_
3_RA3_01_1233.d
Ion Source: ESI(nano-spray)
Fragmentation Mode: CID, CAD(y and b ions)
MS Scan Mode: Quadrupole
MS/MS Scan Mode: Time of Flight (TOF)

Protein List

Protein Accession Contains:
Protein Description Contains:
Protein Sample Area >= 0E0
Protein Ptm Contains: Acetylation (N-term)
Protein Group Protein ID Accession -10lgP Coverage (%) Coverage (%) Atenuado Area Atenuado #Peptides #Unique #Spec Atenuado PTM Avg. Mass Description
1 1 C1G0D4 719.26 100 100 5.11E8 74 74 1382 Y 54454 Catalase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00324 PE=3 SV=2
4 26 C1GM00 717.02 55 55 2.33E8 83 80 934 Y 100508 Plasma membrane ATPase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08391 PE=3 SV=1
20 3 C1G5F6 677.80 98 98 1.09E8 49 49 507 Y 36427 Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02411 PE=3 SV=1
5 18 C1G065 654.10 70 70 6.86E7 166 166 534 Y 231710 Malonyl-CoA:ACP transacylase (MAT) domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00255 PE=3 SV=1
26 11 C1GHS5 576.36 86 86 5.35E7 61 59 386 Y 65365 amidase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06811 PE=3 SV=1
16 10 C1GEN5 575.29 95 95 1.15E8 69 68 519 Y 40135 Ribos_L4_asso_C domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05721 PE=3 SV=1
24 24 C1GA17 574.36 56 56 4.65E7 100 99 348 Y 131218 Pyruvate carboxylase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04103 PE=4 SV=1
3 20 C1G064 557.58 65 65 6.69E7 170 166 626 Y 208196 Fatty acid synthase subunit alpha OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00254 PE=3 SV=2
8 15 A0A0A0HUJ5 554.84 76 76 1.54E8 82 81 688 Y 61077 60S ribosomal protein L3 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_12253 PE=3 SV=1
17 2 C1G810 554.07 98 98 1.12E8 61 61 522 Y 29317 40S ribosomal protein S4 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03315 PE=3 SV=1
13 12 C1G1F2 552.80 90 90 1.6E8 84 84 540 Y 50191 Elongation factor 1-alpha OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00692 PE=3 SV=1
11 39 C1G3Y8 536.53 97 97 1.48E8 71 68 610 Y 27179 40S ribosomal protein S6 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01654 PE=3 SV=1
40 37 C1GMV8 521.82 95 95 9.28E7 55 55 371 Y 28389 40S ribosomal protein S2 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08602 PE=3 SV=1
19 16 C1GLI9 520.53 72 72 4.11E7 89 84 332 Y 92235 Elongation factor 2 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08125 PE=3 SV=2
28 60 A0A0A0HS69 519.66 57 57 6.63E7 56 54 378 Y 51973 40S ribosomal protein S8 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_12365 PE=3 SV=1
36 29 C1GGT8 515.31 89 89 9.24E7 56 54 393 Y 28973 40S ribosomal protein S1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=RPS1 PE=3 SV=1
21 9 C1G712 512.35 84 84 6.8E7 74 71 391 Y 61968 PH domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02967 PE=4 SV=1
10 75 A0A0A0HT80 511.84 58 58 8.5E7 89 87 395 Y 83060 60S ribosomal protein L13 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11227 PE=3 SV=1
18 6 C1GKC9 509.32 79 79 5.03E7 89 88 358 Y 80305 Hsp90-like protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07715 PE=3 SV=2
32 28 C1G391 503.93 98 98 8.55E7 53 51 412 Y 29627 40S ribosomal protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01407 PE=3 SV=1
65 8 C1GBJ2 494.62 84 84 2.2E7 61 60 214 Y 72098 ATP citrate synthase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04993 PE=4 SV=1
58 213 C1G0E5 490.07 92 92 6.91E7 31 31 314 Y 16054 40S ribosomal protein S14 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00335 PE=3 SV=1
38 7 C1G9P8 489.82 75 75 4.09E7 71 69 279 Y 76077 glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03984 PE=4 SV=2
87 113 C1GDK2 488.55 89 89 6.45E7 39 39 224 Y 21550 60S ribosomal protein L18-B OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05338 PE=3 SV=2
64 130 C1G0E3 485.12 95 95 6.03E7 36 36 286 Y 15855 40S ribosomal protein S16 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00333 PE=3 SV=1
51 54 C1G821 465.30 97 97 9.18E7 47 47 332 Y 22091 40S ribosomal protein S9 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03326 PE=3 SV=1
89 43 C1GM03 462.83 79 79 2.56E7 42 42 152 Y 48812 Cytochrome b-c1 complex subunit 2, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08394 PE=4 SV=1
48 5 C1GLI2 462.75 84 84 2.57E7 72 65 234 Y 70822 Hsp72-like protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08118 PE=3 SV=1
7 21 C1G1T5 460.77 64 64 2.83E7 161 157 351 Y 234384 glutamate synthase (NADH) OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02101 PE=3 SV=2
43 14 C1G002 459.26 70 70 2.43E7 61 59 198 Y 87744 ATP-dependent 6-phosphofructokinase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00192 PE=3 SV=1
27 17 C1G989 455.07 64 64 3.05E7 86 83 255 Y 126127 NAD-specific glutamate dehydrogenase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03825 PE=3 SV=1
45 78 C1G283 452.71 93 93 7.86E7 44 44 328 Y 27502 60S ribosomal protein L2 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02249 PE=3 SV=2
113 80 A0A0A0HWK8 447.86 73 73 2.44E7 27 22 196 Y 37162 Actin OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_12077 PE=3 SV=1
105 40 C1GBT0 442.70 78 78 1.99E7 42 41 157 Y 52074 Aldehyde dehydrogenase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05081 PE=3 SV=2
47 167 C1GAM9 441.04 70 70 8.94E7 48 46 324 Y 25175 40S ribosomal protein S24 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04315 PE=3 SV=2
37 22 C1GAG4 436.96 64 64 2.69E7 69 69 206 Y 112048 Formyltetrahydrofolate synthetase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04250 PE=3 SV=2
49 88 C1G2V1 436.76 93 93 1.1E8 46 44 364 Y 18480 40S ribosomal protein S11 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01267 PE=3 SV=1
57 124 C1GG76 435.62 67 67 6.39E7 38 37 285 Y 23316 40S ribosomal protein S18 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06313 PE=3 SV=2
39 57 C1G0X4 432.09 97 97 8.94E7 51 50 357 Y 23111 60S ribosomal protein L16 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00514 PE=3 SV=1
9 23 C1GDJ1 430.14 53 53 3.07E7 132 128 307 Y 257187 Biotin carboxylase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05327 PE=4 SV=2
66 100 C1G6T3 429.48 95 95 3.64E7 49 48 215 Y 22928 60S ribosomal protein L6 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02888 PE=3 SV=1
122 59 C1FYR6 427.47 91 91 2.72E7 36 35 184 Y 22696 40S ribosomal protein S7 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00942 PE=3 SV=1
110 55 C1G3C4 427.22 80 80 2.64E7 37 36 176 Y 33617 ADP/ATP translocase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01440 PE=3 SV=2
69 115 C1GHJ0 425.80 88 88 3.76E7 44 43 201 Y 27037 60S ribosomal protein L17 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06726 PE=3 SV=2
130 61 C1G3L4 424.85 86 86 2.36E7 35 35 142 Y 35072 Guanine nucleotide-binding protein subunit beta-like protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01530 PE=3 SV=2
76 102 C1G371 423.02 90 90 5.1E7 47 46 260 Y 28554 60S ribosomal protein L7 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01387 PE=3 SV=1
22 38 C1G942 422.98 96 96 1.15E8 56 55 466 Y 25717 60S ribosomal protein L10-A OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03778 PE=3 SV=1
114 154 C1GFA3 422.63 91 91 4.31E7 28 26 184 Y 16752 60S ribosomal protein L27a OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05939 PE=3 SV=1
72 62 C1GIX7 420.94 66 66 1.81E7 49 47 161 Y 55479 Acetyltransferase component of pyruvate dehydrogenase complex OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07213 PE=3 SV=2
102 30 C1G9X3 418.73 89 89 1.75E7 42 42 140 Y 47270 Enolase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04059 PE=3 SV=1
50 99 C1G9C0 416.74 86 86 5.71E7 46 45 260 Y 24184 Ribosomal protein L15 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03856 PE=3 SV=1
34 27 C1G3T6 411.31 52 52 2.33E7 74 74 196 Y 125155 Potassium/sodium efflux P-type ATPase, fungal-type OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01602 PE=4 SV=2
2 117 A0A0A0HV62 411.06 38 38 8.19E7 136 131 491 Y 315855 Ribosomal protein L19 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11904 PE=3 SV=1
63 185 C1GLA5 410.71 80 80 4.52E6 26 9 311 Y 19698 Ubiquitin-60S ribosomal protein L40 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07891 PE=3 SV=2
96 70 C1GA20 410.25 94 94 5.41E7 38 36 233 Y 19799 60S ribosomal protein L11 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04106 PE=3 SV=1
79 114 C1GK99 408.80 98 98 7.79E7 31 30 260 Y 16851 40S ribosomal protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07685 PE=3 SV=1
91 66 C1GMU5 408.19 77 77 2.33E7 40 40 194 Y 34595 t-SNARE coiled-coil homology domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08589 PE=4 SV=2
67 216 C1G3T9 408.07 37 37 9.37E5 23 5 306 Y 35358 Polyubiquitin OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01605 PE=4 SV=2
52 49 C1GB47 404.77 91 91 4.14E7 52 52 247 Y 27882 60S ribosomal protein L8 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04848 PE=3 SV=2
44 19 C1GMZ1 404.56 70 70 2.18E7 73 72 199 Y 96879 Peroxisomal hydratase-dehydrogenase-epimerase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08651 PE=3 SV=1
33 4 C1GLX8 404.20 86 86 1.94E7 67 67 197 Y 62389 Hsp60-like protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08369 PE=3 SV=1
131 67 C1GE52 403.03 78 78 8.7E6 37 36 101 Y 47829 Actin family OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05538 PE=3 SV=1
100 13 C1GA13 400.24 78 78 1.18E7 52 51 140 Y 69049 Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04099 PE=3 SV=1
88 76 C1GAG3 398.23 63 63 1.68E7 51 50 142 Y 54368 Isocitrate dehydrogenase [NADP] OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04249 PE=3 SV=2
142 48 C1G2J3 397.64 87 87 1.68E7 32 31 117 Y 39228 Septin-type G domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02359 PE=3 SV=1
117 82 C1GEM8 396.80 76 76 1.87E7 39 38 124 Y 44496 Septin-type G domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05714 PE=3 SV=1
125 123 C1GLU6 395.12 76 76 3.64E7 24 23 184 Y 21587 GTP-binding protein rhoA OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08337 PE=4 SV=1
99 44 C1GBZ4 395.05 73 73 1.42E7 43 42 135 Y 50173 Glutamate dehydrogenase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04516 PE=3 SV=2
150 68 A0A0A0HVP8 389.10 57 57 9.51E6 28 24 107 Y 48954 Mitogen-activated protein kinase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11275 PE=3 SV=1
77 79 C1GHV2 388.70 99 99 4.25E7 40 40 237 Y 23799 40S ribosomal protein S5 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06838 PE=3 SV=2
78 116 C1FZ57 385.78 73 73 2.76E7 43 41 192 Y 23267 60S ribosomal protein L32 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01083 PE=3 SV=2
85 58 C1GII4 384.73 52 52 1.05E7 35 35 125 Y 59144 Septin-type G domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07070 PE=3 SV=1
109 32 C1GAT8 384.46 74 74 2.54E7 54 53 148 Y 56578 UTP--glucose-1-phosphate uridylyltransferase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04374 PE=3 SV=1
70 202 C1GFG5 381.30 87 87 2.01E7 41 40 154 Y 21076 Histone H1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06001 PE=3 SV=1
59 45 C1G8H6 380.51 65 65 1.01E7 57 54 140 Y 73876 Endoplasmic reticulum chaperone BiP OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03562 PE=3 SV=1
157 85 C1FZT8 379.53 65 65 1.13E7 33 32 94 Y 50087 Tubulin alpha chain OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00128 PE=3 SV=1
83 47 A0A0A0HWS3 379.25 62 62 1.2E7 51 47 122 Y 78445 Vacuolar protein sorting-associated protein 1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11982 PE=3 SV=1
128 84 C1GJS2 377.71 84 84 1.47E7 42 41 109 Y 49332 Phosphatidylinositol transfer protein SFH5 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07508 PE=3 SV=2
61 42 C1G4M5 377.38 55 55 2.36E7 54 52 156 Y 84548 Translation initiation factor RLI1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01891 PE=4 SV=2
111 162 A0A0A0HT22 374.90 56 56 1.29E7 32 31 78 Y 56630 AMPK1_CBM domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_12447 PE=4 SV=1
31 35 C1GAF5 373.74 58 58 1.4E7 73 71 150 Y 131482 Coatomer subunit alpha OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04241 PE=4 SV=2
46 33 C1G5V6 372.95 67 67 2.28E7 61 61 189 Y 60213 ATP synthase subunit alpha OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02561 PE=3 SV=1
82 71 C1GLM2 371.46 86 86 3.12E7 36 36 186 Y 31838 Mitochondrial outer membrane protein porin OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08263 PE=4 SV=2
116 219 C1GEX7 370.18 30 30 1.47E7 20 20 145 Y 61338 ZIP family zinc transporter OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05813 PE=4 SV=1
25 25 C1FZI7 368.22 47 47 1.6E7 79 77 185 Y 167827 Vacuolar protein sorting/targeting protein 10 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=VPS10 PE=3 SV=1
120 53 C1G820 366.48 99 99 4.35E7 39 37 189 Y 18252 60S ribosomal protein L21-A OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03325 PE=3 SV=1
92 41 C1GCI0 364.21 62 62 1.24E7 47 47 131 Y 60924 Malate synthase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04702 PE=3 SV=2
139 94 C1G1C8 363.77 76 76 8.81E6 29 28 92 Y 39659 Fructose-bisphosphate aldolase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00668 PE=3 SV=1
124 73 C1FYX6 363.24 74 74 1.51E7 29 28 135 Y 39139 PHB domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01002 PE=3 SV=2
101 83 C1GMI6 363.14 56 56 1.29E7 50 48 125 Y 73691 Lysine--tRNA ligase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08472 PE=3 SV=2
86 36 C1G411 362.87 51 51 1.46E7 52 51 146 Y 73519 Acetyl-coenzyme A synthetase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01677 PE=3 SV=2
84 92 C1G9D7 362.41 95 95 5.39E7 32 30 237 Y 21120 60S ribosomal protein L20 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03873 PE=3 SV=2
108 31 C1GLV8 359.73 83 83 9.34E6 42 39 113 Y 55279 ATP synthase subunit beta OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08349 PE=3 SV=1
73 135 C1GB65 359.65 71 71 5.09E7 41 41 226 Y 28374 S10_plectin domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_04866 PE=3 SV=2
152 65 C1G6U5 353.93 54 54 1.07E7 27 27 90 Y 50837 Tubulin beta chain OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02900 PE=3 SV=2
209 69 C1GCX5 347.61 60 60 7.18E6 33 29 73 Y 52007 Serine hydroxymethyltransferase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05111 PE=3 SV=1
94 107 C1GBM4 344.76 84 84 9.5E7 35 34 309 Y 15198 Ribosomal protein L24 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05025 PE=3 SV=1
175 46 A0A0A0HU84 344.39 38 38 1.07E7 40 40 85 Y 123319 PCI domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_12029 PE=3 SV=1
196 153 C1GHE4 329.39 96 96 2.15E7 22 22 112 Y 14737 40S ribosomal protein S22 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06680 PE=3 SV=1
273 146 C1GEU2 315.53 28 28 3.1E6 24 23 40 Y 80380 Glycogen [starch] synthase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05778 PE=3 SV=1
188 246 C1GLJ7 314.79 60 60 2.4E7 16 16 117 Y 13684 40S ribosomal protein S26 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08238 PE=3 SV=1
264 152 C1GN78 310.85 99 99 1.38E7 23 23 66 Y 16706 Ribosomal_L28e domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08715 PE=3 SV=1
287 267 C1GIP8 284.22 53 53 2.63E6 16 4 62 Y 16321 Histone H4 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07134 PE=3 SV=2
228 87 C1GL73 277.02 18 18 2.34E6 32 32 46 Y 243261 Dedicator of cytokinesis protein 1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_07859 PE=3 SV=1
256 106 C1G6F6 275.75 39 39 3.53E6 23 21 49 Y 67200 Hsp75-like protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02761 PE=3 SV=1
192 248 C1GDA8 268.35 55 55 4.82E7 19 19 125 Y 15119 60S ribosomal protein L44 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05244 PE=3 SV=2
327 166 C1G373 262.83 24 24 4.15E6 19 18 30 Y 97200 Eukaryotic translation initiation factor 3 subunit C OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=NIP1 PE=3 SV=1
178 110 C1G7C1 261.55 31 31 4.61E6 36 33 65 Y 124300 26S proteasome regulatory subunit RPN2 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_03076 PE=3 SV=1
337 266 C1G3D9 259.41 49 49 1.38E6 18 16 30 Y 38588 RNA-binding protein rnc1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01455 PE=4 SV=2
232 227 C1FYJ7 258.97 85 85 1.47E7 21 19 81 Y 15389 Histone H3 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00873 PE=3 SV=1
323 64 C1GH49 258.87 54 54 3.27E6 30 29 48 Y 60184 GMP synthase [glutamine-hydrolyzing] OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_06585 PE=3 SV=2
362 164 A0A0A0HV89 255.18 35 35 2.33E6 18 18 33 Y 65311 Alkaline phosphatase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11766 PE=3 SV=1
311 209 C1G647 253.88 47 47 5.3E6 15 14 35 Y 35039 RNA-binding domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02652 PE=4 SV=1
240 318 A0A0A0HT57 252.67 39 39 1.61E7 13 13 85 Y 15757 60S ribosomal protein L37 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11585 PE=3 SV=1
214 205 C1GE59 225.75 31 31 2.69E6 23 22 38 Y 87463 RNA helicase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05545 PE=3 SV=1
406 464 C1G4K3 223.11 78 78 2.66E6 10 9 30 Y 10785 4F5 domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01869 PE=4 SV=1
296 235 C1GCV9 219.76 33 33 1.92E6 17 17 27 Y 57807 Nucleolar protein 58 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05095 PE=3 SV=1
336 194 C1G4T5 217.41 30 30 2.99E6 16 16 28 Y 62252 Nucleoside diphosphatase Gda1 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_01951 PE=3 SV=1
441 258 C1GLM4 207.00 32 32 1.14E6 11 10 19 Y 48916 Methionine aminopeptidase 2 OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08265 PE=3 SV=1
597 365 C1GG77 198.58 11 11 2.78E6 6 6 18 Y 61910 Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=CPYA PE=3 SV=1
496 281 C1G1P0 194.21 28 28 9.42E5 12 12 16 Y 49054 Pribosyltran_N domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_00780 PE=3 SV=1
430 211 C1G5X0 178.00 10 10 1.07E6 11 11 15 Y 138377 Carrier domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_02575 PE=4 SV=2
450 314 C1GDK4 176.43 39 39 2.43E6 9 8 22 Y 23127 RRM domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_05340 PE=4 SV=1
464 222 A0A0A0HRM2 171.05 21 21 2.03E6 15 15 23 Y 85327 H(+)-transporting two-sector ATPase OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_11981 PE=3 SV=1
600 510 C1GLU1 153.14 21 21 8.43E5 5 5 14 Y 25484 GOLD domain-containing protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08332 PE=3 SV=1
total 125 proteins

C1G0D4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VGVKGPLLLQDFHLIDLLAHFDRER.I Y 200.00 2900.6023 25 4.9 581.1306 5 89.43 2 46992 AEV_1_3_RA2_01_1232.d 2.52E6 8 8 9 33
K.GAGAYGEFEVLDDISDITVIDMLLGVGKK.T Y 200.00 3024.5364 29 4.9 1009.1910 3 97.53 2 50192 AEV_1_3_RA2_01_1232.d 5.85E5 4 4 43 71
K.AIERGEYPSWTC(+57.02)YVQVLSPEQAEKFR.W Y 170.12 3142.5181 26 3.6 786.6396 4 82.03 2 42149 AEV_1_3_RA2_01_1232.d 1.18E6 4 4 233 258 Carbamidomethylation
R.FTLC(+57.02)ENPQNYFAEIEQAAFSPSHMVPGVEPSADPVLQSR.L Y 160.51 4362.0361 39 1.7 1091.5182 4 92.14 2 48239 AEV_1_3_RA2_01_1232.d 2.11E6 12 12 281 319 Carbamidomethylation
R.QPGQQENFVHNVSVHLC(+57.02)GAQEK.V Y 160.39 2505.1819 22 7.2 627.3073 4 67.43 2 30986 AEV_1_3_RA2_01_1232.d 9.17E5 3 3 418 439 Carbamidomethylation
K.AC(+57.02)QEHEQWAGAALSK.Q Y 155.47 1684.7627 15 4.0 562.5971 3 54.43 2 22767 AEV_1_3_RA2_01_1232.d 1.08E7 11 11 382 396 Carbamidomethylation
K.M(+15.99)AADNPDWHTEDLFK.A Y 153.39 1804.7726 15 3.0 602.5999 3 72.56 2 34778 AEV_1_3_RA2_01_1232.d 4.72E6 12 12 218 232 Oxidation (M)
K.VLGRQPGQQENFVHNVSVHLC(+57.02)GAQEK.V Y 151.82 2930.4570 26 -2.3 733.6199 4 67.16 3 38012 AEV_3_3_RA3_01_1233.d 3.81E6 8 8 414 439 Carbamidomethylation
K.MAADNPDWHTEDLFK.A Y 149.46 1788.7777 15 3.0 597.2683 3 75.10 2 36689 AEV_1_3_RA2_01_1232.d 5.93E6 9 9 218 232
K.TDQGNKTFNNEEATK.M Y 147.46 1695.7700 15 4.9 566.2667 3 21.95 2 7247 AEV_1_3_RA2_01_1232.d 1.77E7 28 28 203 217
R.FTLC(+57.02)ENPQNYFAEIEQ(+.98)AAFSPSHMVPGVEPSADPVLQSR.L Y 144.19 4363.0200 39 7.1 1091.7700 4 91.98 3 55787 AEV_3_3_RA3_01_1233.d 2.31E5 1 1 281 319 Carbamidomethylation; Deamidation (NQ)
R.FTLC(+57.02)ENPQN(+.98)YFAEIEQAAFSPSHMVPGVEPSADPVLQSR.L Y 138.91 4363.0200 39 5.5 1455.3553 3 92.24 2 48269 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 281 319 Carbamidomethylation; Deamidation (NQ)
R.VGVKGPLLLQDFHLIDLLAHFDR.E Y 138.37 2615.4587 23 2.8 654.8738 4 90.48 3 54984 AEV_3_3_RA3_01_1233.d 1.32E6 8 8 9 31
R.WNVFDLTKVWPQAEVPLRR.F Y 135.98 2353.2695 19 0.8 589.3251 4 87.09 2 45719 AEV_1_3_RA2_01_1232.d 1.61E6 7 7 259 277
K.GAGAYGEFEVLDDISDITVIDM(+15.99)LLGVGKK.T Y 134.17 3040.5315 29 2.0 1014.5198 3 95.74 3 57544 AEV_3_3_RA3_01_1233.d 6.2E5 5 5 43 71 Oxidation (M)
R.GEYPSWTC(+57.02)YVQVLSPEQAEKFR.W Y 134.16 2673.2532 22 0.1 892.0918 3 84.24 2 43787 AEV_1_3_RA2_01_1232.d 9.48E5 8 8 237 258 Carbamidomethylation
R.Q(-17.03)PGQQENFVHNVSVHLC(+57.02)GAQEK.V Y 129.08 2488.1553 22 1.5 830.3936 3 74.14 2 36017 AEV_1_3_RA2_01_1232.d 2.07E6 8 8 418 439 Pyro-glu from Q; Carbamidomethylation
K.DATMFWDYLSTHQESAHQVMHLFSDR.G Y 127.73 3151.3916 26 1.8 631.2867 5 86.54 2 45320 AEV_1_3_RA2_01_1232.d 2.96E5 3 3 143 168
R.FSTVGGEKGSADSAR.D Y 126.74 1467.6953 15 5.0 490.2415 3 28.56 2 10082 AEV_1_3_RA2_01_1232.d 4.76E6 12 12 78 92
K.GPLLLQDFHLIDLLAHFDRER.I Y 126.28 2517.3491 21 -0.2 504.4770 5 90.50 3 55022 AEV_3_3_RA3_01_1233.d 1.84E6 11 11 13 33
K.AIERGEYPSWTC(+57.02)YVQVLSPEQAEK.F Y 125.85 2839.3486 24 2.4 947.4590 3 82.05 2 42193 AEV_1_3_RA2_01_1232.d 7.03E5 4 4 233 256 Carbamidomethylation
R.FTLC(+57.02)ENPQNYFAEIEQAAFSPSHM(+15.99)VPGVEPSADPVLQSR.L Y 125.40 4378.0308 39 2.1 1095.5172 4 90.70 2 47567 AEV_1_3_RA2_01_1232.d 9.84E5 5 5 281 319 Carbamidomethylation; Oxidation (M)
K.GAGAYGEFEVLDDISDITVIDMLLGVGKKTK.C Y 124.22 3253.6792 31 0.6 814.4276 4 94.87 3 57164 AEV_3_3_RA3_01_1233.d 1.71E5 2 2 43 73
R.HRLGVNYQQIPVNC(+57.02)PLR.A Y 124.06 2063.0847 17 2.6 516.7798 4 68.68 2 31860 AEV_1_3_RA2_01_1232.d 1.4E6 5 5 329 345 Carbamidomethylation
R.LGVNYQQIPVNC(+57.02)PLR.A Y 123.30 1769.9247 15 0.3 885.9699 2 76.47 2 37802 AEV_1_3_RA2_01_1232.d 1.31E7 14 14 331 345 Carbamidomethylation
K.FRWNVFDLTKVWPQAEVPLRR.F Y 121.65 2656.4390 21 -2.0 532.2940 5 85.54 3 52063 AEV_3_3_RA3_01_1233.d 6.77E5 3 3 257 277
R.DGAMAIN(+.98)GNYGANPNYPSTFRPMEFKPVK.A Y 121.30 3186.4902 29 2.7 638.3071 5 78.73 2 39546 AEV_1_3_RA2_01_1232.d 5.9E5 5 5 353 381 Deamidation (NQ)
K.QIPVTDEDFVQPNGLWK.V Y 121.19 1984.9894 17 1.5 993.5034 2 82.12 2 42233 AEV_1_3_RA2_01_1232.d 2.24E6 6 6 397 413
R.Q(-17.03)PGQ(+.98)QENFVHNVSVHLC(+57.02)GAQEK.V Y 119.10 2489.1394 22 10.0 830.7287 3 74.23 2 36051 AEV_1_3_RA2_01_1232.d 3.59E5 2 2 418 439 Pyro-glu from Q; Deamidation (NQ); Carbamidomethylation
R.GEYPSWTC(+57.02)YVQVLSPEQAEK.F Y 118.69 2370.0837 20 3.4 1186.0532 2 84.80 3 51599 AEV_3_3_RA3_01_1233.d 6.61E5 5 5 237 256 Carbamidomethylation
K.WTKPDGTFNYVQIHC(+57.02)K.T Y 117.21 1992.9515 16 5.2 499.2477 4 67.49 2 30998 AEV_1_3_RA2_01_1232.d 3.04E6 10 10 187 202 Carbamidomethylation
R.DPSKFPIFIHTQK.R Y 116.93 1556.8351 13 5.7 519.9553 3 69.17 2 32280 AEV_1_3_RA2_01_1232.d 4.04E6 9 9 122 134
K.Q(-17.03)IPVTDEDFVQPNGLWK.V Y 115.06 1967.9629 17 2.5 984.9912 2 89.22 2 46874 AEV_1_3_RA2_01_1232.d 4.52E6 7 7 397 413 Pyro-glu from Q
R.FSTVGGEKGSADSARDPR.G Y 113.41 1835.8761 18 5.5 612.9694 3 34.54 2 12947 AEV_1_3_RA2_01_1232.d 2.29E7 27 27 78 95
R.WNVFDLTKVWPQAEVPLR.R Y 112.38 2197.1685 18 0.0 733.3968 3 90.33 3 54878 AEV_3_3_RA3_01_1233.d 2.49E5 3 3 259 276
R.DGAMAINGNYGANPNYPSTFRPMEFKPVK.A Y 111.78 3185.5061 29 3.7 797.3867 4 78.09 2 39045 AEV_1_3_RA2_01_1232.d 4.95E5 4 4 353 381
K.GPLLLQDFHLIDLLAHFDRERIPER.V Y 110.80 3012.6296 25 3.4 603.5353 5 88.82 3 54063 AEV_3_3_RA3_01_1233.d 6.02E5 3 3 13 37
K.AC(+57.02)QEHEQWAGAALSK(+14.02).Q Y 110.49 1698.7783 15 3.5 567.2687 3 60.18 2 26000 AEV_1_3_RA2_01_1232.d 1.58E6 6 6 382 396 Carbamidomethylation; Methylation(KR)
R.LFSYPDTHR.H Y 109.85 1134.5458 9 2.8 379.1903 3 56.03 2 23606 AEV_1_3_RA2_01_1232.d 2.9E7 33 33 320 328
R.Q(-17.03)PGQQENFVHNVSVHLC(+57.02)GAQEK(+14.02).V Y 109.11 2502.1709 22 5.2 835.0685 3 75.66 2 37151 AEV_1_3_RA2_01_1232.d 1.01E6 5 5 418 439 Pyro-glu from Q; Carbamidomethylation; Methylation(KR)
R.HMNGYSGHTYK.W Y 108.44 1293.5560 11 12.8 432.1981 3 17.68 3 6580 AEV_3_3_RA3_01_1233.d 5.77E4 1 1 176 186
R.VGVKGPLLLQDFHLIDLLAHFDR(+14.02)ER.I Y 107.24 2914.6179 25 1.1 583.9315 5 89.15 3 54268 AEV_3_3_RA3_01_1233.d 6.82E5 3 3 9 33 Methylation(KR)
R.M(+15.99)VASQPQSHL Y 107.00 1112.5284 10 2.3 557.2728 2 36.61 2 13820 AEV_1_3_RA2_01_1232.d 3.21E7 60 60 466 475 Oxidation (M)
R.LGVNYQ(+.98)QIPVNC(+57.02)PLR.A Y 106.14 1770.9087 15 2.1 886.4635 2 77.36 2 38474 AEV_1_3_RA2_01_1232.d 1.37E6 5 5 331 345 Deamidation (NQ); Carbamidomethylation
R.QPGQQENFVHNVSVHLC(+57.02)GAQEKVR.K Y 105.69 2760.3513 24 -2.5 553.0762 5 66.50 3 37471 AEV_3_3_RA3_01_1233.d 3.88E5 2 2 418 441 Carbamidomethylation
K.VLGRQPGQQENFVHNVSVHLC(+57.02)GAQEK(+14.02).V Y 105.45 2944.4727 26 3.6 589.9039 5 69.94 2 32804 AEV_1_3_RA2_01_1232.d 1.31E6 3 3 414 439 Carbamidomethylation; Methylation(KR)
K.MAADNPDWHTEDLFKAIER.G Y 105.24 2258.0425 19 1.2 565.5186 4 79.39 3 47588 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 218 236
R.DGAM(+15.99)AINGNYGANPNYPSTFRPMEFKPVK.A Y 103.14 3201.5012 29 0.2 641.3076 5 76.54 2 37852 AEV_1_3_RA2_01_1232.d 4.74E5 5 5 353 381 Oxidation (M)
K.Q(-17.03)IPVTDEDFVQPN(+.98)GLWK.V Y 102.78 1968.9469 17 2.4 985.4831 2 90.17 2 47336 AEV_1_3_RA2_01_1232.d 5.29E6 10 10 397 413 Pyro-glu from Q; Deamidation (NQ)
K.AC(+57.02)QEHEQ(+.98)WAGAALSK.Q Y 102.33 1685.7467 15 5.2 562.9258 3 57.62 2 24428 AEV_1_3_RA2_01_1232.d 1.29E6 5 5 382 396 Carbamidomethylation; Deamidation (NQ)
R.Q(-17.03)PGQQENFVHNVSVHLC(+57.02)GAQEKVR.K Y 101.95 2743.3250 24 0.1 686.8386 4 72.33 3 42083 AEV_3_3_RA3_01_1233.d 1.06E6 3 3 418 441 Pyro-glu from Q; Carbamidomethylation
K.AC(+57.02)QE(+14.02)HEQWAGAALSK.Q Y 101.57 1698.7783 15 6.5 567.2704 3 59.39 2 25478 AEV_1_3_RA2_01_1232.d 1.1E6 6 6 382 396 Carbamidomethylation; Methylation(others)
R.KATYC(+57.02)MFTR.I Y 101.10 1176.5420 9 4.3 393.1896 3 54.06 2 22556 AEV_1_3_RA2_01_1232.d 3.86E6 11 11 442 450 Carbamidomethylation
K.FYTEQGNWDWVFNNTPVFFLRDPSKFPIFIHTQK.R Y 100.96 4218.0791 34 8.0 844.6299 5 92.18 3 55883 AEV_3_3_RA3_01_1233.d 6.06E5 4 4 101 134
K.GAGAYGE(+14.02)FEVLDDISDITVIDMLLGVGKK.T Y 100.80 3038.5520 29 2.6 1013.8606 3 97.55 3 58257 AEV_3_3_RA3_01_1233.d 1.91E5 1 1 43 71 Methylation(others)
K.AIERGEYPSWTC(+57.02)YVQVLSPEQAEK(+14.02).F Y 100.39 2853.3643 24 3.6 952.1321 3 83.08 2 42932 AEV_1_3_RA2_01_1232.d 4.51E5 2 2 233 256 Carbamidomethylation; Methylation(KR)
R.FGRFTLC(+57.02)ENPQNYFAEIEQAAFSPSHMVPGVEPSADPVLQSR.L Y 99.22 4722.2271 42 4.1 945.4565 5 90.79 2 47633 AEV_1_3_RA2_01_1232.d 3.88E5 3 3 278 319 Carbamidomethylation
K.TDQGNKTFNNEEATK(+14.02).M Y 98.43 1709.7856 15 3.9 570.9380 3 30.85 2 11153 AEV_1_3_RA2_01_1232.d 6.41E6 10 10 203 217 Methylation(KR)
K.M(+15.99)AADNPDWHTEDLFKAIER.G Y 98.09 2274.0376 19 -1.6 569.5157 4 78.69 2 39548 AEV_1_3_RA2_01_1232.d 1.86E5 2 2 218 236 Oxidation (M)
R.MVASQPQSHL Y 97.37 1096.5336 10 2.8 549.2756 2 46.26 2 18629 AEV_1_3_RA2_01_1232.d 1.11E7 23 23 466 475
K.TDQGNKTFN(+.98)NEEATK.M Y 97.18 1696.7540 15 4.0 566.5942 3 23.27 3 9608 AEV_3_3_RA3_01_1233.d 2.91E6 11 11 203 217 Deamidation (NQ)
R.QPGQQENFVHNVSVHLC(+57.02)GAQEK(+14.02).V Y 97.08 2519.1975 22 4.1 630.8092 4 69.19 2 32247 AEV_1_3_RA2_01_1232.d 6.57E5 3 3 418 439 Carbamidomethylation; Methylation(KR)
K.AC(+57.02)Q(+.98)EHEQWAGAALSK.Q Y 97.02 1685.7467 15 2.1 562.9240 3 55.55 3 29257 AEV_3_3_RA3_01_1233.d 1.06E6 5 5 382 396 Carbamidomethylation; Deamidation (NQ)
R.LGVNYQQIPVNC(+57.02)PLR(+14.02).A Y 96.39 1783.9403 15 0.6 892.9780 2 78.01 2 38999 AEV_1_3_RA2_01_1232.d 1.11E6 4 4 331 345 Carbamidomethylation; Methylation(KR)
R.FTLC(+57.02)ENPQNYFAEIEQAAFS(+58.03)PSHMVPGVEPSADPVLQSR.L Y 96.31 4420.0654 39 -0.8 1106.0227 4 87.95 3 53571 AEV_3_3_RA3_01_1233.d 4.18E5 1 1 281 319 Carbamidomethylation; 2,3-dihydro-2,2-dimethyl-7-benzofuranol N-methyl carbamate
K.VWPQAEVPLRR.F Y 96.23 1349.7567 11 3.9 450.9279 3 67.19 2 30809 AEV_1_3_RA2_01_1232.d 1.02E7 8 8 267 277
R.HRLGVNYQ(+.98)QIPVNC(+57.02)PLR.A Y 95.55 2064.0686 17 11.8 517.0305 4 68.75 2 31917 AEV_1_3_RA2_01_1232.d 4.68E5 3 3 329 345 Deamidation (NQ); Carbamidomethylation
K.TDQGNKTFNNE(+14.02)EATK.M Y 95.53 1709.7856 15 4.2 570.9382 3 31.59 2 11447 AEV_1_3_RA2_01_1232.d 1.77E6 8 8 203 217 Methylation(others)
K.MAADNPDWHTE(+14.02)DLFK.A Y 93.79 1802.7933 15 1.5 601.9393 3 77.30 2 38411 AEV_1_3_RA2_01_1232.d 5.71E5 2 2 218 232 Methylation(others)
K.AC(+57.02)QEHE(+14.02)QWAGAALSK.Q Y 93.33 1698.7783 15 4.1 567.2690 3 60.93 2 26483 AEV_1_3_RA2_01_1232.d 5.75E5 4 4 382 396 Carbamidomethylation; Methylation(others)
K.TDQ(+.98)GNKTFNNEEATK.M Y 93.32 1696.7540 15 2.5 566.5934 3 24.15 3 10083 AEV_3_3_RA3_01_1233.d 2.78E6 4 4 203 217 Deamidation (NQ)
R.LGVNYQQIPVN(+.98)C(+57.02)PLR.A Y 92.63 1770.9087 15 0.4 886.4620 2 78.11 2 39063 AEV_1_3_RA2_01_1232.d 1.81E6 4 4 331 345 Deamidation (NQ); Carbamidomethylation
K.GPLLLQDFHLIDLLAHFDR.E Y 92.16 2232.2056 19 4.5 559.0612 4 93.12 3 56367 AEV_3_3_RA3_01_1233.d 5.25E5 6 6 13 31
K.AC(+57.02)QEHEQW(+31.99)AGAALSK.Q Y 90.46 1716.7526 15 8.0 573.2627 3 34.33 3 15941 AEV_3_3_RA3_01_1233.d 1.66E6 11 11 382 396 Carbamidomethylation; Dihydroxy
K.MAADN(+.98)PDWHTEDLFK.A Y 88.54 1789.7617 15 8.9 597.5999 3 74.82 3 43982 AEV_3_3_RA3_01_1233.d 2.73E5 1 1 218 232 Deamidation (NQ)
R.DGAM(+15.99)AINGNYGANPNYPSTFRPM(+15.99)EFKPVK.A Y 88.31 3217.4961 29 -0.2 805.3811 4 72.81 3 42432 AEV_3_3_RA3_01_1233.d 3.23E5 2 2 353 381 Oxidation (M)
K.GPLLLQDFHLIDLLAHFDRER(+14.02).I Y 88.09 2531.3647 21 0.7 507.2806 5 91.37 3 55484 AEV_3_3_RA3_01_1233.d 1.42E5 1 1 13 33 Methylation(KR)
K.Q(-17.03)IPVTDEDFVQPNGLWK(+14.02).V Y 87.94 1981.9785 17 -1.1 991.9954 2 90.61 3 55043 AEV_3_3_RA3_01_1233.d 1.18E6 4 4 397 413 Pyro-glu from Q; Methylation(KR)
R.NPQTNLKDATMFWDYLSTHQESAHQVMHLFSDR.G Y 87.83 3946.8154 33 7.9 790.3766 5 85.51 3 52040 AEV_3_3_RA3_01_1233.d 3E4 2 2 136 168
K.VLGRQPGQQE(+14.02)NFVHNVSVHLC(+57.02)GAQEK.V Y 87.81 2944.4727 26 5.2 589.9048 5 70.34 2 33099 AEV_1_3_RA2_01_1232.d 3.21E5 1 1 414 439 Methylation(others); Carbamidomethylation
K.QIPVTDEDFVQPN(+.98)GLWK.V Y 87.40 1985.9734 17 2.4 993.9963 2 83.22 2 43033 AEV_1_3_RA2_01_1232.d 2.49E6 7 7 397 413 Deamidation (NQ)
K.ATERM(+15.99)VASQPQSHL Y 87.37 1569.7570 14 0.8 785.8864 2 35.32 3 16560 AEV_3_3_RA3_01_1233.d 8.31E5 8 8 462 475 Oxidation (M)
R.WNVFDLTKVWPQAEVPLR(+14.02)R.F Y 85.50 2367.2852 19 4.9 592.8315 4 87.98 3 53615 AEV_3_3_RA3_01_1233.d 3.79E5 2 2 259 277 Methylation(KR)
K.VLGRQPGQ(+.98)QENFVHNVSVHLC(+57.02)GAQEK.V Y 85.14 2931.4409 26 5.9 587.2989 5 69.64 2 32574 AEV_1_3_RA2_01_1232.d 4.76E5 2 2 414 439 Deamidation (NQ); Carbamidomethylation
R.FSTVGGEKGSADSAR(+14.02)DPR.G Y 84.99 1849.8918 18 4.0 463.4821 4 39.24 2 15102 AEV_1_3_RA2_01_1232.d 1.85E6 6 6 78 95 Methylation(KR)
K.TDQGNKTFNN(+.98)EEATK.M Y 84.84 1696.7540 15 7.4 566.5961 3 26.12 2 8992 AEV_1_3_RA2_01_1232.d 8.72E5 4 4 203 217 Deamidation (NQ)
K.FRWNVFDLTK.V Y 84.75 1324.6927 10 5.1 442.5738 3 81.48 2 41729 AEV_1_3_RA2_01_1232.d 3.31E6 7 7 257 266
K.ATYC(+57.02)MFTR.I Y 84.42 1048.4470 8 11.0 525.2366 2 62.62 2 27638 AEV_1_3_RA2_01_1232.d 2.06E6 3 3 443 450 Carbamidomethylation
R.FSTVGGEKGSADSARDPR(+14.02).G Y 84.26 1849.8918 18 0.9 463.4807 4 36.95 3 17560 AEV_3_3_RA3_01_1233.d 9.62E5 3 3 78 95 Methylation(KR)
R.LGVNYQQIPVNC(+57.02)PLRAFNPYQR.D Y 84.25 2646.3489 22 -0.6 883.1230 3 81.07 3 48892 AEV_3_3_RA3_01_1233.d 3.36E5 2 2 331 352 Carbamidomethylation
K.TFNNEEATK.M Y 84.24 1052.4774 9 3.7 527.2479 2 19.03 2 6050 AEV_1_3_RA2_01_1232.d 7.53E6 19 19 209 217
K.AIER(+14.02)GEYPSWTC(+57.02)YVQVLSPEQAEK.F Y 83.73 2853.3643 24 4.2 952.1327 3 82.68 2 42637 AEV_1_3_RA2_01_1232.d 4.51E5 2 2 233 256 Methylation(KR); Carbamidomethylation
K.DATM(+15.99)FWDYLSTHQESAHQVMHLFSDR.G Y 83.57 3167.3865 26 0.2 634.4847 5 85.12 3 51773 AEV_3_3_RA3_01_1233.d 9.36E4 1 1 143 168 Oxidation (M)
K.TDQGN(+.98)KTFNNEEATK.M Y 81.66 1696.7540 15 4.2 566.5943 3 24.59 3 10335 AEV_3_3_RA3_01_1233.d 2.88E6 5 5 203 217 Deamidation (NQ)
K.GAGAYGEFEVLDDISDITVIDMLLGVGK(+43.01)K(+14.02).T Y 81.47 3081.5579 29 2.6 771.3987 4 92.10 2 48247 AEV_1_3_RA2_01_1232.d 7.2E5 2 2 43 71 Carbamylation; Methylation(KR)
K.AC(+57.02)QEHEQW(+3.99)AGAALSK.Q Y 81.30 1688.7577 15 1.3 845.3872 2 45.89 3 23130 AEV_3_3_RA3_01_1233.d 9.16E5 5 5 382 396 Carbamidomethylation; Tryptophan oxidation to kynurenin
R.DGAM(+15.99)AIN(+.98)GNYGANPNYPSTFRPM(+15.99)EFKPVK.A Y 81.25 3218.4800 29 5.0 805.6313 4 73.87 3 43247 AEV_3_3_RA3_01_1233.d 2.35E5 2 2 353 381 Oxidation (M); Deamidation (NQ)
K.AC(+57.02)QEHEQW(+15.99)AGAALSK.Q Y 81.20 1700.7577 15 2.4 567.9279 3 47.27 3 23985 AEV_3_3_RA3_01_1233.d 1.17E6 8 8 382 396 Carbamidomethylation; Oxidation (HW)
K.TD(+14.02)QGNKTFNNEEATK.M Y 80.97 1709.7856 15 2.3 570.9371 3 23.84 3 9917 AEV_3_3_RA3_01_1233.d 5.99E5 3 3 203 217 Methylation(others)
R.Q(-17.03)PGQQ(+.98)ENFVHNVSVHLC(+57.02)GAQEK.V Y 79.81 2489.1394 22 -5.1 830.7162 3 76.09 3 44990 AEV_3_3_RA3_01_1233.d 6.77E4 1 1 418 439 Pyro-glu from Q; Deamidation (NQ); Carbamidomethylation
K.ATERMVASQPQSHL Y 78.10 1553.7620 14 6.2 518.9312 3 49.81 2 20352 AEV_1_3_RA2_01_1232.d 1.61E5 1 1 462 475
R.WNVFDLTK.V Y 77.77 1021.5233 8 -3.1 511.7673 2 82.27 3 49793 AEV_3_3_RA3_01_1233.d 7.16E6 11 11 259 266
K.M(+15.99)AADNPDWHTEDLFK(+14.02).A Y 77.68 1818.7882 15 1.1 607.2707 3 75.29 3 44356 AEV_3_3_RA3_01_1233.d 6.35E5 6 6 218 232 Oxidation (M); Methylation(KR)
K.FYTEQGNWDWVFNNTPVFFLR.D Y 77.64 2679.2546 21 1.5 1340.6366 2 96.08 3 57680 AEV_3_3_RA3_01_1233.d 1.76E5 3 3 101 121
R.INQDLGARIEK.A Y 76.76 1255.6884 11 0.2 628.8516 2 45.04 3 22619 AEV_3_3_RA3_01_1233.d 7.11E6 8 8 451 461
K.VWPQAEVPLR.R Y 76.74 1193.6556 10 2.2 597.8364 2 73.63 2 35597 AEV_1_3_RA2_01_1232.d 1.47E6 5 5 267 276
K.TFN(+.98)NEEATK.M Y 75.93 1053.4614 9 1.8 527.7390 2 22.48 3 9146 AEV_3_3_RA3_01_1233.d 7.14E5 5 5 209 217 Deamidation (NQ)
R.GEY(-2.02)PSWTC(+57.02)YVQVLSPEQAEKFR.W Y 74.96 2671.2375 22 54.7 891.4685 3 84.29 2 43820 AEV_1_3_RA2_01_1232.d 0 1 1 237 258 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.IPERVVHAK.G Y 73.89 1047.6189 9 -1.8 524.8158 2 19.41 3 7524 AEV_3_3_RA3_01_1233.d 9.55E5 5 5 34 42
K.VLGRQPGQQEN(+.98)FVHNVSVHLC(+57.02)GAQEK.V Y 73.29 2931.4409 26 26.4 587.3109 5 70.90 2 33519 AEV_1_3_RA2_01_1232.d 4.76E5 2 2 414 439 Deamidation (NQ); Carbamidomethylation
K.QIPVTD(+14.02)EDFVQPNGLWK.V Y 72.68 1999.0050 17 -0.6 1000.5092 2 83.69 3 50803 AEV_3_3_RA3_01_1233.d 2.58E5 1 1 397 413 Methylation(others)
K.AIERGEYPSWTC(+57.02)YVQ(+.98)VLSPEQAEK.F Y 72.62 2840.3328 24 3.1 947.7878 3 82.30 3 49812 AEV_3_3_RA3_01_1233.d 9.71E4 1 1 233 256 Carbamidomethylation; Deamidation (NQ)
R.HM(+15.99)NGYSGHTYK.W Y 72.29 1309.5510 11 2.5 655.7844 2 12.79 3 3926 AEV_3_3_RA3_01_1233.d 1.86E5 3 3 176 186 Oxidation (M)
R.INQDLGARIEKATER.M Y 72.08 1712.9169 15 4.7 429.2385 4 60.60 3 32870 AEV_3_3_RA3_01_1233.d 6.83E5 3 3 451 465
K.TDQGNKTFNNEEATK(+28.03).M Y 71.86 1723.8013 15 0.6 575.6080 3 39.83 3 19347 AEV_3_3_RA3_01_1233.d 4.84E5 3 3 203 217 Dimethylation(KR)
R.DGAMAIN(+.98)GN(+.98)YGANPNYPSTFRPMEFKPVK.A Y 71.55 3187.4741 29 7.4 797.8817 4 78.74 2 39556 AEV_1_3_RA2_01_1232.d 2.86E5 1 1 353 381 Deamidation (NQ)
R.M(+31.99)VASQPQSHL Y 71.48 1128.5233 10 0.7 565.2693 2 37.83 3 18148 AEV_3_3_RA3_01_1233.d 1.7E6 8 8 466 475 Sulphone
R.VGVKGPLLLQDFHLIDLLAHFDR(+14.02).E Y 71.33 2629.4744 23 -5.0 526.8995 5 90.87 3 55193 AEV_3_3_RA3_01_1233.d 7.1E4 1 1 9 31 Methylation(KR)
R.DGAM(+15.99)AINGN(+.98)YGANPNYPSTFRPMEFKPVK.A Y 71.23 3202.4851 29 5.3 801.6328 4 76.93 2 38122 AEV_1_3_RA2_01_1232.d 4.39E5 1 1 353 381 Oxidation (M); Deamidation (NQ)
R.LFSYPDTHRHR.L Y 70.99 1427.7058 11 0.4 476.9094 3 37.37 3 17855 AEV_3_3_RA3_01_1233.d 6.51E6 14 14 320 330
K.Q(+.98)IPVTDEDFVQPN(+.98)GLWK.V Y 70.44 1986.9574 17 2.6 994.4885 2 83.45 3 50634 AEV_3_3_RA3_01_1233.d 5.19E5 4 4 397 413 Deamidation (NQ)
R.FSTVGGEK(+14.02)GSADSARDPR.G Y 70.15 1849.8918 18 0.9 617.6384 3 40.07 3 19470 AEV_3_3_RA3_01_1233.d 2.97E6 8 8 78 95 Methylation(KR)
R.MVASQ(+.98)PQSHL Y 69.72 1097.5176 10 0.8 549.7665 2 49.49 3 25456 AEV_3_3_RA3_01_1233.d 2.41E6 8 8 466 475 Deamidation (NQ)
R.MVASQPQ(+.98)SHL Y 69.30 1097.5176 10 5.2 549.7689 2 50.24 2 20562 AEV_1_3_RA2_01_1232.d 1.26E6 6 6 466 475 Deamidation (NQ)
R.M(+15.99)VASQPQ(+.98)SHL Y 69.20 1113.5125 10 3.6 557.7655 2 37.73 3 18022 AEV_3_3_RA3_01_1233.d 3.79E6 13 13 466 475 Oxidation (M); Deamidation (NQ)
R.Q(-17.03)PGQQENFVHNVSVHLC(+57.02)GAQ(+.98)EK.V Y 68.20 2489.1394 22 2.6 830.7225 3 74.70 3 43898 AEV_3_3_RA3_01_1233.d 4.3E5 3 3 418 439 Pyro-glu from Q; Carbamidomethylation; Deamidation (NQ)
K.M(-48.00)AADNPDWHTEDLFK.A Y 68.06 1740.7743 15 3.1 436.2022 4 66.83 3 37761 AEV_3_3_RA3_01_1233.d 1.62E6 4 4 218 232 Dethiomethyl
R.FTLC(+57.02)ENPQNYFAEIEQAAFS(+13.03)PSHMVPGVEPSADPVLQSR.L Y 67.83 4375.0679 39 -4.3 1094.7695 4 92.74 3 56183 AEV_3_3_RA3_01_1233.d 0 1 1 281 319 Carbamidomethylation; Michael addition with methylamine
R.M(+15.99)VASQ(+.98)PQSHL Y 67.37 1113.5125 10 4.0 557.7657 2 39.76 3 19259 AEV_3_3_RA3_01_1233.d 6.84E5 8 8 466 475 Oxidation (M); Deamidation (NQ)
R.LFSYPDTHR(+14.02).H Y 66.76 1148.5614 9 3.0 383.8622 3 58.45 2 24930 AEV_1_3_RA2_01_1232.d 2.82E6 9 9 320 328 Methylation(KR)
R.GTPYSYR.H Y 66.20 842.3922 7 3.6 422.2049 2 32.21 2 11741 AEV_1_3_RA2_01_1232.d 1.19E7 13 13 169 175
R.Q(-17.03)PGQQENFVHNVSVHLC(+57.02)GAQEKVR(+14.02).K Y 66.05 2757.3406 24 0.4 690.3427 4 74.00 3 43350 AEV_3_3_RA3_01_1233.d 0 1 1 418 441 Pyro-glu from Q; Carbamidomethylation; Methylation(KR)
K.TDQ(+.98)GNKTFNNEEATK(+14.02).M Y 65.36 1710.7697 15 1.7 571.2648 3 33.41 3 15377 AEV_3_3_RA3_01_1233.d 1.09E6 4 4 203 217 Deamidation (NQ); Methylation(KR)
R.INQDLGAR.I Y 64.95 885.4668 8 -88.2 443.7016 2 37.56 1 13022 AEV 2_3_RA2_01_1224.d 1.66E7 14 14 451 458
K.FPIFIHTQK.R Y 64.87 1129.6284 9 -1.5 377.5495 3 67.56 3 38332 AEV_3_3_RA3_01_1233.d 6.3E5 4 4 126 134
K.TFNN(+.98)EEATK.M Y 64.06 1053.4614 9 -66.9 527.7028 2 28.65 1 8292 AEV 2_3_RA2_01_1224.d 1.54E6 6 6 209 217 Deamidation (NQ)
K.QIPVTDEDFVQPN(+.98)GLWK(+14.02).V Y 63.16 1999.9890 17 1.6 1001.0034 2 84.11 3 51098 AEV_3_3_RA3_01_1233.d 3.06E5 2 2 397 413 Deamidation (NQ); Methylation(KR)
K.MAADNPDWHTEDLFK(+14.02).A Y 63.11 1802.7933 15 2.4 601.9398 3 76.84 3 45572 AEV_3_3_RA3_01_1233.d 6.03E5 2 2 218 232 Methylation(KR)
R.FSTVGGEK(+14.02)GSADSAR.D Y 63.10 1481.7109 15 -0.2 741.8626 2 35.93 3 16924 AEV_3_3_RA3_01_1233.d 8.05E5 5 5 78 92 Methylation(KR)
R.FSTVGGEK(+14.02).G Y 63.00 837.4232 8 2.4 419.7199 2 35.43 2 13274 AEV_1_3_RA2_01_1232.d 3.53E6 10 10 78 85 Methylation(KR)
R.FTLC(+57.02)ENPQNYFAEIEQAAFSPS(+58.03)HMVPGVEPSADPVLQSR.L Y 63.00 4420.0654 39 1.1 885.0214 5 88.38 3 53815 AEV_3_3_RA3_01_1233.d 3.31E5 1 1 281 319 Carbamidomethylation; 2,3-dihydro-2,2-dimethyl-7-benzofuranol N-methyl carbamate
R.LGVNYQ(+.98)QIPVN(+.98)C(+57.02)PLR.A Y 62.68 1771.8927 15 2.6 886.9559 2 78.19 3 46683 AEV_3_3_RA3_01_1233.d 2.58E5 2 2 331 345 Deamidation (NQ); Carbamidomethylation
K.TFNNE(+14.02)EATK.M Y 62.56 1066.4930 9 1.9 534.2548 2 28.57 3 12561 AEV_3_3_RA3_01_1233.d 5.09E6 4 4 209 217 Methylation(others)
K.MAAD(+14.02)NPDWHTEDLFK.A Y 62.14 1802.7933 15 -1.9 601.9373 3 76.42 3 45238 AEV_3_3_RA3_01_1233.d 9.29E4 1 1 218 232 Methylation(others)
R.DPSKFPIFIHTQKR.N Y 62.13 1712.9362 14 -4.3 343.5930 5 63.02 3 34758 AEV_3_3_RA3_01_1233.d 1.16E6 3 3 122 135
K.TFNNEEATK(+14.02).M Y 61.80 1066.4930 9 0.0 534.2538 2 28.15 3 12329 AEV_3_3_RA3_01_1233.d 4.02E6 6 6 209 217 Methylation(KR)
K.AC(+57.02)QEHEQ(+.98)W(+31.99)AGAALSK.Q Y 61.25 1717.7366 15 3.2 573.5880 3 41.08 3 20055 AEV_3_3_RA3_01_1233.d 9.19E4 1 1 382 396 Carbamidomethylation; Deamidation (NQ); Dihydroxy
R.VGVKGPLLLQDFHLIDLLAHFDRER(+14.02).I Y 59.98 2914.6179 25 -11.0 583.9244 5 88.38 3 53816 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 9 33 Methylation(KR)
R.FSTVGGEK.G Y 59.89 823.4075 8 4.5 412.7129 2 23.63 2 7898 AEV_1_3_RA2_01_1232.d 7.98E6 9 9 78 85
K.Q(-15.01)IPVTDEDFVQPNGLWK.V Y 59.61 1969.9785 17 -5.2 985.9915 2 89.17 3 54249 AEV_3_3_RA3_01_1233.d 3.21E5 1 1 397 413 ISD (z+2)-series
K.MAADNPD(+14.02)WHTEDLFK.A Y 59.57 1802.7933 15 8.1 601.9432 3 75.61 3 44608 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 218 232 Methylation(others)
R.AFNPYQR.D Y 59.25 894.4348 7 1.7 448.2254 2 43.91 2 17390 AEV_1_3_RA2_01_1232.d 2.24E7 12 12 346 352
K.FRWNVFDLTKVWPQAEVPLR(+14.02)R.F Y 59.25 2670.4546 21 11.2 535.1042 5 86.61 3 52777 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 257 277 Methylation(KR)
K.T(+164.06)DQGNKTFNNEEATK.M Y 59.03 1859.8302 15 8.9 620.9562 3 18.29 3 6917 AEV_3_3_RA3_01_1233.d 4.3E4 1 1 203 217 O-Diisopropylphosphorylation
K.ATER(+14.02)M(+15.99)VASQPQSHL Y 58.62 1583.7726 14 1.1 528.9321 3 43.53 3 21622 AEV_3_3_RA3_01_1233.d 2.98E5 2 2 462 475 Methylation(KR); Oxidation (M)
R.WNVFDLTKVWPQ(+.98)AEVPLRR.F Y 58.46 2354.2534 19 8.2 589.5754 4 87.64 3 53385 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 259 277 Deamidation (NQ)
R.HRLGVNYQQIPVNC(+57.02)PLR(+14.02).A Y 57.93 2077.1003 17 -1.4 520.2816 4 70.88 2 33510 AEV_1_3_RA2_01_1232.d 2.48E5 2 2 329 345 Carbamidomethylation; Methylation(KR)
K.TDQGNKTFNNEEAT(+164.06)K.M Y 57.90 1859.8302 15 7.7 620.9554 3 19.59 3 7665 AEV_3_3_RA3_01_1233.d 2.91E5 3 3 203 217 O-Diisopropylphosphorylation
R.LGVNYQ(+.98)QIPVNC(+57.02)PLR(+14.02).A Y 57.80 1784.9243 15 -0.9 893.4686 2 78.84 2 39639 AEV_1_3_RA2_01_1232.d 1.69E5 2 2 331 345 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
R.FTLC(+57.02)ENPQ(+.98)NYFAEIEQAAFSPSHMVPGVEPSADPVLQSR.L Y 57.76 4363.0200 39 2.6 1091.7651 4 92.86 3 56242 AEV_3_3_RA3_01_1233.d 2.31E5 1 1 281 319 Carbamidomethylation; Deamidation (NQ)
K.QIPVTDEDFVQPNGLWK(+14.02).V Y 57.48 1999.0050 17 -3.2 1000.5065 2 83.37 3 50626 AEV_3_3_RA3_01_1233.d 2.93E5 3 3 397 413 Methylation(KR)
K.ATYC(+57.02)M(+15.99)FTR.I Y 57.40 1064.4419 8 0.7 533.2286 2 45.34 3 22771 AEV_3_3_RA3_01_1233.d 1.5E6 11 11 443 450 Carbamidomethylation; Oxidation (M)
K.VWPQAEVPLR(+14.02)R.F Y 57.20 1363.7725 11 -2.8 455.5968 3 66.85 3 37739 AEV_3_3_RA3_01_1233.d 5.72E5 2 2 267 277 Methylation(KR)
K.AC(+57.02)QEHEQWAGAALS(-18.01)K(+14.02).Q Y 57.13 1680.7678 15 -1.5 841.3900 2 52.58 3 27438 AEV_3_3_RA3_01_1233.d 1.16E4 1 1 382 396 Carbamidomethylation; Dehydration; Methylation(KR)
R.WN(+.98)VFDLTKVWPQ(+.98)AEVPLRR.F Y 56.82 2355.2375 19 19.6 589.8282 4 87.06 3 53036 AEV_3_3_RA3_01_1233.d 1.46E5 1 1 259 277 Deamidation (NQ)
R.KATYC(+57.02)M(+15.99)FTR.I Y 56.56 1192.5369 9 2.1 597.2770 2 35.54 3 16656 AEV_3_3_RA3_01_1233.d 4.44E6 12 12 442 450 Carbamidomethylation; Oxidation (M)
K.TDQGNKTFN(+.98)NEEATK(+14.02).M Y 56.20 1710.7697 15 4.9 571.2666 3 33.84 3 15632 AEV_3_3_RA3_01_1233.d 6.19E5 2 2 203 217 Deamidation (NQ); Methylation(KR)
R.DGAMAINGNY(+15.01)GANPNYPSTFRPMEFKPVK.A Y 56.11 3200.5171 29 -3.6 641.1084 5 76.07 3 44975 AEV_3_3_RA3_01_1233.d 0 1 1 353 381 Tyrosine oxidation to 2-aminotyrosine
R.WNVFDLTKVWPQAEVPLR(+14.02).R Y 56.11 2211.1841 18 -3.9 738.0657 3 91.81 2 48086 AEV_1_3_RA2_01_1232.d 4.4E4 1 1 259 276 Methylation(KR)
K.RNPQTNLK.D Y 55.91 969.5356 8 1.4 485.7758 2 12.08 3 3532 AEV_3_3_RA3_01_1233.d 6.48E5 3 3 135 142
R.WNVFDLTK(+14.02).V Y 55.49 1035.5389 8 2.6 518.7781 2 83.60 2 43347 AEV_1_3_RA2_01_1232.d 1.31E6 6 6 259 266 Methylation(KR)
R.NPQTNLK.D Y 55.22 813.4344 7 -86.5 407.6893 2 24.15 1 6218 AEV 2_3_RA2_01_1224.d 8.36E5 3 3 136 142
R.HMN(+.98)GYSGHTYK.W Y 55.06 1294.5400 11 8.9 648.2831 2 19.70 3 7681 AEV_3_3_RA3_01_1233.d 9.87E4 2 2 176 186 Deamidation (NQ)
K.M(+15.99)AADNPDW(+31.99)HTEDLFK.A Y 54.92 1836.7625 15 24.0 613.2761 3 65.66 2 29700 AEV_1_3_RA2_01_1232.d 0 1 1 218 232 Oxidation (M); Dihydroxy
K.VLGRQPGQQ(+15.00)ENFVHNVSVHLC(+57.02)GAQEK.V Y 54.57 2945.4565 26 9.2 590.1040 5 70.32 2 33083 AEV_1_3_RA2_01_1232.d 3.08E5 1 1 414 439 Deamidation followed by a methylation; Carbamidomethylation
R.M(+15.99)VASQ(+.98)PQ(+.98)SHL Y 54.39 1114.4965 10 19.6 558.2664 2 39.79 3 19285 AEV_3_3_RA3_01_1233.d 1.86E6 8 8 466 475 Oxidation (M); Deamidation (NQ)
R.WN(+.98)VFDLTK.V Y 54.21 1022.5073 8 20.9 512.2716 2 82.22 2 42289 AEV_1_3_RA2_01_1232.d 2.39E6 3 3 259 266 Deamidation (NQ)
R.WNVFDLTKVWPQAEVPLRR(+14.02).F Y 53.99 2367.2852 19 3.2 592.8304 4 88.29 2 46351 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 259 277 Methylation(KR)
K.TDQGNKTFNNE(+28.03)EATK.M Y 53.70 1723.8013 15 4.7 575.6104 3 41.54 2 16223 AEV_1_3_RA2_01_1232.d 4.48E5 3 3 203 217 Ethylation
K.TFNNEEATK(+27.99).M Y 53.68 1080.4723 9 -52.6 541.2150 2 54.59 1 22916 AEV 2_3_RA2_01_1224.d 2.3E5 1 1 209 217 Formylation
K.MAADN(+.98)PDWHTEDLFKAIER.G Y 53.52 2259.0266 19 16.2 754.0283 3 79.39 3 47592 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 218 236 Deamidation (NQ)
K.TFNNEE(+14.02)ATK.M Y 53.12 1066.4930 9 5.4 534.2567 2 28.87 2 10230 AEV_1_3_RA2_01_1232.d 5.09E6 5 5 209 217 Methylation(others)
R.AFNPYQR(+14.02).D Y 53.05 908.4504 7 -0.5 455.2323 2 46.69 3 23648 AEV_3_3_RA3_01_1233.d 3.94E6 7 7 346 352 Methylation(KR)
R.M(+31.99)VASQPQ(+.98)SHL Y 52.93 1129.5073 10 10.0 565.7666 2 42.89 2 16903 AEV_1_3_RA2_01_1232.d 6.32E4 2 2 466 475 Sulphone; Deamidation (NQ)
R.LGVNYQQ(+.98)IPVN(+.98)C(+57.02)PLR.A Y 52.57 1771.8927 15 24.1 591.6524 3 76.46 2 37754 AEV_1_3_RA2_01_1232.d 3.05E5 2 2 331 345 Deamidation (NQ); Carbamidomethylation
R.DGAMAINGNYGANPNYPSTFRPM(+15.99)EFKPVK.A Y 52.36 3201.5012 29 22.3 801.4004 4 75.84 2 37267 AEV_1_3_RA2_01_1232.d 8.31E4 3 3 353 381 Oxidation (M)
K.TDQ(+.98)GNKTFN(+.98)NEEATK.M Y 52.07 1697.7380 15 6.5 566.9236 3 28.34 2 9966 AEV_1_3_RA2_01_1232.d 0 1 1 203 217 Deamidation (NQ)
R.M(+43.01)VASQPQSHL Y 51.91 1139.5393 10 0.4 570.7772 2 37.36 3 17860 AEV_3_3_RA3_01_1233.d 5.58E5 3 3 466 475 Carbamylation
R.DPSKFPIFIHTQ(+.98)K.R Y 51.82 1557.8191 13 3.3 390.4633 4 70.19 2 32999 AEV_1_3_RA2_01_1232.d 9.79E4 1 1 122 134 Deamidation (NQ)
K.GPLLLQ(+.98)DFHLIDLLAHFDRER.I Y 51.81 2518.3333 21 2.4 504.6751 5 91.38 3 55468 AEV_3_3_RA3_01_1233.d 0 1 1 13 33 Deamidation (NQ)
R.FGRFTLC(+57.02)ENPQNYFAEIEQAAFSPSHM(+15.99)VPGVEPSADPVLQSR.L Y 51.57 4738.2222 42 2.1 1185.5653 4 89.00 3 54151 AEV_3_3_RA3_01_1233.d 9.85E4 2 2 278 319 Carbamidomethylation; Oxidation (M)
K.FRWNVFDLTK(+14.02).V Y 51.45 1338.7084 10 -3.6 447.2418 3 81.90 3 49520 AEV_3_3_RA3_01_1233.d 6.01E5 4 4 257 266 Methylation(KR)
R.AFNPYQ(+.98)R.D Y 51.32 895.4188 7 0.4 448.7169 2 44.67 3 22346 AEV_3_3_RA3_01_1233.d 9.34E6 11 11 346 352 Deamidation (NQ)
R.M(+31.99)VASQ(+.98)PQSHL Y 51.27 1129.5073 10 8.3 565.7656 2 42.87 3 21197 AEV_3_3_RA3_01_1233.d 8.3E4 2 2 466 475 Sulphone; Deamidation (NQ)
R.WN(-17.03)VFDLTK.V Y 50.86 1004.4967 8 -3.4 1005.5006 1 92.40 2 48339 AEV_1_3_RA2_01_1232.d 4.85E4 1 1 259 266 Ammonia-loss (N)
R.INQDLGAR(+14.02).I Y 50.82 899.4825 8 3.0 450.7498 2 36.88 2 13988 AEV_1_3_RA2_01_1232.d 3.81E6 7 7 451 458 Methylation(KR)
K.MAADNPDW(+31.99)HTEDLFK.A Y 50.48 1820.7676 15 6.9 607.9340 3 68.52 2 31740 AEV_1_3_RA2_01_1232.d 7.1E4 1 1 218 232 Dihydroxy
K.TDQGN(+.98)KTFNNEEATK(+14.02).M Y 50.21 1710.7697 15 10.3 571.2697 3 33.01 3 15151 AEV_3_3_RA3_01_1233.d 9.13E5 2 2 203 217 Deamidation (NQ); Methylation(KR)
R.Q(-17.03)PGQQEN(+.98)FVHNVSVHLC(+57.02)GAQEK.V Y 50.02 2489.1394 22 1.4 830.7216 3 75.61 2 37080 AEV_1_3_RA2_01_1232.d 2.48E5 2 2 418 439 Pyro-glu from Q; Deamidation (NQ); Carbamidomethylation
R.GEYPSWTC(+57.02)YVQVLSPEQAEK(+14.02).F Y 49.93 2384.0994 20 5.3 1193.0632 2 85.81 3 52242 AEV_3_3_RA3_01_1233.d 1.82E5 3 3 237 256 Carbamidomethylation; Methylation(KR)
K.QIPVTDEDFVQPNGLW(+15.99)K.V Y 49.66 2000.9843 17 -1.8 1001.4976 2 80.16 3 48192 AEV_3_3_RA3_01_1233.d 2.56E5 2 2 397 413 Oxidation (HW)
R.L(+71.04)FSYPDTHR.H Y 49.65 1205.5829 9 14.7 402.8741 3 53.78 3 28220 AEV_3_3_RA3_01_1233.d 0 1 1 320 328 Propionamide (K, X@N-term)
R.L(+41.03)FSYPDTHR.H Y 48.69 1175.5723 9 1.8 392.8654 3 56.14 2 23630 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 320 328 Amidination of lysines or N-terminal amines with methyl acetimidate
K.GAGAYGEFEVLDDISDITVID(+17.03)MLLGVGKK.T Y 48.18 3041.5630 29 -11.1 1014.8503 3 95.82 3 57568 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 43 71 Replacement of proton with ammonium ion
R.MVASQPQSHL(+14.02) Y 47.95 1110.5492 10 -1.9 556.2808 2 54.71 3 28815 AEV_3_3_RA3_01_1233.d 8.7E5 4 4 466 475 Methylation(C-term)
K.TDQ(+.98)GNKTFNN(+.98)EEATK(+14.02).M Y 47.75 1711.7537 15 25.7 571.6065 3 30.93 2 11141 AEV_1_3_RA2_01_1232.d 2.36E4 1 1 203 217 Deamidation (NQ); Methylation(KR)
R.M(-48.00)VASQPQSHL Y 47.22 1048.5302 10 0.6 525.2726 2 22.87 3 9392 AEV_3_3_RA3_01_1233.d 7.18E6 12 12 466 475 Dethiomethyl
R.INQ(+.98)DLGAR.I Y 47.15 886.4508 8 -83.6 444.1956 2 44.85 1 17203 AEV 2_3_RA2_01_1224.d 2.2E6 7 7 451 458 Deamidation (NQ)
K.TFNN(+.98)EEATK(+14.02).M Y 46.59 1067.4771 9 20.7 534.7568 2 27.82 3 12136 AEV_3_3_RA3_01_1233.d 4.31E5 1 1 209 217 Deamidation (NQ); Methylation(KR)
K.AIERGEYPSWTC(+57.02)Y(+15.99)VQVLSPEQAEK.F Y 46.40 2855.3435 24 9.6 952.7975 3 83.00 3 50312 AEV_3_3_RA3_01_1233.d 3.53E5 2 2 233 256 Carbamidomethylation; Oxidation or Hydroxylation
R.MVASQPQ(+15.00)SHL Y 46.21 1111.5332 10 -2.1 556.7727 2 57.60 3 30652 AEV_3_3_RA3_01_1233.d 7.88E4 1 1 466 475 Deamidation followed by a methylation
R.WNVFD(+14.02)LTK.V Y 45.02 1035.5389 8 7.9 518.7808 2 81.16 2 41478 AEV_1_3_RA2_01_1232.d 1.76E5 1 1 259 266 Methylation(others)
K.VWPQ(+.98)AEVPLRR.F Y 44.60 1350.7407 11 -2.2 451.2532 3 67.96 3 38621 AEV_3_3_RA3_01_1233.d 4.82E5 1 1 267 277 Deamidation (NQ)
R.IN(+.98)QDLGARIEK.A Y 44.04 1256.6724 11 13.8 629.3521 2 45.95 3 23156 AEV_3_3_RA3_01_1233.d 5.84E4 1 1 451 461 Deamidation (NQ)
R.INQDLGARIEK(+14.02).A Y 43.41 1269.7041 11 4.5 424.2439 3 56.65 2 23901 AEV_1_3_RA2_01_1232.d 1.21E6 4 4 451 461 Methylation(KR)
K.TFN(+.98)NEEATK(+14.02).M Y 43.13 1067.4771 9 2.4 534.7471 2 32.51 3 14922 AEV_3_3_RA3_01_1233.d 7.65E5 6 6 209 217 Deamidation (NQ); Methylation(KR)
K.VW(+15.99)PQAEVPLRR.F Y 43.06 1365.7517 11 -7.8 456.2543 3 62.63 3 34486 AEV_3_3_RA3_01_1233.d 5.65E5 3 3 267 277 Oxidation (HW)
R.FSTVGGEKGSADSAR(+28.03)DPR.G Y 42.92 1863.9075 18 0.4 622.3100 3 43.33 3 21495 AEV_3_3_RA3_01_1233.d 4.63E4 1 1 78 95 Dimethylation(KR)
R.QP(+421.07)GQQENFVHNVSVHLC(+57.02)GAQEK.V Y 42.21 2926.2551 22 63.8 586.2957 5 68.49 2 31725 AEV_1_3_RA2_01_1232.d 0 1 1 418 439 Fluorescein-5-thiosemicarbazide; Carbamidomethylation
R.HR(+14.02)LGVNY(-18.01)QQIPVNC(+57.02)PLR.A Y 42.08 2059.0898 17 -13.2 515.7729 4 67.55 3 38297 AEV_3_3_RA3_01_1233.d 3.66E5 2 2 329 345 Methylation(KR); Dehydration; Carbamidomethylation
R.INQ(+.98)DLGARIEK.A Y 42.05 1256.6724 11 4.7 629.3464 2 53.31 2 22149 AEV_1_3_RA2_01_1232.d 4.44E5 2 2 451 461 Deamidation (NQ)
R.LF(+31.99)SYPDTHR.H Y 41.95 1166.5356 9 110.5 389.8955 3 53.63 3 28131 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 320 328 Dihydroxy
R.W(+42.01)NVFDLTK.V Y 41.17 1063.5338 8 -1.4 532.7734 2 82.29 2 42345 AEV_1_3_RA2_01_1232.d 1.32E5 2 2 259 266 Acetylation (N-term)
R.LFSYPDTHR(+.98).H Y 41.14 1135.5298 9 20.0 379.5248 3 56.07 2 23580 AEV_1_3_RA2_01_1232.d 4.78E6 5 5 320 328 Deamidation (R)
R.GTPYSYR(+14.02).H Y 40.63 856.4079 7 5.7 429.2137 2 41.29 2 16090 AEV_1_3_RA2_01_1232.d 1.72E6 6 6 169 175 Methylation(KR)
K.FRWNVFDLTKVWPQ(+.98)AEVPLR.R Y 40.61 2501.3218 20 14.9 626.3470 4 88.29 3 53764 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 257 276 Deamidation (NQ)
R.AFN(+.98)PYQR.D Y 40.27 895.4188 7 -86.3 448.6780 2 59.38 1 26043 AEV 2_3_RA2_01_1224.d 5.42E6 3 3 346 352 Deamidation (NQ)
K.Q(-17.03)IPVTDEDFVQPNGLWKVLGR.Q Y 40.20 2393.2378 21 -29.8 1197.5905 2 90.89 2 47661 AEV_1_3_RA2_01_1232.d 0 1 1 397 417 Pyro-glu from Q
R.LGVNYQQIPVN(+.98)C(+57.02)PLR(+14.02).A Y 39.34 1784.9243 15 -10.5 893.4601 2 80.54 2 40992 AEV_1_3_RA2_01_1232.d 6.22E4 1 1 331 345 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
K.QIPVTDEDFVQPN(+.98)GLW(+15.99)K.V Y 39.09 2001.9684 17 19.3 1002.0107 2 80.88 3 48750 AEV_3_3_RA3_01_1233.d 1.78E5 4 4 397 413 Deamidation (NQ); Oxidation (HW)
R.DGAMAINGNYGANPNYPSTFR(+14.02)PMEFKPVK.A Y 38.74 3199.5220 29 -11.6 800.8785 4 79.26 2 39969 AEV_1_3_RA2_01_1232.d 0 1 1 353 381 Methylation(KR)
K.TD(-18.01)QGNK(+14.02)TFNNEEATK.M Y 38.40 1691.7750 15 8.6 564.9371 3 22.05 3 8919 AEV_3_3_RA3_01_1233.d 0 2 2 203 217 Dehydration; Methylation(KR)
K.QIPVTDEDFVQ(+.98)PN(+.98)GLWK.V Y 38.09 1986.9574 17 10.6 994.4965 2 83.30 2 43101 AEV_1_3_RA2_01_1232.d 1.96E5 1 1 397 413 Deamidation (NQ)
R.VGVK(-1.03)GPLLLQDFHLIDLLAHFDRER.I Y 37.98 2899.5708 25 1.1 725.9008 4 88.64 3 53973 AEV_3_3_RA3_01_1233.d 0 1 1 9 33 Lysine oxidation to aminoadipic semialdehyde
R.MVASQ(+.98)PQ(+.98)SHL Y 37.92 1098.5016 10 21.6 550.2700 2 49.93 2 20410 AEV_1_3_RA2_01_1232.d 3.14E5 4 4 466 475 Deamidation (NQ)
R.IN(+.98)QDLGAR.I Y 37.79 886.4508 8 -86.3 444.1944 2 40.65 1 14790 AEV 2_3_RA2_01_1224.d 1.12E6 7 7 451 458 Deamidation (NQ)
K.T(+79.96)FNNEEATK.M Y 37.77 1132.4342 9 -21.7 567.2121 2 35.71 1 12048 AEV 2_3_RA2_01_1224.d 5.7E4 4 4 209 217 Sulfation
K.Q(+.98)IPVTDEDFVQPNGLWK(+14.02).V Y 37.26 1999.9890 17 -7.6 1000.9942 2 83.40 2 43183 AEV_1_3_RA2_01_1232.d 2.02E4 1 1 397 413 Deamidation (NQ); Methylation(KR)
K.AC(+57.02)QEHEQW(+13.98)AGAALSK.Q Y 37.20 1698.7419 15 -43.9 567.2297 3 69.11 1 33269 AEV 2_3_RA2_01_1224.d 8.87E5 3 3 382 396 Carbamidomethylation; Tryptophan oxidation to oxolactone
K.GAGAYGEFEVLDDIS(+13.03)DITVIDMLLGVGKK.T Y 37.01 3037.5681 29 -9.1 760.3924 4 95.74 3 57538 AEV_3_3_RA3_01_1233.d 0 1 1 43 71 Michael addition with methylamine
K.QIPVTDEDFVQPNGLW(+31.99)K.V Y 36.97 2016.9792 17 -0.8 1009.4961 2 78.72 2 39542 AEV_1_3_RA2_01_1232.d 1.28E5 2 2 397 413 Dihydroxy
K.M(+56.06)AADNPDWHTEDLFK.A Y 36.84 1844.8403 15 -14.0 923.4146 2 66.87 3 37756 AEV_3_3_RA3_01_1233.d 1.46E4 1 1 218 232 Diethylation
R.IEKATER(+14.02).M Y 36.56 859.4763 7 6.4 430.7482 2 12.26 2 3321 AEV_1_3_RA2_01_1232.d 1.52E5 2 2 459 465 Methylation(KR)
K.VWPQAEVPLR(+14.02).R Y 36.54 1207.6713 10 -2.1 604.8416 2 76.20 3 45072 AEV_3_3_RA3_01_1233.d 7.89E4 1 1 267 276 Methylation(KR)
R.DPS(-2.02)KFPIFIHTQKR.N Y 36.21 1710.9205 14 21.7 343.1988 5 63.15 3 34856 AEV_3_3_RA3_01_1233.d 0 1 1 122 135 2-amino-3-oxo-butanoic_acid
R.INQD(+14.02)LGAR.I Y 35.96 899.4825 8 2.4 450.7496 2 32.64 2 11953 AEV_1_3_RA2_01_1232.d 1.63E6 5 5 451 458 Methylation(others)
R.FTLC(+57.02)ENPQ(+.98)NYFAEIEQAAFSPSHM(+15.99)VPGVEPSADPVLQSR.L Y 35.95 4379.0151 39 24.5 1095.7878 4 91.55 2 47974 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 281 319 Carbamidomethylation; Deamidation (NQ); Oxidation (M)
R.ERIPER.V Y 35.86 798.4348 6 6.8 400.2274 2 15.81 2 4665 AEV_1_3_RA2_01_1232.d 3.61E5 2 2 32 37
K.AC(+57.02)QEHEQ(+15.00)WAGAALSK.Q Y 35.45 1699.7623 15 -72.6 567.5536 3 69.07 1 33241 AEV 2_3_RA2_01_1224.d 3.87E5 3 3 382 396 Carbamidomethylation; Deamidation followed by a methylation
K.TFNNEE(+28.03)ATK.M Y 35.34 1080.5088 9 3.6 541.2636 2 41.58 2 16266 AEV_1_3_RA2_01_1232.d 3.2E5 1 1 209 217 Ethylation
R.F(+71.04)TLC(+57.02)ENPQNYFAEIEQAAFSPSHMVPGVEPSADPVLQSR.L Y 35.29 4433.0732 39 6.5 887.6277 5 88.64 2 46538 AEV_1_3_RA2_01_1232.d 2.88E5 1 1 281 319 Propionamide (K, X@N-term); Carbamidomethylation
R.INQDLGAR(+14.02)IEK.A Y 35.06 1269.7041 11 -1.1 635.8586 2 56.68 2 23924 AEV_1_3_RA2_01_1232.d 9.01E5 3 3 451 461 Methylation(KR)
K.F(+43.01)R(+14.02)WNVFDLTK.V Y 34.96 1381.7142 10 4.1 461.5806 3 82.62 3 50038 AEV_3_3_RA3_01_1233.d 8.25E4 2 2 257 266 Carbamylation; Methylation(KR)
R.DPS(+79.97)KFPIFIHTQKR.N Y 34.91 1792.9025 14 7.4 449.2362 4 64.52 2 28910 AEV_1_3_RA2_01_1232.d 0 1 1 122 135 Phosphorylation (STY)
R.FTLC(+57.02)EN(+15.00)PQNYFAEIEQAAFSPSHMVPGVEPSADPVLQSR.L Y 34.90 4377.0356 39 -4.8 1095.2610 4 93.19 2 48660 AEV_1_3_RA2_01_1232.d 4.17E4 1 1 281 319 Carbamidomethylation; Deamidation followed by a methylation
R.HM(+15.99)N(+.98)GYSGHTYK.W Y 34.89 1310.5350 11 7.3 437.8555 3 14.30 2 4080 AEV_1_3_RA2_01_1232.d 4.69E4 2 2 176 186 Oxidation (M); Deamidation (NQ)
K.T(+14.02)DQGNKTFNNEEATK.M Y 34.35 1709.7856 15 1.8 570.9368 3 24.38 3 10224 AEV_3_3_RA3_01_1233.d 2.58E5 1 1 203 217 Methylation(others)
K.TDQGNKTFNN(+.98)EEATK(+14.02).M Y 34.25 1710.7697 15 3.3 571.2657 3 34.23 3 15866 AEV_3_3_RA3_01_1233.d 9.53E5 2 2 203 217 Deamidation (NQ); Methylation(KR)
R.INQD(+14.02)LGARIEK.A Y 34.24 1269.7041 11 -2.6 424.2409 3 47.25 3 23969 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 451 461 Methylation(others)
R.FST(-18.01)VGGEK(+14.02)GSADSARDPR.G Y 34.23 1831.8812 18 5.2 458.9800 4 33.20 3 15258 AEV_3_3_RA3_01_1233.d 0 1 1 78 95 Dehydration; Methylation(KR)
R.L(+42.01)FS(+79.96)YPDTHR.H Y 34.21 1256.5132 9 98.9 419.8864 3 53.81 3 28237 AEV_3_3_RA3_01_1233.d 0 1 1 320 328 Acetylation (N-term); Sulfation
R.L(+43.01)FS(+79.97)YPDTHR.H Y 34.16 1257.5179 9 109.2 420.2257 3 53.71 3 28176 AEV_3_3_RA3_01_1233.d 0 1 1 320 328 Carbamylation; Phosphorylation (STY)
K.AIERGEYPSWTC(+57.02)Y(-2.02)VQVLSPEQAEKFR.W Y 33.90 3140.5024 26 10.9 786.1415 4 82.40 3 49888 AEV_3_3_RA3_01_1233.d 0 1 1 233 258 Carbamidomethylation; 2-amino-3-oxo-butanoic_acid
R.F(+42.01)STVGGEK.G Y 33.78 865.4181 8 -88.0 433.6783 2 35.16 1 11764 AEV 2_3_RA2_01_1224.d 1.69E5 1 1 78 85 Acetylation (N-term)
R.DPSKFPIFIHTQK(+14.02).R Y 33.62 1570.8507 13 -0.8 393.7196 4 68.37 3 38953 AEV_3_3_RA3_01_1233.d 1.56E5 2 2 122 134 Methylation(KR)
R.G(+42.01)TPYSYR.H Y 33.46 884.4028 7 -51.0 443.1862 2 42.70 1 15978 AEV 2_3_RA2_01_1224.d 1.68E5 3 3 169 175 Acetylation (N-term)
R.Q(-17.03)PGQQENFVHN(+.98)VSVHLC(+57.02)GAQEK.V Y 33.25 2489.1394 22 -82.5 830.6520 3 79.53 1 41472 AEV 2_3_RA2_01_1224.d 5.42E5 2 2 418 439 Pyro-glu from Q; Deamidation (NQ); Carbamidomethylation
K.FRWNVFDLTK(-1.03)VWPQAEVPLR.R Y 32.96 2499.3062 20 8.9 625.8394 4 88.85 2 46648 AEV_1_3_RA2_01_1232.d 0 1 1 257 276 Lysine oxidation to aminoadipic semialdehyde
R.W(+31.99)NVFDLTK.V Y 32.57 1053.5131 8 3.9 527.7659 2 76.15 2 37513 AEV_1_3_RA2_01_1232.d 1.36E5 1 1 259 266 Dihydroxy
K.M(-4.99)AADNPDWHTEDLFK.A Y 32.50 1783.7914 15 104.0 595.6663 3 75.06 3 44170 AEV_3_3_RA3_01_1233.d 2.22E5 1 1 218 232 Methionine replacement by azido homoalanine
K.GPLLLQDFHLIDLLAHFDR(+14.02)ER.I Y 32.06 2531.3647 21 -15.4 507.2724 5 92.74 2 48481 AEV_1_3_RA2_01_1232.d 0 1 1 13 33 Methylation(KR)
K.ATYC(+57.02)MFTR(+14.02).I Y 31.94 1062.4626 8 11.0 532.2444 2 65.66 2 29703 AEV_1_3_RA2_01_1232.d 1.26E5 2 2 443 450 Carbamidomethylation; Methylation(KR)
R.NPQTNLK(+14.02).D Y 31.84 827.4501 7 -85.8 414.6968 2 38.75 1 13719 AEV 2_3_RA2_01_1224.d 3.22E5 1 1 136 142 Methylation(KR)
R.LGVNYQQIPVNC(+57.02)P(+13.98)LR.A Y 31.84 1783.9039 15 -69.9 892.8969 2 82.54 1 43831 AEV 2_3_RA2_01_1224.d 7.53E5 2 2 331 345 Carbamidomethylation; Proline oxidation to pyroglutamic acid
K.TFNNEEATK(+28.03).M Y 31.80 1080.5088 9 1.2 541.2623 2 38.67 3 18612 AEV_3_3_RA3_01_1233.d 5.57E5 3 3 209 217 Dimethylation(KR)
R.FSTVGGE(+129.04)KGSADSAR.D Y 31.76 1596.7379 15 6.5 533.2567 3 38.06 3 18231 AEV_3_3_RA3_01_1233.d 2.44E5 2 2 78 92 Monoglutamyl
K.CITRFSTVGGEK.G Y 31.47 1296.6497 12 -20.9 433.2148 3 22.99 3 9440 AEV_3_3_RA3_01_1233.d 5.98E4 1 1 74 85
R.Q(-17.03)PGQQENFVHNVSVHLC(+57.02)GAQEK(+14.02)VR.K Y 31.45 2757.3406 24 2.1 690.3439 4 74.65 2 36359 AEV_1_3_RA2_01_1232.d 0 2 2 418 441 Pyro-glu from Q; Carbamidomethylation; Methylation(KR)
R.LGVNYQQ(+.98)IPVNC(+57.02)PLR.A Y 31.43 1770.9087 15 1.4 886.4628 2 78.42 2 39303 AEV_1_3_RA2_01_1232.d 6.31E5 3 3 331 345 Deamidation (NQ); Carbamidomethylation
R.DGAMAINGNYGANPNYPSTFRPME(+55.92)FKPVK.A Y 31.42 3241.4258 29 22.1 811.3816 4 79.32 1 41300 AEV 2_3_RA2_01_1224.d 0 1 1 353 381 Replacement of 2 protons by nickel
K.AC(+57.02)QEHEQWAGAALSK(-.98).Q Y 31.05 1683.7787 15 -6.0 842.8916 2 52.67 3 27499 AEV_3_3_RA3_01_1233.d 7.75E5 2 2 382 396 Carbamidomethylation; Amidation
R.KATYC(+57.02)M(-48.00)FTR.I Y 30.86 1128.5386 9 2.0 377.1876 3 21.06 3 8424 AEV_3_3_RA3_01_1233.d 3.69E6 4 4 442 450 Carbamidomethylation; Dethiomethyl
K.VW(+31.99)PQAEVPLRR.F Y 30.83 1381.7466 11 7.3 461.5928 3 58.87 3 31575 AEV_3_3_RA3_01_1233.d 0 1 1 267 277 Dihydroxy
R.FSTVGGEKGSADSAR(+14.02).D Y 30.73 1481.7109 15 6.7 494.9142 3 35.40 2 13261 AEV_1_3_RA2_01_1232.d 5.6E5 2 2 78 92 Methylation(KR)
K.QIPVTDEDFVQPN(+15.00)GLWK.V Y 30.71 1999.9890 17 0.3 1001.0021 2 84.76 2 44211 AEV_1_3_RA2_01_1232.d 1.22E5 1 1 397 413 Deamidation followed by a methylation
K.VW(+31.99)PQAEVPLR.R Y 30.67 1225.6455 10 4.6 613.8328 2 66.58 2 30357 AEV_1_3_RA2_01_1232.d 2.64E4 1 1 267 276 Dihydroxy
K.QIPVTDED(+14.02)FVQPNGLWK.V Y 30.37 1999.0050 17 -2.5 1000.5073 2 82.96 3 50285 AEV_3_3_RA3_01_1233.d 8.3E4 1 1 397 413 Methylation(others)
R.AFNPYQ(+.98)R(+14.02).D Y 30.26 909.4344 7 0.3 455.7246 2 50.40 3 25981 AEV_3_3_RA3_01_1233.d 2.46E5 1 1 346 352 Deamidation (NQ); Methylation(KR)
R.H(+42.01)M(+15.99)NGYSGHTYK.W Y 29.82 1351.5615 11 10.2 451.5324 3 11.56 2 3059 AEV_1_3_RA2_01_1232.d 2.41E4 1 1 176 186 Acetylation (N-term); Oxidation (M)
R.IEKATERM(+15.99)VASQPQSHL Y 29.73 1939.9785 17 0.5 647.6671 3 41.76 3 20510 AEV_3_3_RA3_01_1233.d 6.48E4 1 1 459 475 Oxidation (M)
R.LGVN(+.98)YQQIPVNC(+57.02)PLR.A Y 29.30 1770.9087 15 -18.0 886.4457 2 87.21 3 53127 AEV_3_3_RA3_01_1233.d 5.25E4 1 1 331 345 Deamidation (NQ); Carbamidomethylation
R.A(+42.01)FNPYQR.D Y 29.15 936.4453 7 12.4 469.2357 2 43.74 2 17311 AEV_1_3_RA2_01_1232.d 4.13E5 3 3 346 352 Acetylation (N-term)
R.DPS(-2.02)KFPIFIHTQK.R Y 28.87 1554.8195 13 11.7 519.2865 3 69.28 2 32313 AEV_1_3_RA2_01_1232.d 3.06E4 1 1 122 134 2-amino-3-oxo-butanoic_acid
K.QIPVTDEDFVQ(+15.00)PNGLWK.V Y 28.80 1999.9890 17 -1.1 1001.0007 2 84.54 3 51391 AEV_3_3_RA3_01_1233.d 2.99E5 1 1 397 413 Deamidation followed by a methylation
R.GEYPSWTC(+57.02)YVQVLSPEQAEKFRWNVFDLTK.V Y 28.72 3676.7659 30 2.7 920.2012 4 89.87 3 54642 AEV_3_3_RA3_01_1233.d 5.75E4 1 1 237 266 Carbamidomethylation
R.FST(-18.01)VGGEK(+14.02)GSADSAR.D Y 28.38 1463.7004 15 16.8 488.9156 3 29.01 2 10256 AEV_1_3_RA2_01_1232.d 1.33E5 2 2 78 92 Dehydration; Methylation(KR)
K.M(+15.99)AADNPDW(+15.99)HTEDLFK.A Y 28.34 1820.7676 15 25.9 607.9455 3 69.67 2 32603 AEV_1_3_RA2_01_1232.d 0 1 1 218 232 Oxidation (M); Oxidation (HW)
R.GEYPSWTC(+57.02)YVQVLSPEQAEK(+14.02)FR.W Y 28.12 2687.2690 22 -18.1 896.7474 3 85.11 3 51772 AEV_3_3_RA3_01_1233.d 0 1 1 237 258 Carbamidomethylation; Methylation(KR)
R.A(+43.01)FNPYQR.D Y 27.89 937.4406 7 13.9 469.7341 2 43.69 2 17289 AEV_1_3_RA2_01_1232.d 0 1 1 346 352 Carbamylation
K.TFNNEEATK(+164.06).M Y 27.41 1216.5376 9 11.0 609.2828 2 17.80 2 5490 AEV_1_3_RA2_01_1232.d 1.53E5 2 2 209 217 O-Diisopropylphosphorylation
K.T(+79.97)FNNEEATK.M Y 27.30 1132.4437 9 76.8 567.2726 2 27.43 3 11922 AEV_3_3_RA3_01_1233.d 0 1 1 209 217 Phosphorylation (STY)
R.NPQTN(+.98)LK.D Y 26.86 814.4185 7 -88.7 408.1804 2 26.67 1 7299 AEV 2_3_RA2_01_1224.d 9.15E4 1 1 136 142 Deamidation (NQ)
R.WNVFDLTKVW(+31.99)PQAEVPLRR.F Y 26.50 2385.2593 19 -3.2 597.3202 4 84.67 2 44151 AEV_1_3_RA2_01_1232.d 0 1 1 259 277 Dihydroxy
R.L(+43.01)FSYPDTHR(+14.02).H Y 26.35 1191.5673 9 -1.1 398.1959 3 56.97 3 30203 AEV_3_3_RA3_01_1233.d 4.3E5 1 1 320 328 Carbamylation; Methylation(KR)
K.MAADNPDWH(+218.17)TEDLFK.A Y 26.34 2006.9448 15 -2.1 669.9875 3 90.98 2 47706 AEV_1_3_RA2_01_1232.d 6.18E4 1 1 218 232 Michael addition of BHT quinone methide
K.AC(+57.02)QEHEQ(+.98)WAGAALSK(+14.02).Q Y 26.12 1699.7623 15 -2.8 567.5931 3 60.83 3 33049 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 382 396 Carbamidomethylation; Deamidation (NQ); Methylation(KR)
R.LGVNYQQIPVN(-17.03)C(+57.02)PLR.A Y 26.09 1752.8981 15 -0.2 877.4562 2 79.40 2 40082 AEV_1_3_RA2_01_1232.d 5.82E4 1 1 331 345 Ammonia-loss (N); Carbamidomethylation
K.FRWNVFDLTK(-1.03)VWPQAEVPLRR.F Y 25.96 2655.4072 21 1.9 532.0897 5 85.48 3 52028 AEV_3_3_RA3_01_1233.d 0 1 1 257 277 Lysine oxidation to aminoadipic semialdehyde
K.VWPQ(+.98)AEVPLR(+14.02)R.F Y 25.96 1364.7565 11 7.1 455.9293 3 70.85 3 40896 AEV_3_3_RA3_01_1233.d 8.39E4 2 2 267 277 Deamidation (NQ); Methylation(KR)
K.TD(+43.99)QGNKTFN(+.98)NEEATK.M Y 25.90 1740.7438 15 -11.6 871.3691 2 53.94 1 22526 AEV 2_3_RA2_01_1224.d 5.76E5 3 3 203 217 Carboxylation (DKW); Deamidation (NQ)
R.LFS(-2.02)YPDTHR.H Y 25.85 1132.5302 9 15.7 567.2812 2 55.90 2 23477 AEV_1_3_RA2_01_1232.d 0 1 1 320 328 2-amino-3-oxo-butanoic_acid
R.LGVNY(-2.02)QQIPVNC(+57.02)PLRAFNPYQR.D Y 25.72 2644.3333 22 16.7 882.4664 3 81.34 2 41618 AEV_1_3_RA2_01_1232.d 0 1 1 331 352 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
K.AIER(+14.02)GEYPSWTC(+57.02)YVQVLSPEQAEK(+14.02).F Y 25.28 2867.3799 24 -2.8 956.7979 3 83.48 2 43237 AEV_1_3_RA2_01_1232.d 5.15E4 1 1 233 256 Methylation(KR); Carbamidomethylation
K.VW(+43.99)PQ(+.98)AEVPLRR.F Y 25.25 1394.7306 11 20.8 465.9271 3 66.60 3 37540 AEV_3_3_RA3_01_1233.d 1.69E5 1 1 267 277 Carboxylation (DKW); Deamidation (NQ)
MDPESSQR.V Y 25.10 948.3971 8 -46.6 475.1837 2 21.50 1 5223 AEV 2_3_RA2_01_1224.d 0 1 1 1 8
R.FTLC(+57.02)ENPQNYFAEIEQAAFS(+60.00)PSHMVPGVEPSADPVLQSR.L Y 24.96 4422.0396 39 18.9 1106.5381 4 91.81 3 55707 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 281 319 Carbamidomethylation; 2-OH-ethyl thio-Ser
K.VWPQ(+.98)AEVPLRR(+14.02).F Y 24.87 1364.7565 11 6.9 455.9292 3 71.58 2 34030 AEV_1_3_RA2_01_1232.d 4.62E4 1 1 267 277 Deamidation (NQ); Methylation(KR)
R.IN(+.98)Q(+.98)DLGAR.I Y 24.85 887.4348 8 19.2 444.7332 2 31.75 2 11529 AEV_1_3_RA2_01_1232.d 0 1 1 451 458 Deamidation (NQ)
R.N(+.98)PQTNLK.D Y 24.81 814.4185 7 -88.8 408.1804 2 26.13 1 7044 AEV 2_3_RA2_01_1224.d 7.08E4 1 1 136 142 Deamidation (NQ)
K.MAADNPDWHTEDLFK(+28.03).A Y 24.77 1816.8090 15 27.6 606.6270 3 78.42 3 46849 AEV_3_3_RA3_01_1233.d 0 1 1 218 232 Dimethylation(KR)
R.INQ(+.98)DLGAR(+14.02).I Y 24.52 900.4665 8 -87.7 451.2010 2 57.24 1 24575 AEV 2_3_RA2_01_1224.d 2.29E5 2 2 451 458 Deamidation (NQ); Methylation(KR)
K.V(+42.01)LGR(+14.02)QPGQQENFVHNVSVHLC(+57.02)GAQEK.V Y 24.47 2986.4832 26 -6.2 598.3002 5 68.67 3 39190 AEV_3_3_RA3_01_1233.d 2.53E5 1 1 414 439 Acetylation (N-term); Methylation(KR); Carbamidomethylation
K.GSADSARDPR(+14.02).G Y 24.34 1044.4948 10 2.5 523.2560 2 13.09 3 4078 AEV_3_3_RA3_01_1233.d 6.03E5 4 4 86 95 Methylation(KR)
K.ATERM(+15.99)VASQPQ(+.98)SHL Y 24.29 1570.7410 14 -0.1 524.5875 3 38.10 3 18256 AEV_3_3_RA3_01_1233.d 5.83E4 1 1 462 475 Oxidation (M); Deamidation (NQ)
K.QIPVTDE(+14.02)DFVQPNGLWK.V Y 24.20 1999.0050 17 -2.1 1000.5076 2 83.83 2 43495 AEV_1_3_RA2_01_1232.d 1.35E5 1 1 397 413 Methylation(others)
K.T(+42.01)F(+31.99)NNEEATK.M Y 24.12 1126.4778 9 55.2 564.2773 2 24.45 3 10260 AEV_3_3_RA3_01_1233.d 0 1 1 209 217 Acetylation (N-term); Dihydroxy
R.FSTVGGEK(+14.02)GSADSARDPR(+14.02).G Y 23.88 1863.9075 18 1.0 622.3104 3 48.10 2 19488 AEV_1_3_RA2_01_1232.d 6.11E4 1 1 78 95 Methylation(KR)
K.TDQGN(+.98)KTFN(+.98)NEEATK(+14.02).M Y 23.83 1711.7537 15 24.3 571.6057 3 31.82 2 11565 AEV_1_3_RA2_01_1232.d 4.87E4 1 1 203 217 Deamidation (NQ); Methylation(KR)
K.TFNNE(+28.03)EATK.M Y 23.80 1080.5088 9 4.6 541.2642 2 40.71 2 15796 AEV_1_3_RA2_01_1232.d 8.54E5 2 2 209 217 Ethylation
R.LGVNYQQIP(+15.99)VNC(+57.02)PLR.A Y 23.61 1785.9196 15 3.5 596.3159 3 78.42 2 39306 AEV_1_3_RA2_01_1232.d 2.59E5 1 1 331 345 Oxidation or Hydroxylation; Carbamidomethylation
R.VGVKGPLLLQDFHLID(+14.02)LLAHFDRER.I Y 23.53 2914.6179 25 -10.0 583.9250 5 87.96 3 53580 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 9 33 Methylation(others)
K.QIPVTDEDFVQPNGLWK(-.98).V Y 23.44 1984.0054 17 8.7 662.3481 3 82.41 2 42428 AEV_1_3_RA2_01_1232.d 0 1 1 397 413 Amidation
R.FSTVGGEKGSADSARDP(+13.98)R.G Y 23.43 1849.8553 18 -65.8 463.4407 4 56.17 1 23924 AEV 2_3_RA2_01_1224.d 2.33E5 1 1 78 95 Proline oxidation to pyroglutamic acid
R.WNVFDLT(-18.01)KVWPQAEVPLR.R Y 23.37 2179.1577 18 -27.8 545.7816 4 67.71 3 38425 AEV_3_3_RA3_01_1233.d 2.01E5 1 1 259 276 Dehydration
R.VGVKGPLLLQDFHLIDLLAHFDRERIPER.V Y 23.32 3395.8828 29 4.4 680.1868 5 88.48 2 46449 AEV_1_3_RA2_01_1232.d 3.17E5 1 1 9 37
R.W(+56.06)NVFDLTK.V Y 23.25 1077.5858 8 -65.5 539.7649 2 87.50 2 45913 AEV_1_3_RA2_01_1232.d 5.19E4 1 1 259 266 Diethylation
K.GSADSAR(+14.02)DPR.G Y 23.24 1044.4948 10 2.5 523.2560 2 12.56 2 3451 AEV_1_3_RA2_01_1232.d 2.73E4 2 2 86 95 Methylation(KR)
K.T(+43.01)DQGNKTFN(+.98)NEEATK.M Y 23.15 1739.7598 15 -12.6 870.8762 2 50.43 1 20462 AEV 2_3_RA2_01_1224.d 1.16E5 1 1 203 217 Carbamylation; Deamidation (NQ)
R.MVASQPQSH(+15.99)L Y 23.08 1112.5284 10 4.3 557.2739 2 21.00 2 6833 AEV_1_3_RA2_01_1232.d 6.02E4 1 1 466 475 Oxidation (HW)
R.I(+42.01)NQ(+.98)DLGAR.I Y 23.01 928.4614 8 -32.5 310.4843 3 41.85 1 15481 AEV 2_3_RA2_01_1224.d 8.48E4 1 1 451 458 Acetylation (N-term); Deamidation (NQ)
R.LGVNYQQIPVNC(+57.02)PLR(+.98).A Y 22.98 1770.9087 15 -7.3 886.4552 2 78.27 3 46714 AEV_3_3_RA3_01_1233.d 2.25E5 1 1 331 345 Carbamidomethylation; Deamidation (R)
R.LFSYP(+13.98)DTHR.H Y 22.89 1148.5250 9 -57.3 575.2369 2 68.51 1 32825 AEV 2_3_RA2_01_1224.d 7.72E5 3 3 320 328 Proline oxidation to pyroglutamic acid
K.T(+42.01)DQGN(+.98)K(+14.02)TFNNEEATK.M Y 22.88 1752.7803 15 11.5 585.2741 3 22.78 3 9315 AEV_3_3_RA3_01_1233.d 1.33E5 1 1 203 217 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
K.G(+210.20)SADSARDPR(+14.02).G Y 22.28 1254.6931 10 1.1 628.3546 2 33.43 3 15393 AEV_3_3_RA3_01_1233.d 0 1 1 86 95 Myristoylation; Methylation(KR)
R.IN(+.98)QDLGARIEK(+27.99).A Y 22.27 1284.6674 11 28.4 429.2419 3 59.62 3 32134 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 451 461 Deamidation (NQ); Formylation
K.TDQGNK(+43.99)TFN(+.98)NEEATK.M Y 21.96 1740.7438 15 -11.4 871.3693 2 53.53 1 22263 AEV 2_3_RA2_01_1224.d 3.77E5 2 2 203 217 Carboxylation (DKW); Deamidation (NQ)
MD(+43.99)PESSQR.V Y 21.87 992.3869 8 29.4 993.4233 1 112.64 1 59529 AEV 2_3_RA2_01_1224.d 2.39E4 1 1 1 8 Carboxylation (DKW)
R.FSTVGGEK(+15.99)GSADSAR.D Y 21.64 1483.6903 15 1.5 495.5715 3 20.81 3 8252 AEV_3_3_RA3_01_1233.d 1.17E5 2 2 78 92 Oxidation or Hydroxylation
K.RNPQTNLK(+21.98)(+42.01).D Y 21.64 1033.5281 8 -33.7 1034.5005 1 111.18 1 59092 AEV 2_3_RA2_01_1224.d 0 1 1 135 142 Sodium adduct; Acetylation (K)
R.FTLC(+57.02)ENPQNYFAEIEQAAFSP(+31.99)SHM(+15.99)VPGVEPSADPVLQSR.L Y 21.42 4410.0210 39 0.3 1471.0146 3 90.81 3 55169 AEV_3_3_RA3_01_1233.d 4.18E5 1 1 281 319 Carbamidomethylation; Dihydroxy; Oxidation (M)
K.TDQGNKTFNNEEATK(+27.99).M Y 21.36 1723.7649 15 -65.8 575.5577 3 55.73 1 23656 AEV 2_3_RA2_01_1224.d 1.4E5 1 1 203 217 Formylation
R.F(+27.99)STVGGEKGSADSARDPR.G Y 21.06 1863.8711 18 15.2 466.9821 4 47.28 2 19079 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 78 95 Formylation
R.DGAMAINGNYGANPNYPSTFRPMEFK(+43.01)PVK(+14.02).A Y 20.97 3242.5276 29 11.5 649.5203 5 72.10 2 34426 AEV_1_3_RA2_01_1232.d 2.66E5 1 1 353 381 Carbamylation; Methylation(KR)
R.FT(+79.97)LC(+57.02)ENPQNYFAEIEQAAFS(-18.01)PSHMVPGVEPSADPVLQSR.L Y 20.84 4423.9917 39 6.3 1107.0122 4 91.30 3 55422 AEV_3_3_RA3_01_1233.d 1.27E5 1 1 281 319 Phosphorylation (STY); Carbamidomethylation; Dehydration
R.MVASQ(+15.00)PQSHL Y 20.79 1111.5332 10 9.8 556.7793 2 60.62 2 26286 AEV_1_3_RA2_01_1232.d 6.67E4 1 1 466 475 Deamidation followed by a methylation
R.LFSYPD(+14.02)THR.H Y 20.41 1148.5614 9 3.5 575.2900 2 59.78 2 25738 AEV_1_3_RA2_01_1232.d 1.91E5 1 1 320 328 Methylation(others)
R.FSTVGGEK(+28.03).G Y 20.31 851.4388 8 3.8 426.7283 2 49.77 2 20334 AEV_1_3_RA2_01_1232.d 1.42E5 1 1 78 85 Dimethylation(KR)
R.G(+41.03)TPYSYR.H Y 20.07 883.4188 7 3.3 442.7181 2 32.31 2 11789 AEV_1_3_RA2_01_1232.d 0 1 1 169 175 Amidination of lysines or N-terminal amines with methyl acetimidate
R.IEKATER.M Y 19.75 845.4606 7 5.5 423.7399 2 8.98 2 2144 AEV_1_3_RA2_01_1232.d 6.39E4 2 2 459 465
K.QIPVTDEDFVQPN(-17.03)GLWK.V Y 19.73 1967.9629 17 2.3 656.9964 3 83.40 2 43171 AEV_1_3_RA2_01_1232.d 8.73E4 1 1 397 413 Ammonia-loss (N)
R.IE(+14.02)KATER.M Y 19.44 859.4763 7 3.5 430.7469 2 11.60 2 3070 AEV_1_3_RA2_01_1232.d 5.6E4 1 1 459 465 Methylation(others)
K.T(+104.03)FNNEEATK.M Y 19.38 1156.5037 9 47.8 579.2867 2 21.11 3 8436 AEV_3_3_RA3_01_1233.d 0 1 1 209 217 Benzoyl
R.GFST(-18.01)K.F Y 19.17 520.2645 5 -104.4 521.2175 1 26.22 1 7086 AEV 2_3_RA2_01_1224.d 0 1 1 96 100 Dehydration
R.DGAM(+15.99)AINGNYGANPNYPSTFR(+14.02)PMEFKPVK.A Y 19.11 3215.5168 29 15.4 644.1205 5 77.03 2 38207 AEV_1_3_RA2_01_1232.d 0 1 1 353 381 Oxidation (M); Methylation(KR)
R.KATYC(+57.02)MFTR(+.98).I Y 19.11 1177.5260 9 17.5 393.5228 3 51.31 3 26583 AEV_3_3_RA3_01_1233.d 3.17E5 1 1 442 450 Carbamidomethylation; Deamidation (R)
K.RNPQTNLK(+14.02).D Y 18.94 983.5512 8 -6.9 492.7795 2 19.85 2 6348 AEV_1_3_RA2_01_1232.d 3.03E4 1 1 135 142 Methylation(KR)
R.GFSTK(+14.02).F Y 18.73 552.2908 5 2.1 553.2992 1 17.92 2 5539 AEV_1_3_RA2_01_1232.d 5.05E4 1 1 96 100 Methylation(KR)
K.AIERGEYPSWTC(+57.02)Y(+17.99)VQVLSPEQAEK.F Y 18.67 2857.3391 24 14.1 953.4671 3 82.81 2 42735 AEV_1_3_RA2_01_1232.d 5.02E4 1 1 233 256 Carbamidomethylation; Fluorination
R.QPGQQENFVH(+14.02)NVSVHLC(+57.02)GAQEK.V Y 18.62 2519.1975 22 -1.6 840.7384 3 68.39 3 38965 AEV_3_3_RA3_01_1233.d 2.09E5 1 1 418 439 Methylation(others); Carbamidomethylation
R.FSTVGGEKGS(+14.02)ADSAR.D Y 18.57 1481.7109 15 -25.1 741.8441 2 33.39 3 15369 AEV_3_3_RA3_01_1233.d 0 1 1 78 92 Methylation(others)
K.TDQ(+.98)GNK(+42.01)T(+79.97)FNNEEATK.M Y 18.50 1818.7308 15 -22.1 607.2375 3 51.14 1 20867 AEV 2_3_RA2_01_1224.d 0 1 1 203 217 Deamidation (NQ); Acetylation (K); Phosphorylation (STY)
R.NPQ(+.98)TNLK.D Y 18.47 814.4185 7 -14.5 408.2106 2 36.09 2 13581 AEV_1_3_RA2_01_1232.d 3.47E4 1 1 136 142 Deamidation (NQ)
R.QPGQQENFVH(+40.03)NVSVHLC(+57.02)GAQEK.V Y 18.47 2545.2131 22 -15.3 849.3987 3 73.00 3 42581 AEV_3_3_RA3_01_1233.d 1.29E5 1 1 418 439 Propionaldehyde +40; Carbamidomethylation
R.L(+226.08)FSYPDTHR.H Y 18.41 1360.6234 9 -36.9 341.1506 4 29.75 1 8835 AEV 2_3_RA2_01_1224.d 1.17E5 1 1 320 328 Biotinylation
K.GSADSARDPR.G Y 18.35 1030.4791 10 -84.2 516.2034 2 16.97 1 4013 AEV 2_3_RA2_01_1224.d 9.76E4 2 2 86 95
K.AT(-18.01)ERMVASQPQ(+.98)SHL Y 18.11 1536.7355 14 23.0 769.3927 2 88.18 3 53693 AEV_3_3_RA3_01_1233.d 7.43E4 1 1 462 475 Dehydration; Deamidation (NQ)
R.GFS(-18.01)TK.F Y 18.00 520.2645 5 -47.8 521.2469 1 48.02 3 24461 AEV_3_3_RA3_01_1233.d 0 1 1 96 100 Dehydration
R.M(+15.99)VASQP(+31.99)QSHL Y 17.91 1144.5183 10 36.6 573.2874 2 36.79 2 13916 AEV_1_3_RA2_01_1232.d 0 1 1 466 475 Oxidation (M); Dihydroxy
K.C(+57.02)ITRFST(+79.97)VGGEK.G Y 17.54 1433.6375 12 -14.1 478.8797 3 76.38 1 38959 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 74 85 Carbamidomethylation; Phosphorylation (STY)
K.Q(-17.03)IPVTDEDFVQ(+.98)PNGLWK.V Y 17.52 1968.9469 17 -92.3 985.3899 2 92.53 1 51431 AEV 2_3_RA2_01_1224.d 2.25E6 1 1 397 413 Pyro-glu from Q; Deamidation (NQ)
R.G(+43.01)FST(+79.97)K.F Y 17.38 661.2473 5 41.9 662.2822 1 79.60 1 41524 AEV 2_3_RA2_01_1224.d 0 1 1 96 100 Carbamylation; Phosphorylation (STY)
R.LFSYPDT(+79.97)HR.H Y 17.38 1214.5121 9 10.3 608.2696 2 66.64 1 31352 AEV 2_3_RA2_01_1224.d 7.52E3 1 1 320 328 Phosphorylation (STY)
K.TDQGNK(+14.02)TFNNEEATK.M Y 17.37 1709.7856 15 -85.9 570.8868 3 38.63 1 13670 AEV 2_3_RA2_01_1224.d 2.74E5 1 1 203 217 Methylation(KR)
R.I(+41.03)NQDLGAR.I Y 17.32 926.4933 8 -18.7 464.2453 2 27.41 2 9553 AEV_1_3_RA2_01_1232.d 4.31E3 1 1 451 458 Amidination of lysines or N-terminal amines with methyl acetimidate
R.FS(-18.01)TVGGEK.G Y 17.22 805.3970 8 -71.1 403.6771 2 41.77 1 15459 AEV 2_3_RA2_01_1224.d 1.57E5 1 1 78 85 Dehydration
R.LGVNY(-2.02)QQIPVNC(+57.02)PLR.A Y 17.19 1767.9091 15 10.0 590.3162 3 77.46 2 38542 AEV_1_3_RA2_01_1232.d 7.8E4 1 1 331 345 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.GEYPSWTC(+57.02)YVQ(+.98)VLSPEQ(+.98)AEKFR.W Y 17.17 2675.2212 22 12.5 892.7588 3 84.19 3 51151 AEV_3_3_RA3_01_1233.d 7.71E4 1 1 237 258 Carbamidomethylation; Deamidation (NQ)
K.T(+43.01)DQGNK(+14.02)TFNNEEATK.M Y 16.95 1752.7915 15 3.8 585.2733 3 21.21 3 8490 AEV_3_3_RA3_01_1233.d 0 1 1 203 217 Carbamylation; Methylation(KR)
R.DGAMAINGNYGANPNYPSTFR(+14.02)PME(+43.99)FKPVK.A Y 16.91 3243.5117 29 -6.3 811.8801 4 72.19 3 41942 AEV_3_3_RA3_01_1233.d 9.47E4 1 1 353 381 Methylation(KR); Carboxylation (E)
R.L(+42.01)FSYPDTHR.H Y 16.78 1176.5564 9 21.6 589.2982 2 53.68 3 28159 AEV_3_3_RA3_01_1233.d 0 1 1 320 328 Acetylation (N-term)
R.I(+42.01)NQDLGAR(+14.02).I Y 16.63 941.4930 8 6.1 314.8402 3 19.21 2 6073 AEV_1_3_RA2_01_1232.d 2E5 1 1 451 458 Acetylation (N-term); Methylation(KR)
R.INQDLGAR(+31.99)IEK.A Y 16.61 1287.6782 11 -26.8 644.8292 2 47.30 3 24003 AEV_3_3_RA3_01_1233.d 1.69E4 1 1 451 461 Dihydroxy
R.D(+42.01)PR(+14.02)GFSTK.F Y 16.51 962.4821 8 37.6 482.2664 2 67.89 2 31290 AEV_1_3_RA2_01_1232.d 7.26E4 1 1 93 100 Acetylation (N-term); Methylation(KR)
R.KATYC(+57.02)MFTR(+14.02).I Y 16.46 1190.5576 9 33.7 397.8732 3 59.17 2 25337 AEV_1_3_RA2_01_1232.d 1.72E5 2 2 442 450 Carbamidomethylation; Methylation(KR)
K.TDQGNKTFNNEE(+14.02)ATK.M Y 16.45 1709.7856 15 -85.7 570.8870 3 42.78 1 16026 AEV 2_3_RA2_01_1224.d 6.65E5 1 1 203 217 Methylation(others)
R.LGVN(+.98)YQQIPVNCPLR.A Y 16.40 1713.8872 15 0.0 429.4791 4 71.77 3 41622 AEV_3_3_RA3_01_1233.d 7.16E4 1 1 331 345 Deamidation (NQ)
R.I(+43.01)NQDLGAR.I Y 16.39 928.4726 8 -50.1 465.2203 2 41.52 1 15297 AEV 2_3_RA2_01_1224.d 2.01E5 1 1 451 458 Carbamylation
R.AFN(+.98)PYQ(+.98)R.D Y 16.36 896.4028 7 -46.5 449.1878 2 56.26 1 23988 AEV 2_3_RA2_01_1224.d 5.68E5 1 1 346 352 Deamidation (NQ)
K.A(+43.01)TERMVASQPQSHL Y 16.31 1596.7678 14 -14.3 533.2556 3 45.15 2 18013 AEV_1_3_RA2_01_1232.d 2.29E4 1 1 462 475 Carbamylation
R.LFSYPDTHR(+44.03).H Y 16.25 1178.5720 9 -20.2 393.8567 3 9.77 3 2451 AEV_3_3_RA3_01_1233.d 3.29E4 1 1 320 328 Ethanolation (KR)
R.GFST(+79.97)K(+42.01).F Y 16.17 660.2520 5 0.4 661.2595 1 76.45 1 39015 AEV 2_3_RA2_01_1224.d 1.56E5 1 1 96 100 Phosphorylation (STY); Acetylation (K)
K.C(+57.02)ITRFSTVGGEK.G Y 16.13 1353.6710 12 -37.3 677.8176 2 12.89 3 3987 AEV_3_3_RA3_01_1233.d 2.77E4 1 1 74 85 Carbamidomethylation
K.A(+42.01)TYCMFTR.I Y 16.13 1033.4362 8 -28.7 517.7105 2 32.25 1 10211 AEV 2_3_RA2_01_1224.d 2.24E5 1 1 443 450 Acetylation (N-term)
K.GSADSAR(+14.02)DPR(+14.02).G Y 16.10 1058.5105 10 -75.0 530.2228 2 53.29 1 22127 AEV 2_3_RA2_01_1224.d 5.8E4 2 2 86 95 Methylation(KR)
R.FST(+79.97)VGGEK(+27.99).G Y 15.98 931.3688 8 -4.2 311.4622 3 28.76 1 8343 AEV 2_3_RA2_01_1224.d 0 1 1 78 85 Phosphorylation (STY); Formylation
K.M(+42.01)AADNPD(+21.98)WHTEDLFK.A Y 15.95 1852.7703 15 24.4 464.2111 4 77.73 1 40039 AEV 2_3_RA2_01_1224.d 0 1 1 218 232 Acetylation (N-term); Sodium adduct
K.GSADS(-18.01)AR.D Y 15.76 644.2878 7 -45.1 645.2660 1 28.65 1 8294 AEV 2_3_RA2_01_1224.d 3.24E4 1 1 86 92 Dehydration
K.WTK(+14.02)PDGTFNYVQIHC(+57.02)K.T Y 15.65 2006.9673 16 5.3 502.7518 4 66.91 3 37782 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 187 202 Methylation(KR); Carbamidomethylation
R.MVAS(+14.02)QPQSHL Y 15.63 1110.5492 10 2.2 556.2831 2 40.06 3 19444 AEV_3_3_RA3_01_1233.d 0 1 1 466 475 Methylation(others)
K.C(+57.02)(+226.08)ITRFSTVGGEK(+14.02)GSADSAR.D Y 15.59 2238.0520 19 36.6 747.0519 3 78.88 2 39714 AEV_1_3_RA2_01_1232.d 3.51E5 1 1 74 92 Carbamidomethylation; Biotinylation; Methylation(KR)
K.AC(+57.02)QEHEQWAGAALSK(+28.03).Q Y 15.58 1712.7941 15 1.2 571.9393 3 62.84 3 34611 AEV_3_3_RA3_01_1233.d 9.39E4 1 1 382 396 Carbamidomethylation; Dimethylation(KR)
R.I(+42.01)NQDLGAR.I Y 15.57 927.4774 8 -49.8 310.1510 3 41.98 1 15570 AEV 2_3_RA2_01_1224.d 2.53E4 1 1 451 458 Acetylation (N-term)
R.DGAMAINGNYGANPNYPSTFRPM(+15.99)EFK(+42.01)PVK.A Y 15.45 3243.5117 29 0.5 811.8856 4 72.97 2 35094 AEV_1_3_RA2_01_1232.d 9.02E4 1 1 353 381 Oxidation (M); Acetylation (K)
K.T(+42.01)DQ(+.98)GNK(+14.02)TFNNEEATK.M Y 15.29 1752.7803 15 15.8 585.2766 3 22.09 2 7256 AEV_1_3_RA2_01_1232.d 1.21E5 1 1 203 217 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
R.LFSYPDTHR(+28.03).H Y 15.27 1162.5770 9 -62.2 582.2596 2 84.24 1 45175 AEV 2_3_RA2_01_1224.d 7.25E4 1 1 320 328 Dimethylation(KR)
K.VLGRQPGQQENFVHNVSVHLC(+57.02)GAQEKVR.K Y 15.13 3185.6265 28 -3.9 797.4108 4 85.65 3 52134 AEV_3_3_RA3_01_1233.d 4.62E4 1 1 414 441 Carbamidomethylation
R.FTLC(+57.02)ENPQNY(-18.01)FAEIEQAAFS(+79.97)PSHMVPGVEPSADPVLQSR.L Y 15.09 4423.9917 39 11.1 1107.0175 4 90.51 3 54996 AEV_3_3_RA3_01_1233.d 9.93E4 1 1 281 319 Carbamidomethylation; Dehydration; Phosphorylation (STY)
K.FRW(+15.99)NVFDLTK.V Y 15.04 1340.6877 10 -88.2 447.8638 3 85.33 1 46051 AEV 2_3_RA2_01_1224.d 5.82E4 1 1 257 266 Oxidation (HW)
total 418 peptides
C1GM00
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TVEEDHAIPEDVDNAYKNK.V Y 200.00 2186.0127 19 2.9 729.6803 3 60.77 2 26400 AEV_1_3_RA2_01_1232.d 4.73E6 10 10 492 510
R.LTEVEAPEVVPGDILQVEEGTIIPADGR.I Y 200.00 2945.5232 28 1.9 982.8502 3 88.51 2 46475 AEV_1_3_RA2_01_1232.d 2.08E6 7 7 197 224
K.LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 200.00 2907.3816 27 2.7 1454.7020 2 91.23 2 47840 AEV_1_3_RA2_01_1232.d 1.02E6 6 6 397 423 Carbamidomethylation
R.NGRLTEVEAPEVVPGDILQVEEGTIIPADGR.I Y 163.93 3272.6887 31 3.3 1091.9071 3 85.41 2 44606 AEV_1_3_RA2_01_1232.d 4.26E5 4 4 194 224
R.GQHIPPNHLGTSVPSGAFPGKPTESVPEEK.K Y 155.25 3093.5518 30 5.8 619.7212 5 66.43 2 30286 AEV_1_3_RA2_01_1232.d 5.68E6 24 24 11 40
R.GYLVAMTGDGVNDAPSLK.K Y 152.56 1806.8822 18 3.0 603.3032 3 77.80 2 38811 AEV_1_3_RA2_01_1232.d 2.31E6 8 8 635 652
R.IVTEDAFLQVDQSAITGESLAVDK.H Y 148.55 2548.2908 24 1.6 1275.1547 2 84.66 2 44103 AEV_1_3_RA2_01_1232.d 3.97E5 4 4 225 248
K.RGEAFMVITSTGDNTFVGR.A Y 148.14 2057.0000 19 -0.7 686.6735 3 77.83 2 38854 AEV_1_3_RA2_01_1232.d 1.55E6 8 8 262 280
K.NKLSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 146.81 3149.5195 29 3.1 1050.8503 3 87.15 2 45721 AEV_1_3_RA2_01_1232.d 9.48E5 6 6 395 423 Carbamidomethylation
R.SAADIVFLAPGLSAIIDALK.T Y 143.51 1984.1244 20 4.2 662.3848 3 97.67 2 50256 AEV_1_3_RA2_01_1232.d 1.16E6 6 6 669 688
R.GYLVAMTGDGVNDAPSLKK.A Y 143.46 1934.9772 19 1.3 646.0005 3 72.28 2 34568 AEV_1_3_RA2_01_1232.d 1.75E6 8 8 635 653
K.TVEEDHAIPEDVDNAYK.N Y 143.14 1943.8748 17 4.2 648.9683 3 63.38 2 28163 AEV_1_3_RA2_01_1232.d 3.04E6 8 8 492 508
R.GYLVAM(+15.99)TGDGVNDAPSLK.K Y 140.70 1822.8771 18 0.9 912.4467 2 72.13 2 34510 AEV_1_3_RA2_01_1232.d 8.87E5 3 3 635 652 Oxidation (M)
R.ETSRQLGLGTNVYNAER.L Y 137.52 1906.9497 17 4.3 636.6599 3 63.30 2 28082 AEV_1_3_RA2_01_1232.d 6.51E5 4 4 576 592
R.N(+.98)GRLTEVEAPEVVPGDILQVEEGTIIPADGR.I Y 132.29 3273.6729 31 4.4 1092.2363 3 88.16 3 53700 AEV_3_3_RA3_01_1233.d 5.59E5 3 3 194 224 Deamidation (NQ)
K.TVEEDHAIPEDVDNAYKNKVAEFATR.G Y 130.45 2960.4150 26 4.7 593.0931 5 72.86 2 35009 AEV_1_3_RA2_01_1232.d 1.47E6 6 6 492 517
K.ADTGIAVEGASDAAR.S Y 126.20 1402.6688 15 2.0 702.3431 2 56.06 2 23607 AEV_1_3_RA2_01_1232.d 5.57E6 14 14 654 668
R.SAADIVFLAPGLSAIIDALKTSR.Q Y 126.16 2328.3052 23 1.8 777.1104 3 96.14 2 49730 AEV_1_3_RA2_01_1232.d 1.08E6 6 6 669 691
K.LSLAEPYC(+57.02)VAGVDPDDLM(+15.99)LTAC(+57.02)LAASR.K Y 123.30 2923.3765 27 2.7 1462.6995 2 88.11 2 46252 AEV_1_3_RA2_01_1232.d 3.48E5 4 4 397 423 Carbamidomethylation; Oxidation (M)
K.NKLSLAEPYC(+57.02)VAGVDPDDLM(+15.99)LTAC(+57.02)LAASR.K Y 123.23 3165.5144 29 4.2 1056.1832 3 84.43 2 43922 AEV_1_3_RA2_01_1232.d 3.18E5 2 2 395 423 Carbamidomethylation; Oxidation (M)
R.QLGLGTNVYNAER.L Y 123.09 1433.7263 13 4.2 717.8734 2 67.58 2 31082 AEV_1_3_RA2_01_1232.d 4.49E6 9 9 580 592
R.GYLVAM(+15.99)TGDGVNDAPSLKK.A Y 117.21 1950.9720 19 3.4 651.3335 3 66.12 2 30035 AEV_1_3_RA2_01_1232.d 2.12E5 3 3 635 653 Oxidation (M)
K.KADTGIAVEGASDAAR.S Y 115.98 1530.7638 16 0.3 766.3894 2 45.35 2 18127 AEV_1_3_RA2_01_1232.d 4.93E6 22 22 653 668
R.LGLGGGGTM(+15.99)PGSEVYDFVEAADGFAEVFPQHKYNVVEILQQR.G Y 115.83 4540.2007 42 8.1 1136.0667 4 92.63 3 56136 AEV_3_3_RA3_01_1233.d 2.53E5 2 2 593 634 Oxidation (M)
R.LTEVEAPEVVPGDILQVE(+14.02)EGTIIPADGR.I Y 115.73 2959.5388 28 -0.9 1480.7754 2 92.73 3 56178 AEV_3_3_RA3_01_1233.d 1.09E6 7 7 197 224 Methylation(others)
K.VLEFHPFDPVSK.K Y 114.83 1413.7292 12 1.2 707.8727 2 75.98 2 37403 AEV_1_3_RA2_01_1232.d 5.24E6 10 10 454 465
R.LTEVE(+14.02)APEVVPGDILQVEEGTIIPADGR.I Y 114.75 2959.5388 28 -3.3 1480.7717 2 89.33 2 46916 AEV_1_3_RA2_01_1232.d 1.48E6 5 5 197 224 Methylation(others)
R.LTE(+14.02)VEAPEVVPGDILQVEEGTIIPADGR.I Y 111.81 2959.5388 28 1.3 1480.7786 2 89.42 3 54393 AEV_3_3_RA3_01_1233.d 2.37E5 1 1 197 224 Methylation(others)
R.SLEDFVVSLQR.V Y 109.50 1291.6771 11 3.0 646.8478 2 83.06 2 42926 AEV_1_3_RA2_01_1232.d 7.74E6 13 13 910 920
R.GQHIPPNHLGTSVPSGAFPGKPTESVPEEK(+14.02).K Y 108.38 3107.5676 30 4.1 622.5234 5 68.02 2 31378 AEV_1_3_RA2_01_1232.d 1.98E6 11 11 11 40 Methylation(KR)
K.KVSAVVISPQGER.I Y 106.36 1368.7725 13 3.7 457.2664 3 50.83 2 20897 AEV_1_3_RA2_01_1232.d 3.94E6 15 15 466 478
R.KRGEGSWEILGIMPC(+57.02)SDPPRHDTAK.T Y 105.86 2836.3748 25 13.8 568.2900 5 69.32 3 39741 AEV_3_3_RA3_01_1233.d 8.94E4 1 1 527 551 Carbamidomethylation
K.LSAIESLAGVEILC(+57.02)SDKTGTLTK.N Y 105.80 2405.2722 23 -1.6 802.7634 3 82.25 3 49772 AEV_3_3_RA3_01_1233.d 5.04E5 3 3 372 394 Carbamidomethylation
R.LTEVEAPEVVPGDILQVEE(+14.02)GTIIPADGR.I Y 105.06 2959.5388 28 -1.4 1480.7747 2 90.22 3 54820 AEV_3_3_RA3_01_1233.d 2.53E5 2 2 197 224 Methylation(others)
R.Q(-17.03)LGLGTNVYNAER.L Y 104.91 1416.6997 13 2.1 709.3586 2 78.57 2 39440 AEV_1_3_RA2_01_1232.d 4.96E6 9 9 580 592 Pyro-glu from Q
R.LGLGGGGTMPGSEVYDFVEAADGFAEVFPQHK.Y Y 102.05 3281.5339 32 0.7 1094.8527 3 92.82 3 56221 AEV_3_3_RA3_01_1233.d 4.52E5 2 2 593 624
K.LSAIESLAGVEILC(+57.02)SDK.T Y 101.42 1803.9287 17 2.8 602.3185 3 84.55 2 43999 AEV_1_3_RA2_01_1232.d 1.55E6 7 7 372 388 Carbamidomethylation
R.IVTEDAFLQVDQSAITGESLAVDKHKGDTC(+57.02)YASSAVK.R Y 100.90 3952.9363 37 -2.1 791.5928 5 77.95 3 46459 AEV_3_3_RA3_01_1233.d 2.91E5 2 2 225 261 Carbamidomethylation
K.TVEEDHAIPEDVDNAYKNK(+14.02).V Y 100.73 2200.0283 19 -1.9 734.3486 3 62.60 3 34429 AEV_3_3_RA3_01_1233.d 4.56E5 2 2 492 510 Methylation(KR)
K.SVLTQYKVLEFHPFDPVSK.K Y 100.12 2233.1782 19 -2.5 745.3981 3 80.60 3 48538 AEV_3_3_RA3_01_1233.d 6.05E5 4 4 447 465
K.YNVVEILQQR.G Y 98.65 1260.6826 10 -22.5 631.3344 2 77.69 2 38768 AEV_1_3_RA2_01_1232.d 2.15E6 7 7 625 634
R.GQHIPPNHLGTSVPS(-2.02)GAFPGKPTESVPEEK.K Y 98.53 3091.5361 30 20.5 619.3271 5 66.22 2 30112 AEV_1_3_RA2_01_1232.d 4.12E5 3 3 11 40 2-amino-3-oxo-butanoic_acid
K.RGEAFM(+15.99)VITSTGDNTFVGR.A Y 98.11 2072.9949 19 5.0 692.0090 3 74.22 3 43520 AEV_3_3_RA3_01_1233.d 2.01E5 1 1 262 280 Oxidation (M)
R.GEAFMVITSTGDNTFVGR.A Y 97.59 1900.8989 18 -0.4 634.6400 3 80.73 3 48630 AEV_3_3_RA3_01_1233.d 2.9E5 4 4 263 280
R.NGR(+14.02)LTEVEAPEVVPGDILQVEEGTIIPADGR.I Y 95.50 3286.7043 31 1.2 1096.5767 3 86.44 2 45266 AEV_1_3_RA2_01_1232.d 2.91E5 2 2 194 224 Methylation(KR)
K.MLTGDAVGIAR.E Y 94.20 1102.5804 11 3.5 552.2994 2 64.87 2 29192 AEV_1_3_RA2_01_1232.d 4.34E6 8 8 565 575
R.LTEVEAPEVVPGDILQVEEGTIIPADGR(+14.02).I Y 93.58 2959.5388 28 4.3 1480.7831 2 88.58 3 53941 AEV_3_3_RA3_01_1233.d 1.79E5 3 3 197 224 Methylation(KR)
K.VLEFHPFDPVSKK.V Y 93.42 1541.8241 13 0.0 771.9193 2 69.16 3 39582 AEV_3_3_RA3_01_1233.d 2.45E6 6 6 454 466
R.LTEVEAPEVVPGDILQ(+.98)VEEGTIIPADGR.I Y 92.93 2946.5073 28 4.1 1474.2670 2 88.99 3 54142 AEV_3_3_RA3_01_1233.d 6.69E4 2 2 197 224 Deamidation (NQ)
R.LTEVE(+28.03)APEVVPGDILQVEEGTIIPADGR.I Y 92.72 2973.5544 28 2.4 1487.7881 2 90.29 3 54864 AEV_3_3_RA3_01_1233.d 1.2E5 2 2 197 224 Ethylation
R.GQHIPPN(+.98)HLGTSVPSGAFPGKPTESVPEEK.K Y 92.08 3094.5359 30 9.7 619.9205 5 66.79 2 30506 AEV_1_3_RA2_01_1232.d 1.09E6 1 1 11 40 Deamidation (NQ)
R.Q(-17.03)LGLGTNVYNAER(+14.02).L Y 91.56 1430.7153 13 2.3 716.3666 2 81.71 2 41965 AEV_1_3_RA2_01_1232.d 1.59E6 6 6 580 592 Pyro-glu from Q; Methylation(KR)
R.SAADIVFLAPGLSAIIDALK(+14.02).T Y 91.54 1998.1400 20 1.5 667.0549 3 97.75 3 58321 AEV_3_3_RA3_01_1233.d 9.68E4 3 3 669 688 Methylation(KR)
K.M(+15.99)LTGDAVGIAR.E Y 91.47 1118.5753 11 3.1 560.2967 2 59.44 2 25518 AEV_1_3_RA2_01_1232.d 5.38E6 24 24 565 575 Oxidation (M)
K.GIDAIDKAFLK.S Y 90.36 1189.6707 11 3.4 595.8446 2 73.55 2 35534 AEV_1_3_RA2_01_1232.d 4.96E6 8 8 427 437
K.ADTGIAVEGASDAAR(+14.02).S Y 89.73 1416.6844 15 1.8 709.3508 2 60.97 2 26506 AEV_1_3_RA2_01_1232.d 1.6E6 4 4 654 668 Methylation(KR)
K.VSAVVISPQGER.I Y 89.32 1240.6775 12 3.3 621.3481 2 59.35 2 25496 AEV_1_3_RA2_01_1232.d 5.91E6 8 8 467 478
R.LGLGGGGTMPGSEVYDFVEAADGFAEVFPQHKYNVVEILQQR.G Y 88.12 4524.2061 42 0.9 1132.0598 4 94.29 2 49079 AEV_1_3_RA2_01_1232.d 4.24E5 2 2 593 634
K.LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASRK.K Y 87.56 3035.4766 28 9.7 1012.8427 3 87.67 2 46036 AEV_1_3_RA2_01_1232.d 1.57E5 2 2 397 424 Carbamidomethylation
K.KGIDAIDKAFLK.S Y 87.45 1317.7656 12 -4.5 440.2605 3 66.67 3 37596 AEV_3_3_RA3_01_1233.d 4.75E5 5 5 426 437
K.ADTGIAVE(+14.02)GASDAAR.S Y 87.10 1416.6844 15 -0.7 709.3490 2 60.57 3 32846 AEV_3_3_RA3_01_1233.d 8.83E5 2 2 654 668 Methylation(others)
K.KADTGIAVEGASDAAR(+14.02).S Y 85.49 1544.7794 16 4.2 515.9359 3 53.46 2 22220 AEV_1_3_RA2_01_1232.d 2.42E6 9 9 653 668 Methylation(KR)
K.TVE(+14.02)EDHAIPEDVDNAYK.N Y 85.37 1957.8905 17 5.2 653.6409 3 65.45 2 29613 AEV_1_3_RA2_01_1232.d 2.78E5 2 2 492 508 Methylation(others)
R.GLM(+15.99)DQEVLSR.R Y 84.72 1162.5652 10 2.5 582.2913 2 58.32 2 24824 AEV_1_3_RA2_01_1232.d 2.58E6 16 16 96 105 Oxidation (M)
K.NKLSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASRK.K Y 84.54 3277.6145 30 4.4 820.4145 4 84.46 2 43941 AEV_1_3_RA2_01_1232.d 0 1 1 395 424 Carbamidomethylation
R.GLMDQEVLSR.R Y 84.50 1146.5703 10 1.9 574.2935 2 69.02 2 32153 AEV_1_3_RA2_01_1232.d 2.87E6 7 7 96 105
R.SLEDFVVSLQR(+14.02).V Y 84.31 1305.6929 11 2.0 653.8550 2 84.46 2 44025 AEV_1_3_RA2_01_1232.d 5.4E5 5 5 910 920 Methylation(KR)
K.TVEEDHAIPE(+14.02)DVDNAYK.N Y 83.98 1957.8905 17 5.0 653.6407 3 65.94 2 29907 AEV_1_3_RA2_01_1232.d 6.16E5 2 2 492 508 Methylation(others)
K.NKLSLAE(+14.02)PYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 83.78 3163.5352 29 -0.2 1055.5188 3 88.09 3 53690 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 395 423 Methylation(others); Carbamidomethylation
K.GDTC(+57.02)YASSAVK.R Y 83.68 1157.5023 11 0.5 579.7587 2 30.83 3 13873 AEV_3_3_RA3_01_1233.d 5.58E5 4 4 251 261 Carbamidomethylation
R.Q(-17.03)LGLGTNVYN(+.98)AER.L Y 83.65 1417.6837 13 8.2 709.8550 2 79.76 2 40373 AEV_1_3_RA2_01_1232.d 3.28E5 2 2 580 592 Pyro-glu from Q; Deamidation (NQ)
R.GYLVAMTGDGVND(+14.02)APSLK.K Y 82.84 1820.8978 18 0.9 911.4570 2 79.32 2 40014 AEV_1_3_RA2_01_1232.d 3.54E5 2 2 635 652 Methylation(others)
R.LGLGGGGTMPGSEVYDFVEAADGFAE(+14.02)VFPQHK.Y Y 81.84 3295.5496 32 0.9 1099.5248 3 93.28 3 56458 AEV_3_3_RA3_01_1233.d 3E4 1 1 593 624 Methylation(others)
K.NKLSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR(+14.02).K Y 81.82 3163.5352 29 4.6 1055.5238 3 88.09 2 46330 AEV_1_3_RA2_01_1232.d 2.36E5 2 2 395 423 Carbamidomethylation; Methylation(KR)
K.Q(-17.03)RSLEDFVVSLQR.V Y 80.83 1558.8103 13 1.3 520.6114 3 84.40 2 43913 AEV_1_3_RA2_01_1232.d 2.78E5 2 2 908 920 Pyro-glu from Q
R.GQHIPPNHLGTS(-2.02)VPSGAFPGKPTESVPEEK.K Y 80.27 3091.5361 30 -2.3 619.3131 5 66.73 3 37644 AEV_3_3_RA3_01_1233.d 3.25E5 1 1 11 40 2-amino-3-oxo-butanoic_acid
R.Q(+.98)LGLGTNVYNAER.L Y 79.79 1434.7103 13 -2.0 718.3610 2 68.64 3 39167 AEV_3_3_RA3_01_1233.d 1.23E6 3 3 580 592 Deamidation (NQ)
K.AIVQKLSAIESLAGVEILC(+57.02)SDK.T Y 78.69 2343.2720 22 -15.8 782.0856 3 85.85 3 52268 AEV_3_3_RA3_01_1233.d 0 1 1 367 388 Carbamidomethylation
K.TVEE(+14.02)DHAIPEDVDNAYKNK.V Y 78.68 2200.0283 19 4.9 734.3536 3 63.77 2 28405 AEV_1_3_RA2_01_1232.d 6.85E5 3 3 492 510 Methylation(others)
R.SLEDFVVSLQ(+.98)R.V Y 78.34 1292.6611 11 16.8 647.3487 2 83.31 2 43104 AEV_1_3_RA2_01_1232.d 1.5E6 5 5 910 920 Deamidation (NQ)
K.TVEEDHAIPEDVDNAYK(+14.02).N Y 77.77 1957.8905 17 -3.5 653.6351 3 65.34 3 36544 AEV_3_3_RA3_01_1233.d 5.31E5 4 4 492 508 Methylation(KR)
K.KADTGIAVE(+14.02)GASDAAR.S Y 77.17 1544.7794 16 4.0 515.9358 3 52.65 2 21802 AEV_1_3_RA2_01_1232.d 1.9E6 6 6 653 668 Methylation(others)
R.GQHIPPNHLGTSVPS(-18.01)GAFPGK(+14.02)PTESVPEEK.K Y 76.91 3089.5569 30 -1.2 618.9179 5 66.65 2 30406 AEV_1_3_RA2_01_1232.d 8.96E4 2 2 11 40 Dehydration; Methylation(KR)
R.ETSR(+14.02)QLGLGTNVYNAER.L Y 76.81 1920.9653 17 -3.3 641.3270 3 63.34 3 34996 AEV_3_3_RA3_01_1233.d 6.16E4 1 1 576 592 Methylation(KR)
R.RGLMDQEVLSR.R Y 75.79 1302.6714 11 19.1 435.2394 3 63.19 2 28038 AEV_1_3_RA2_01_1232.d 7.72E5 5 5 95 105
R.LTEVEAPEVVPGDILQVE(+28.03)EGTIIPADGR.I Y 75.68 2973.5544 28 0.1 1487.7847 2 94.73 3 57107 AEV_3_3_RA3_01_1233.d 5.94E5 6 6 197 224 Ethylation
R.QLGLGTN(+.98)VYNAER.L Y 74.98 1434.7103 13 9.5 718.3693 2 67.00 3 37861 AEV_3_3_RA3_01_1233.d 7.17E2 1 1 580 592 Deamidation (NQ)
K.TVEEDHAIPE(+14.02)DVDNAYKNK.V Y 74.95 2200.0283 19 -0.1 551.0143 4 61.75 3 33774 AEV_3_3_RA3_01_1233.d 1.52E5 2 2 492 510 Methylation(others)
K.LSLAE(+14.02)PYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 74.74 2921.3972 27 -2.6 1461.7020 2 92.23 3 55911 AEV_3_3_RA3_01_1233.d 2.37E5 4 4 397 423 Methylation(others); Carbamidomethylation
R.SLEDFVVSLQ(+.98)R(+14.02).V Y 73.74 1306.6769 11 0.3 654.3459 2 89.80 3 54605 AEV_3_3_RA3_01_1233.d 6.73E5 4 4 910 920 Deamidation (NQ); Methylation(KR)
R.QLGLGTNVYNAER(+14.02).L Y 73.45 1447.7419 13 0.7 724.8788 2 69.36 2 32386 AEV_1_3_RA2_01_1232.d 1.7E6 9 9 580 592 Methylation(KR)
R.GYLVAMTGDGVN(+.98)DAPSLK.K Y 73.34 1807.8662 18 11.1 904.9504 2 77.82 2 38829 AEV_1_3_RA2_01_1232.d 2.64E5 4 4 635 652 Deamidation (NQ)
R.NGRLTEVEAPEVVPGDILQVEE(+14.02)GTIIPADGR.I Y 72.93 3286.7043 31 0.6 1096.5760 3 86.97 2 45598 AEV_1_3_RA2_01_1232.d 9.01E4 2 2 194 224 Methylation(others)
K.TVEED(+14.02)HAIPEDVDNAYK.N Y 72.81 1957.8905 17 4.4 653.6403 3 66.04 3 37095 AEV_3_3_RA3_01_1233.d 6.14E4 1 1 492 508 Methylation(others)
K.TVEED(+14.02)HAIPEDVDNAYKNK.V Y 72.77 2200.0283 19 -4.1 734.3470 3 63.11 3 34830 AEV_3_3_RA3_01_1233.d 3.28E5 4 4 492 510 Methylation(others)
R.NGRLTEVEAPEVVPGDILQ(+.98)VEEGTIIPADGR.I Y 71.86 3273.6729 31 2.4 1092.2341 3 85.77 3 52221 AEV_3_3_RA3_01_1233.d 0 1 1 194 224 Deamidation (NQ)
K.TLGLSIKM(+15.99)LTGDAVGIAR.E Y 70.62 1831.0237 18 -3.4 611.3464 3 80.48 3 48440 AEV_3_3_RA3_01_1233.d 3.97E4 1 1 558 575 Oxidation (M)
K.NKLSLAEPYC(+57.02)VAGVDPDD(+14.02)LMLTAC(+57.02)LAASR.K Y 70.52 3163.5352 29 2.9 1055.5221 3 87.49 3 53295 AEV_3_3_RA3_01_1233.d 2.36E5 2 2 395 423 Carbamidomethylation; Methylation(others)
K.N(+.98)KLSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 70.40 3150.5034 29 9.2 1051.1847 3 87.24 2 45766 AEV_1_3_RA2_01_1232.d 2.38E5 3 3 395 423 Deamidation (NQ); Carbamidomethylation
R.SLE(+14.02)DFVVSLQR.V Y 70.40 1305.6929 11 -0.9 653.8531 2 85.35 3 51956 AEV_3_3_RA3_01_1233.d 1.44E6 5 5 910 920 Methylation(others)
R.LTEVEAPE(+14.02)VVPGDILQVEEGTIIPADGR.I Y 70.35 2959.5388 28 2.5 987.5227 3 89.76 2 47105 AEV_1_3_RA2_01_1232.d 1.24E6 3 3 197 224 Methylation(others)
R.GQHIPPNHLGTSVPSGAFPGKPTESVPE(+14.02)EK.K Y 70.00 3107.5676 30 9.3 622.5266 5 68.85 2 31991 AEV_1_3_RA2_01_1232.d 1.04E6 1 1 11 40 Methylation(others)
K.R(+14.02)GEAFMVITSTGDNTFVGR.A Y 69.95 2071.0156 19 2.8 691.3478 3 78.61 3 46982 AEV_3_3_RA3_01_1233.d 1.73E5 3 3 262 280 Methylation(KR)
K.VLEFHPFDPVSK(+14.02).K Y 69.36 1427.7449 12 -0.4 476.9221 3 75.56 3 44565 AEV_3_3_RA3_01_1233.d 7.27E5 4 4 454 465 Methylation(KR)
R.ETSRQLGLGTNVYNAER(+14.02).L Y 69.06 1920.9653 17 -9.5 641.3230 3 66.51 3 37510 AEV_3_3_RA3_01_1233.d 1.93E5 1 1 576 592 Methylation(KR)
R.S(+14.02)LEDFVVSLQR.V Y 68.63 1305.6929 11 3.0 436.2395 3 85.62 2 44734 AEV_1_3_RA2_01_1232.d 4.85E5 2 2 910 920 Methylation(others)
K.TVEEDHAIPEDVD(+14.02)NAYK.N Y 68.60 1957.8905 17 1.4 979.9539 2 65.90 2 29882 AEV_1_3_RA2_01_1232.d 5.31E4 1 1 492 508 Methylation(others)
K.LS(+79.97)LAEPY(+162.05)C(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 68.50 3149.4006 27 -54.6 1050.7501 3 92.25 1 51263 AEV 2_3_RA2_01_1224.d 4.61E5 1 1 397 423 Phosphorylation (STY); Hexose (NSY); Carbamidomethylation
K.KVSAVVISPQ(+.98)GER.I Y 68.05 1369.7565 13 2.5 457.5939 3 51.46 3 26681 AEV_3_3_RA3_01_1233.d 5.81E5 4 4 466 478 Deamidation (NQ)
K.SVLTQYK.V Y 66.98 837.4596 7 2.6 419.7382 2 44.30 2 17621 AEV_1_3_RA2_01_1232.d 7.29E6 9 9 447 453
R.RGLM(+15.99)DQEVLSR.R Y 66.71 1318.6663 11 -0.8 440.5623 3 50.00 2 20446 AEV_1_3_RA2_01_1232.d 1.08E6 10 10 95 105 Oxidation (M)
K.HKGDTC(+57.02)YASSAVK.R Y 65.71 1422.6561 13 9.9 712.3424 2 17.14 3 6292 AEV_3_3_RA3_01_1233.d 4.44E5 5 5 249 261 Carbamidomethylation
K.TLGLSIKMLTGDAVGIAR.E Y 65.71 1815.0288 18 -21.8 606.0037 3 82.85 3 50205 AEV_3_3_RA3_01_1233.d 0 1 1 558 575
K.VSAVVISPQGER(+14.02).I Y 65.07 1254.6931 12 -3.4 628.3517 2 64.32 2 28814 AEV_1_3_RA2_01_1232.d 7.55E5 4 4 467 478 Methylation(KR)
K.ADTGIAVEGAS(+14.02)DAAR.S Y 65.06 1416.6844 15 4.0 709.3524 2 60.41 2 26170 AEV_1_3_RA2_01_1232.d 4.86E4 1 1 654 668 Methylation(others)
R.SLED(+14.02)FVVSLQR.V Y 64.86 1305.6929 11 -1.9 436.2374 3 81.44 2 41694 AEV_1_3_RA2_01_1232.d 4E5 3 3 910 920 Methylation(others)
R.GLMDQEVLSR(+14.02).R Y 64.35 1160.5859 10 0.5 581.3005 2 72.34 2 34611 AEV_1_3_RA2_01_1232.d 7.54E5 4 4 96 105 Methylation(KR)
K.LSAIESLAGVE(+14.02)ILC(+57.02)SDKTGTLTK.N Y 64.05 2419.2878 23 -0.8 807.4359 3 84.43 2 43917 AEV_1_3_RA2_01_1232.d 1.01E5 2 2 372 394 Methylation(others); Carbamidomethylation
R.GQHIPPN(+.98)HLGTSVPSGAFPGKPTESVPEEK(+14.02).K Y 63.92 3108.5515 30 -8.9 622.7120 5 69.26 3 39658 AEV_3_3_RA3_01_1233.d 7.07E5 2 2 11 40 Deamidation (NQ); Methylation(KR)
R.QLGLGTNVYNAER(+28.03).L Y 63.17 1461.7576 13 -2.4 731.8843 2 74.36 2 36147 AEV_1_3_RA2_01_1232.d 9.14E4 1 1 580 592 Dimethylation(KR)
K.QRSLEDFVVSLQR.V Y 62.99 1575.8369 13 2.0 526.2873 3 78.46 2 39339 AEV_1_3_RA2_01_1232.d 1.61E5 3 3 908 920
R.AKSVLTQYK.V Y 62.68 1036.5917 9 0.2 519.3032 2 29.85 3 13301 AEV_3_3_RA3_01_1233.d 3.48E5 4 4 445 453
R.Q(-17.03)LGLGTN(+.98)VYNAER.L Y 62.39 1417.6837 13 4.8 709.8525 2 80.13 2 40706 AEV_1_3_RA2_01_1232.d 4.31E5 2 2 580 592 Pyro-glu from Q; Deamidation (NQ)
R.SAADIVFLAPGLSAIIDALKTSR(+14.02).Q Y 62.10 2342.3208 23 0.8 781.7815 3 96.94 2 49983 AEV_1_3_RA2_01_1232.d 3.14E4 1 1 669 691 Methylation(KR)
K.K(+43.01)(+14.02)ADTGIAVEGASDAAR.S Y 62.05 1587.7852 16 8.6 530.2736 3 46.15 2 18506 AEV_1_3_RA2_01_1232.d 3.3E5 3 3 653 668 Carbamylation; Methylation(KR)
K.SLKYYPR.A Y 61.82 925.5021 7 5.0 463.7607 2 35.90 2 13548 AEV_1_3_RA2_01_1232.d 7.81E6 18 18 438 444
K.LSAIESLAGVEILC(+57.02)SDK(+14.02).T Y 61.81 1817.9445 17 -6.5 909.9736 2 85.00 3 51699 AEV_3_3_RA3_01_1233.d 1.42E5 3 3 372 388 Carbamidomethylation; Methylation(KR)
K.YNVVEILQQR(+14.02).G Y 60.74 1274.6982 10 0.6 425.9070 3 79.18 3 47422 AEV_3_3_RA3_01_1233.d 3E5 3 3 625 634 Methylation(KR)
R.GQHIPPNHLGTSVPSGAFPGK(+14.02)PTESVPEEK(+14.02).K Y 60.55 3121.5833 30 0.2 625.3240 5 70.62 2 33317 AEV_1_3_RA2_01_1232.d 0 1 1 11 40 Methylation(KR)
K.KVSAVVISPQGERITC(+57.02)VK.G Y 60.44 1970.0983 18 14.2 493.5388 4 63.35 2 28174 AEV_1_3_RA2_01_1232.d 1.1E5 1 1 466 483 Carbamidomethylation
R.SAADIVFLAPGLSAIIDALK(+14.02)TSR.Q Y 59.79 2342.3208 23 -3.1 781.7784 3 96.42 3 57816 AEV_3_3_RA3_01_1233.d 1.62E5 2 2 669 691 Methylation(KR)
K.VLE(+14.02)FHPFDPVSK.K Y 59.45 1427.7449 12 1.6 476.9230 3 77.00 2 38181 AEV_1_3_RA2_01_1232.d 3.81E5 2 2 454 465 Methylation(others)
K.KVSAVVISPQGER(+14.02).I Y 58.96 1382.7881 13 -0.9 461.9362 3 57.09 3 30285 AEV_3_3_RA3_01_1233.d 1.21E6 8 8 466 478 Methylation(KR)
K.YNVVEILQ(+.98)QR.G Y 58.10 1261.6666 10 1.5 631.8416 2 80.00 2 40566 AEV_1_3_RA2_01_1232.d 2.4E5 4 4 625 634 Deamidation (NQ)
K.LSAIESLAGVEILC(+57.02)S(+601.21)DK.T Y 57.97 2405.1350 17 -34.2 802.6915 3 87.89 1 48050 AEV 2_3_RA2_01_1224.d 7.97E5 1 1 372 388 Carbamidomethylation; EDT-maleimide-PEO-biotin
K.GAPLFVLK.T Y 57.84 843.5218 8 -1.9 844.5275 1 74.11 2 35960 AEV_1_3_RA2_01_1232.d 7.05E6 8 8 484 491
R.GLM(+15.99)DQEVLSRR.K Y 57.67 1318.6663 11 0.8 440.5630 3 49.50 3 25427 AEV_3_3_RA3_01_1233.d 7.13E5 4 4 96 106 Oxidation (M)
R.Q(+.98)LGLGTNVYNAER(+14.02).L Y 57.41 1448.7260 13 -2.3 725.3686 2 73.02 3 42635 AEV_3_3_RA3_01_1233.d 2.82E5 3 3 580 592 Deamidation (NQ); Methylation(KR)
K.TVEEDHAIPEDVDN(+.98)AYK.N Y 57.23 1944.8588 17 0.8 649.2941 3 64.32 3 35740 AEV_3_3_RA3_01_1233.d 1.08E5 2 2 492 508 Deamidation (NQ)
K.T(-2.02)VEEDHAIPEDVDNAYK.N Y 57.10 1941.8591 17 73.9 648.3415 3 63.46 2 28195 AEV_1_3_RA2_01_1232.d 2.96E4 2 2 492 508 2-amino-3-oxo-butanoic_acid
K.TVEEDHAIPEDVDNAYKN(+.98)K.V Y 56.61 2186.9968 19 6.0 730.0106 3 60.95 3 33145 AEV_3_3_RA3_01_1233.d 5.4E4 1 1 492 510 Deamidation (NQ)
K.YNVVE(+14.02)ILQQR.G Y 56.21 1274.6982 10 6.7 425.9095 3 77.78 2 38794 AEV_1_3_RA2_01_1232.d 2.29E5 3 3 625 634 Methylation(others)
K.Q(-17.03)RSLEDFVVSLQR(+14.02).V Y 55.44 1572.8259 13 -0.6 525.2823 3 85.48 2 44637 AEV_1_3_RA2_01_1232.d 7.48E4 1 1 908 920 Pyro-glu from Q; Methylation(KR)
K.LSAIESLAGVEILC(+57.02)SDKTGTLTK(+14.02).N Y 54.75 2419.2878 23 -4.1 807.4333 3 82.73 3 50117 AEV_3_3_RA3_01_1233.d 2.37E4 1 1 372 394 Carbamidomethylation; Methylation(KR)
R.GLMDQ(+.98)EVLSR.R Y 54.52 1147.5543 10 14.9 574.7930 2 68.66 3 39182 AEV_3_3_RA3_01_1233.d 6.47E5 4 4 96 105 Deamidation (NQ)
R.LGLGGGGTMPGS(+14.02)EVYDFVEAADGFAEVFPQHK.Y Y 54.48 3295.5496 32 -0.5 1099.5232 3 91.36 3 55477 AEV_3_3_RA3_01_1233.d 6.98E4 2 2 593 624 Methylation(others)
K.MLTGDAVGIAR(+14.02).E Y 53.47 1116.5961 11 -3.7 559.3032 2 67.02 3 37874 AEV_3_3_RA3_01_1233.d 6.07E5 3 3 565 575 Methylation(KR)
K.KADTGIAVEGASDAAR(+.98).S Y 53.42 1531.7478 16 12.3 511.5962 3 43.84 3 21804 AEV_3_3_RA3_01_1233.d 9.61E5 1 1 653 668 Deamidation (R)
K.TVEEDHAIPEDVDN(+.98)AYKNK.V Y 53.41 2186.9968 19 7.3 547.7605 4 60.44 3 32749 AEV_3_3_RA3_01_1233.d 3.41E5 2 2 492 510 Deamidation (NQ)
R.N(+.98)GR(+14.02)LTEVEAPEVVPGDILQVEEGTIIPADGR.I Y 53.27 3287.6885 31 -18.5 1096.8832 3 89.14 2 46796 AEV_1_3_RA2_01_1232.d 1.5E5 2 2 194 224 Deamidation (NQ); Methylation(KR)
R.N(+.98)GR(+14.02)LTEVEAPEVVPGDILQ(+.98)VEEGTIIPADGR.I Y 51.96 3288.6724 31 -13.3 1097.2168 3 88.99 3 54141 AEV_3_3_RA3_01_1233.d 0 1 1 194 224 Deamidation (NQ); Methylation(KR)
K.GAPLFVLK(+14.02).T Y 51.61 857.5374 8 2.9 858.5472 1 76.94 3 45654 AEV_3_3_RA3_01_1233.d 6.53E5 4 4 484 491 Methylation(KR)
K.VAEFATR.G Y 51.44 792.4130 7 2.4 397.2147 2 32.51 2 11951 AEV_1_3_RA2_01_1232.d 1.07E7 13 13 511 517
K.LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR(+.98).K Y 51.36 2908.3657 27 11.2 970.4734 3 91.30 2 47853 AEV_1_3_RA2_01_1232.d 1.2E5 2 2 397 423 Carbamidomethylation; Deamidation (R)
R.GQ(+.98)HIPPN(+.98)HLGTSVPSGAFPGKPTESVPEEK.K Y 51.25 3095.5200 30 11.5 620.1184 5 66.05 3 37107 AEV_3_3_RA3_01_1233.d 5.56E5 1 1 11 40 Deamidation (NQ)
K.RGEGSWEILGIMPC(+57.02)SDPPR.H Y 50.70 2156.0142 19 -3.2 719.6763 3 80.60 3 48531 AEV_3_3_RA3_01_1233.d 0 1 1 528 546 Carbamidomethylation
R.GLMDQEVLSRR.K Y 49.99 1302.6714 11 -4.7 652.3399 2 63.73 3 35305 AEV_3_3_RA3_01_1233.d 7.72E5 3 3 96 106
R.RGLMDQEVLSR(+14.02).R Y 49.31 1316.6870 11 5.4 439.9053 3 66.23 2 30120 AEV_1_3_RA2_01_1232.d 5.11E4 1 1 95 105 Methylation(KR)
R.SAAD(+14.02)IVFLAPGLSAIIDALK.T Y 48.18 1998.1400 20 12.6 667.0623 3 97.68 2 50262 AEV_1_3_RA2_01_1232.d 3.14E4 1 1 669 688 Methylation(others)
K.TVEEDHAIPEDVD(+14.02)NAYKNK.V Y 48.14 2200.0283 19 -13.9 551.0067 4 63.52 3 35140 AEV_3_3_RA3_01_1233.d 2.12E5 2 2 492 510 Methylation(others)
K.TLGLSIK.M Y 47.84 730.4589 7 1.2 366.2372 2 62.47 2 27554 AEV_1_3_RA2_01_1232.d 7.97E6 13 13 558 564
R.RGLMDQE(+14.02)VLSR.R Y 47.83 1316.6870 11 6.8 439.9059 3 67.07 2 30708 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 95 105 Methylation(others)
K.VAEFATR(+14.02).G Y 46.92 806.4286 7 1.2 404.2221 2 43.28 2 17097 AEV_1_3_RA2_01_1232.d 1.93E6 3 3 511 517 Methylation(KR)
R.GYLVAMTGDGVN(+.98)DAPSLKK.A Y 46.60 1935.9612 19 -1.4 646.3268 3 72.83 3 42445 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 635 653 Deamidation (NQ)
R.SAADIVFLAPGLSAIIDALKTSRQIFHR.M Y 45.68 3009.6763 28 1.8 602.9436 5 95.06 3 57251 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 669 696
K.AD(+14.02)TGIAVEGASDAAR.S Y 45.17 1416.6844 15 -0.7 709.3490 2 58.57 3 31347 AEV_3_3_RA3_01_1233.d 2.41E5 3 3 654 668 Methylation(others)
R.GLM(+15.99)DQEVLSR(+14.02).R Y 44.69 1176.5808 10 24.9 589.3123 2 61.97 3 33941 AEV_3_3_RA3_01_1233.d 0 1 1 96 105 Oxidation (M); Methylation(KR)
M.S(+42.01)DSITSGPR.G Y 44.32 960.4512 9 2.6 481.2341 2 46.58 2 18713 AEV_1_3_RA2_01_1232.d 5.27E6 10 10 2 10 Acetylation (Protein N-term)
R.GLMDQE(+14.02)VLSR.R Y 44.28 1160.5859 10 0.5 581.3005 2 73.52 2 35515 AEV_1_3_RA2_01_1232.d 6.36E5 4 4 96 105 Methylation(others)
K.NKVAEFATR.G Y 43.70 1034.5509 9 0.2 518.2828 2 31.33 3 14160 AEV_3_3_RA3_01_1233.d 1.44E6 6 6 509 517
R.G(+42.01)YLVAM(+15.99)TGDGVNDAPSLK.K Y 43.70 1864.8877 18 9.2 622.6422 3 64.82 3 36136 AEV_3_3_RA3_01_1233.d 4.36E5 2 2 635 652 Acetylation (N-term); Oxidation (M)
K.LSAIESLAGVE(+14.02)ILC(+57.02)SDK.T Y 43.60 1817.9445 17 7.5 606.9933 3 86.39 3 52630 AEV_3_3_RA3_01_1233.d 2.76E5 2 2 372 388 Methylation(others); Carbamidomethylation
K.VLEFH(+14.02)PFDPVSKK.V Y 43.26 1555.8398 13 1.2 389.9677 4 70.34 3 40490 AEV_3_3_RA3_01_1233.d 2.66E5 1 1 454 466 Methylation(others)
K.QRSLEDFVVSLQRVSTQHEKST Y 42.56 2573.3198 22 -8.5 515.6669 5 77.02 3 45712 AEV_3_3_RA3_01_1233.d 8.18E4 1 1 908 929
M.SDSITSGPR.G Y 42.18 918.4407 9 -83.1 460.1895 2 32.51 1 10355 AEV 2_3_RA2_01_1224.d 1.55E6 7 7 2 10
R.S(+41.03)LEDFVVSLQR.V Y 41.80 1332.7037 11 -8.3 445.2382 3 83.17 2 43005 AEV_1_3_RA2_01_1232.d 6.71E4 1 1 910 920 Amidination of lysines or N-terminal amines with methyl acetimidate
R.R(+14.02)GLM(+15.99)DQEVLSRR.K Y 41.76 1488.7831 12 -16.6 497.2601 3 66.41 2 30242 AEV_1_3_RA2_01_1232.d 6.31E5 5 5 95 106 Methylation(KR); Oxidation (M)
K.VLEFHPFD(+14.02)PVSK.K Y 41.73 1427.7449 12 0.5 476.9225 3 76.93 3 45640 AEV_3_3_RA3_01_1233.d 1.53E5 1 1 454 465 Methylation(others)
K.SLKYYPR(+14.02).A Y 40.99 939.5178 7 5.1 470.7686 2 40.94 3 20005 AEV_3_3_RA3_01_1233.d 1.83E5 1 1 438 444 Methylation(KR)
R.SLEDFVVSLQRVSTQHEKST Y 39.66 2289.1602 20 9.9 573.3030 4 81.18 2 41496 AEV_1_3_RA2_01_1232.d 2.2E5 1 1 910 929
K.G(+41.03)IDAIDKAFLK.S Y 39.44 1230.6971 11 -8.0 411.2364 3 73.49 2 35486 AEV_1_3_RA2_01_1232.d 2.1E4 1 1 427 437 Amidination of lysines or N-terminal amines with methyl acetimidate
K.VLE(+37.96)FHPFDPVSKK.V Y 37.75 1579.7800 13 44.9 395.9700 4 69.13 3 39558 AEV_3_3_RA3_01_1233.d 8.74E4 1 1 454 466 Replacement of proton by potassium
K.GIDAIDKAFLK(+14.02).S Y 37.74 1203.6863 11 -3.1 402.2348 3 75.27 3 44358 AEV_3_3_RA3_01_1233.d 3.79E5 2 2 427 437 Methylation(KR)
K.GIDAIDKAFLKSLKYYPR.A Y 37.35 2097.1621 18 2.6 420.4408 5 79.40 3 47603 AEV_3_3_RA3_01_1233.d 5.78E4 1 1 427 444
K.TVEEDHAIPEDVDN(+162.05)AY(+79.97)K.N Y 37.14 2185.8940 17 -35.3 729.6129 3 66.99 1 31635 AEV 2_3_RA2_01_1224.d 8.18E5 2 2 492 508 Hexose (NSY); Phosphorylation (STY)
K.LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAAS(-18.01)R(+14.02).K Y 36.88 2903.3867 27 65.9 968.8666 3 91.22 2 47817 AEV_1_3_RA2_01_1232.d 4.65E3 1 1 397 423 Carbamidomethylation; Dehydration; Methylation(KR)
K.K(+14.02)ADTGIAVEGASDAAR.S Y 36.86 1544.7794 16 -0.2 773.3969 2 47.52 3 24146 AEV_3_3_RA3_01_1233.d 3.46E5 2 2 653 668 Methylation(KR)
R.GLM(+15.99)DQ(+.98)EVLSR.R Y 36.80 1163.5492 10 -71.4 582.7404 2 63.77 1 29371 AEV 2_3_RA2_01_1224.d 3.15E5 2 2 96 105 Oxidation (M); Deamidation (NQ)
K.Q(-17.03)R(+14.02)SLEDFVVSLQR.V Y 36.20 1572.8259 13 3.0 525.2842 3 86.64 2 45392 AEV_1_3_RA2_01_1232.d 7.27E4 1 1 908 920 Pyro-glu from Q; Methylation(KR)
R.LGLGGGGTMPGSEVYD(+14.02)FVEAADGFAEVFPQHK.Y Y 35.99 3295.5496 32 0.0 1099.5238 3 91.56 2 47977 AEV_1_3_RA2_01_1232.d 4.44E4 1 1 593 624 Methylation(others)
K.VAE(+14.02)FATR.G Y 35.58 806.4286 7 -0.3 404.2215 2 43.52 3 21613 AEV_3_3_RA3_01_1233.d 2.71E6 6 6 511 517 Methylation(others)
R.GLM(-48.00)DQEVLSR.R Y 35.42 1098.5669 10 7.9 367.1991 3 40.42 2 15731 AEV_1_3_RA2_01_1232.d 1.6E6 5 5 96 105 Dethiomethyl
K.V(+42.01)AEFATR.G Y 35.26 834.4235 7 -93.8 418.1799 2 44.84 1 17198 AEV 2_3_RA2_01_1224.d 2.09E5 2 2 511 517 Acetylation (N-term)
K.VSAVVISP(+13.98)QGER.I Y 34.90 1254.6567 12 -76.2 628.2878 2 69.16 1 33332 AEV 2_3_RA2_01_1224.d 5.52E5 2 2 467 478 Proline oxidation to pyroglutamic acid
K.LSAIE(+14.02)SLAGVEILC(+57.02)SDK.T Y 34.72 1817.9445 17 5.0 909.9840 2 85.55 3 52074 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 372 388 Methylation(others); Carbamidomethylation
K.KADTGIAVE(+6.01)GASDAAR.S Y 34.69 1536.7720 16 10.6 513.2700 3 43.43 3 21554 AEV_3_3_RA3_01_1233.d 1.79E6 2 2 653 668 Replacement of proton by lithium
R.GQHIPPNHLGTSVPSGAFPGKPTES(+13.03)VPEEK.K Y 34.55 3106.5835 30 -7.2 622.3195 5 68.89 2 32018 AEV_1_3_RA2_01_1232.d 0 1 1 11 40 Michael addition with methylamine
K.TLALK.A N 34.51 544.3584 5 2.4 545.3670 1 27.25 2 9484 AEV_1_3_RA2_01_1232.d 1.02E5 1 1 184 188
K.TVEED(+28.03)HAIPEDVDNAYK.N Y 33.68 1971.9061 17 10.9 658.3165 3 67.82 2 31236 AEV_1_3_RA2_01_1232.d 7.59E3 1 1 492 508 Ethylation
K.M(-48.00)LTGDAVGIAR.E Y 33.30 1054.5771 11 -86.2 352.5027 3 63.53 1 29195 AEV 2_3_RA2_01_1224.d 1.44E6 5 5 565 575 Dethiomethyl
R.QLGLGTNVYN(+.98)AER.L Y 32.47 1434.7103 13 2.6 718.3643 2 69.08 3 39520 AEV_3_3_RA3_01_1233.d 4.24E5 1 1 580 592 Deamidation (NQ)
K.YGLNQMK.E Y 32.06 852.4164 7 -1.9 427.2147 2 42.73 3 21112 AEV_3_3_RA3_01_1233.d 3.89E5 2 2 109 115
R.LGLGGGGTMPGSE(+17.03)VYDFVEAADGFAEVFPQHK.Y Y 31.81 3298.5603 32 -7.0 1100.5197 3 91.27 3 55409 AEV_3_3_RA3_01_1233.d 1.23E5 1 1 593 624 Replacement of proton with ammonium ion
R.ITC(+57.02)VK(+14.02).G Y 31.77 633.3520 5 -120.0 634.2833 1 36.94 1 12681 AEV 2_3_RA2_01_1224.d 0 1 1 479 483 Carbamidomethylation; Methylation(KR)
R.G(+56.06)LMDQEVLSR.R Y 30.36 1202.6329 10 -17.0 602.3135 2 69.14 2 32202 AEV_1_3_RA2_01_1232.d 4.04E4 1 1 96 105 Diethylation
K.G(+43.01)APLFVLK.T Y 30.04 886.5276 8 -63.1 444.2431 2 73.77 2 35709 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 484 491 Carbamylation
R.GQHIPPNHLGTSVPS(+13.03)GAFPGKPTESVPEEK.K Y 29.82 3106.5835 30 -24.8 622.3086 5 67.33 2 30885 AEV_1_3_RA2_01_1232.d 1.16E5 1 1 11 40 Michael addition with methylamine
K.K(+14.02)AD(-18.01)TGIAVEGASDAAR.S Y 29.69 1526.7688 16 -18.9 509.9206 3 46.09 2 18477 AEV_1_3_RA2_01_1232.d 3.29E4 1 1 653 668 Methylation(KR); Dehydration
K.NKLSLAEPYC(+57.02)VAGVDPDD(+43.99)LMLTAC(+57.02)LAASR(+14.02).K Y 29.55 3207.5249 29 10.3 802.8967 4 82.01 2 42140 AEV_1_3_RA2_01_1232.d 1.91E5 1 1 395 423 Carbamidomethylation; Carboxylation (DKW); Methylation(KR)
K.NK(+14.02)LSLAEPYC(+57.02)VAGVDPDDLM(+15.99)LTAC(+57.02)LAASR.K Y 29.28 3179.5300 29 0.2 1060.8508 3 85.58 2 44709 AEV_1_3_RA2_01_1232.d 1.59E5 1 1 395 423 Methylation(KR); Carbamidomethylation; Oxidation (M)
K.ADTGIAVEGASDAAR(+28.03).S Y 28.92 1430.7001 15 5.8 716.3615 2 64.46 2 28874 AEV_1_3_RA2_01_1232.d 1.06E5 2 2 654 668 Dimethylation(KR)
R.LTEVEAPEVVPGDILQVEEGTIIPAD(-18.01)GR.I Y 28.44 2927.5127 28 4.1 976.8489 3 88.96 2 46700 AEV_1_3_RA2_01_1232.d 2.3E4 1 1 197 224 Dehydration
K.NK(+14.02)LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASRK.K Y 28.41 3291.6301 30 6.1 823.9199 4 85.51 2 44661 AEV_1_3_RA2_01_1232.d 0 1 1 395 424 Methylation(KR); Carbamidomethylation
K.TLGLS(-2.02)IKMLTGDAVGIAR.E Y 28.25 1813.0131 18 -64.8 605.3058 3 82.83 3 50189 AEV_3_3_RA3_01_1233.d 0 1 1 558 575 2-amino-3-oxo-butanoic_acid
R.GEGSWEILGIMPC(+57.02)SDPPRHDTAK.T Y 28.24 2552.1787 23 -16.8 639.0413 4 77.75 2 38772 AEV_1_3_RA2_01_1232.d 0 1 1 529 551 Carbamidomethylation
M.S(+42.01)DSITSGPR(+14.02).G Y 28.15 974.4669 9 -86.0 488.1988 2 62.88 1 28690 AEV 2_3_RA2_01_1224.d 4.42E5 1 1 2 10 Acetylation (Protein N-term); Methylation(KR)
K.GIDAIDK.A Y 28.01 730.3861 7 -88.4 366.1680 2 44.10 1 16740 AEV 2_3_RA2_01_1224.d 4.17E5 2 2 427 433
R.GEAFMVIT(+79.97)STGDN(+.98)TFVGR.A Y 28.00 1981.8492 18 -33.9 661.6013 3 63.36 1 29055 AEV 2_3_RA2_01_1224.d 1.47E5 2 2 263 280 Phosphorylation (STY); Deamidation (NQ)
R.R(+14.02)GLM(+15.99)DQEVLSRR(+14.02).K Y 27.38 1502.7987 12 -24.3 501.9280 3 70.05 3 40263 AEV_3_3_RA3_01_1233.d 3.97E5 1 1 95 106 Methylation(KR); Oxidation (M)
K.V(+42.01)S(+79.97)AVVISPQGER(+14.02).I Y 27.33 1376.6700 12 20.3 459.9066 3 58.98 2 25211 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 467 478 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
R.SLGVARK.R Y 27.10 729.4497 7 2.3 365.7330 2 13.48 3 4289 AEV_3_3_RA3_01_1233.d 8.11E4 2 2 521 527
R.GLMD(+14.02)QEVLSR.R Y 26.57 1160.5859 10 -1.9 581.2991 2 70.40 3 40539 AEV_3_3_RA3_01_1233.d 3.65E5 2 2 96 105 Methylation(others)
R.S(-2.02)LEDFVVSLQR.V Y 26.44 1289.6615 11 -21.4 645.8242 2 83.76 2 43482 AEV_1_3_RA2_01_1232.d 1.1E5 1 1 910 920 2-amino-3-oxo-butanoic_acid
R.GL(+53.97)MDQEVLSR.R Y 26.43 1200.5420 10 44.3 601.3049 2 68.66 3 39248 AEV_3_3_RA3_01_1233.d 5.88E4 1 1 96 105 Trifluoroleucine
K.LSAIES(+79.97)LAGVEILCSDKTGTLTK.N Y 26.06 2428.2173 23 -6.2 810.4080 3 84.19 3 51156 AEV_3_3_RA3_01_1233.d 8.15E4 1 1 372 394 Phosphorylation (STY)
R.ETSRQLGLGTN(+.98)VYNAER(+14.02).L Y 25.65 1921.9493 17 -27.0 641.6398 3 64.42 3 35821 AEV_3_3_RA3_01_1233.d 4.68E4 1 1 576 592 Deamidation (NQ); Methylation(KR)
K.VLEFHPFDPVS(-18.01)K(+14.02).K Y 25.56 1409.7343 12 -5.8 705.8703 2 76.07 2 37453 AEV_1_3_RA2_01_1232.d 0 1 1 454 465 Dehydration; Methylation(KR)
K.K(+43.99)VSAVVISPQGER.I Y 25.43 1412.7623 13 -39.2 471.9096 3 51.28 2 21102 AEV_1_3_RA2_01_1232.d 7.39E4 1 1 466 478 Carboxylation (DKW)
R.HDTAK(+42.01).T Y 25.27 612.2867 5 -3.8 613.2917 1 25.87 3 11064 AEV_3_3_RA3_01_1233.d 9.44E3 1 1 547 551 Acetylation (K)
R.RGLM(-4.99)DQEVLSR.R Y 24.94 1297.6851 11 -13.0 433.5634 3 63.26 2 28052 AEV_1_3_RA2_01_1232.d 9.5E4 1 1 95 105 Methionine replacement by azido homoalanine
R.A(+27.99)K(+42.01)SVLTQYK.V Y 24.89 1106.5972 9 -9.1 369.8696 3 52.47 2 21712 AEV_1_3_RA2_01_1232.d 0 1 1 445 453 Formylation; Acetylation (K)
R.GYLVAM(+15.99)TGDGVNDAPSLK(+14.02).K Y 24.83 1836.8927 18 1.1 919.4547 2 74.94 2 36572 AEV_1_3_RA2_01_1232.d 6.59E4 1 1 635 652 Oxidation (M); Methylation(KR)
R.RGLM(-48.00)DQEVLSR.R Y 24.77 1254.6680 11 4.3 419.2317 3 37.39 2 14221 AEV_1_3_RA2_01_1232.d 0 1 1 95 105 Dethiomethyl
R.SLGVAR.K Y 24.52 601.3547 6 14.6 301.6890 2 20.42 3 8046 AEV_3_3_RA3_01_1233.d 1.38E6 3 3 521 526
K.TVEEDHAIPED(+14.02)VDNAYKNK.V Y 24.33 2200.0283 19 1.8 734.3514 3 63.38 2 28140 AEV_1_3_RA2_01_1232.d 4.34E4 1 1 492 510 Methylation(others)
R.QLGLGTNVYN(+.98)AER(+14.02).L Y 24.23 1448.7260 13 1.5 725.3713 2 73.96 2 35861 AEV_1_3_RA2_01_1232.d 3.78E5 3 3 580 592 Deamidation (NQ); Methylation(KR)
R.GYLVAMTGDGVNDAPS(+162.05)LK.K Y 23.47 1968.9349 18 -21.9 493.2302 4 82.88 1 44085 AEV 2_3_RA2_01_1224.d 4.42E4 1 1 635 652 Hexose (NSY)
K.GIDAID(-18.01)K.A Y 22.92 712.3755 7 -15.6 713.3717 1 73.88 3 43254 AEV_3_3_RA3_01_1233.d 0 1 1 427 433 Dehydration
R.G(+42.01)LM(+15.99)DQEVLSR.R Y 22.70 1204.5758 10 -71.6 603.2521 2 60.87 1 27145 AEV 2_3_RA2_01_1224.d 1.07E5 2 2 96 105 Acetylation (N-term); Oxidation (M)
K.KVSAVVIS(+42.01)PQGER.I Y 22.63 1410.7831 13 -81.9 471.2298 3 48.46 3 24735 AEV_3_3_RA3_01_1233.d 8.77E4 2 2 466 478 Acetylation (TSCYH)
R.G(+42.01)YLVAM(+15.99)TGDGVNDAPSLKK.A Y 22.31 1992.9825 19 -77.4 499.2144 4 69.09 1 33255 AEV 2_3_RA2_01_1224.d 8.23E4 1 1 635 653 Acetylation (N-term); Oxidation (M)
K.R(+42.01)(+14.02)GEAFMVITSTGDNTFVGR.A Y 22.21 2113.0261 19 55.0 529.2928 4 70.15 2 32954 AEV_1_3_RA2_01_1232.d 0 1 1 262 280 Acetylation (N-term); Methylation(KR)
R.ITC(+57.02)VK.G Y 22.17 619.3363 5 -25.1 620.3281 1 79.07 2 39819 AEV_1_3_RA2_01_1232.d 9.64E4 2 2 479 483 Carbamidomethylation
K.MLTGDAVGIARETSR.Q Y 22.09 1575.8038 15 3.3 526.2770 3 64.51 2 28901 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 565 579
K.Y(+42.01)GLNQMK(+43.99).E Y 21.48 938.4167 7 -24.3 470.2043 2 56.69 1 24231 AEV 2_3_RA2_01_1224.d 0 1 1 109 115 Acetylation (N-term); Carboxylation (DKW)
R.SLGVAR(+14.02).K Y 21.41 615.3704 6 -18.4 616.3663 1 28.42 3 12485 AEV_3_3_RA3_01_1233.d 2.28E5 2 2 521 526 Methylation(KR)
K.T(+42.01)INEAK(+14.02).T Y 21.30 730.3861 6 -5.5 366.1983 2 17.58 3 6526 AEV_3_3_RA3_01_1233.d 0 1 1 552 557 Acetylation (N-term); Methylation(KR)
K.NK(-1.03)LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 20.99 3148.4878 29 46.5 1050.5520 3 88.20 2 46302 AEV_1_3_RA2_01_1232.d 0 1 1 395 423 Lysine oxidation to aminoadipic semialdehyde; Carbamidomethylation
K.TLGLSIK(+14.02).M Y 20.80 744.4745 7 -90.8 373.2108 2 77.64 1 39965 AEV 2_3_RA2_01_1224.d 1.89E5 1 1 558 564 Methylation(KR)
R.S(+42.01)LGVAR.K Y 20.78 643.3653 6 -2.3 644.3711 1 79.37 2 40059 AEV_1_3_RA2_01_1232.d 0 1 1 521 526 Acetylation (N-term)
R.ETSRQLGLGTNVYNAER(-.98)(+14.02).L Y 20.54 1919.9813 17 -27.6 640.9834 3 64.31 3 35734 AEV_3_3_RA3_01_1233.d 5.51E4 1 1 576 592 Amidation; Methylation(KR)
K.KADTGIAVEGAS(-18.01)DAAR(+14.02).S Y 20.46 1526.7688 16 -95.1 509.8818 3 58.49 1 25428 AEV 2_3_RA2_01_1224.d 2.41E4 1 1 653 668 Dehydration; Methylation(KR)
K.TLGLSIK(+42.01)MLTGDAVGIAR.E Y 20.41 1857.0393 18 -20.3 465.2577 4 66.02 3 37079 AEV_3_3_RA3_01_1233.d 0 1 1 558 575 Acetylation (K)
K.M(+15.99)LTGDAVGIAR(+14.02).E Y 20.41 1132.5911 11 -90.7 567.2515 2 70.44 1 34297 AEV 2_3_RA2_01_1224.d 1.54E5 1 1 565 575 Oxidation (M); Methylation(KR)
K.KADTGIAVEGASD(+14.02)AAR.S Y 20.40 1544.7794 16 -80.4 515.8923 3 62.13 1 28101 AEV 2_3_RA2_01_1224.d 2.91E5 1 1 653 668 Methylation(others)
R.GYLVAMTGDGVNDAP(+13.98)SLK.K Y 20.23 1820.8615 18 -66.3 911.3776 2 84.31 1 45226 AEV 2_3_RA2_01_1224.d 1.29E5 1 1 635 652 Proline oxidation to pyroglutamic acid
K.SVLTQYKVLEFHPFDPVSKK.V Y 20.21 2361.2732 20 1.1 473.2625 5 77.77 3 46320 AEV_3_3_RA3_01_1233.d 1.81E5 1 1 447 466
R.GYLVAMTGDGVN(+.98)DAPS(+162.05)LK.K Y 20.12 1969.9189 18 2.3 493.4881 4 83.09 1 44259 AEV 2_3_RA2_01_1224.d 2.25E5 1 1 635 652 Deamidation (NQ); Hexose (NSY)
M(+226.08)(+15.99)SDSITSGPR.G Y 20.10 1291.5537 10 9.6 323.8988 4 63.91 1 29480 AEV 2_3_RA2_01_1224.d 0 1 1 1 10 Biotinylation; Oxidation (M)
R.R(+28.03)GLMDQEVLSRR.K Y 20.09 1486.8038 12 17.2 372.7146 4 45.14 2 18003 AEV_1_3_RA2_01_1232.d 3.69E4 1 1 95 106 Dimethylation(KR)
K.K(+43.01)(+14.02)VSAVVISPQGER.I Y 19.91 1425.7939 13 -94.6 476.2270 3 63.30 1 29005 AEV 2_3_RA2_01_1224.d 9.61E4 1 1 466 478 Carbamylation; Methylation(KR)
R.GQHIPPNHLGTSVPSGAFPGK(+14.02)PTESVPEEK.K Y 19.79 3107.5676 30 0.3 777.8994 4 69.31 2 32336 AEV_1_3_RA2_01_1232.d 4.98E5 1 1 11 40 Methylation(KR)
K.M(+15.99)LT(-18.01)GDAVGIAR.E Y 19.59 1100.5648 11 -6.6 551.2861 2 65.40 3 36596 AEV_3_3_RA3_01_1233.d 0 1 1 565 575 Oxidation (M); Dehydration
K.KADTGIAVEGASDAAR(+28.03).S Y 19.41 1558.7950 16 1.6 520.6064 3 58.82 2 25124 AEV_1_3_RA2_01_1232.d 7.92E4 1 1 653 668 Dimethylation(KR)
K.T(+79.96)LALK.A N 19.28 624.3152 5 -67.7 313.1438 2 41.77 1 15430 AEV 2_3_RA2_01_1224.d 9.81E4 1 1 184 188 Sulfation
R.R(+14.02)GLM(+31.99)DQEVLSRR.K Y 19.26 1504.7780 12 -27.8 502.5860 3 46.27 3 23358 AEV_3_3_RA3_01_1233.d 3.12E5 1 1 95 106 Methylation(KR); Sulphone
K.A(+42.01)VVLR.N N 18.78 598.3802 5 -74.3 300.1752 2 63.00 1 28817 AEV 2_3_RA2_01_1224.d 0 1 1 189 193 Acetylation (N-term)
R.AK(+42.01)S(+79.97)VLTQYK.V Y 18.68 1158.5686 9 -22.4 387.1882 3 73.50 1 36684 AEV 2_3_RA2_01_1224.d 0 1 1 445 453 Acetylation (K); Phosphorylation (STY)
R.RGLM(+15.99)DQ(+.98)EVLSR.R Y 18.68 1319.6503 11 25.6 440.9020 3 55.15 2 23088 AEV_1_3_RA2_01_1232.d 1.45E5 1 1 95 105 Oxidation (M); Deamidation (NQ)
R.LTEVEAPE(+21.98)VVPGDILQVEEGTIIPADGR(+14.02).I Y 18.52 2981.5208 28 -40.5 994.8073 3 93.87 3 56729 AEV_3_3_RA3_01_1233.d 0 1 1 197 224 Sodium adduct; Methylation(KR)
K.YGLNQM(+15.99)K.E Y 18.30 868.4113 7 -86.8 435.1752 2 35.33 1 11849 AEV 2_3_RA2_01_1224.d 1.25E5 1 1 109 115 Oxidation (M)
K.G(+43.01)IDAIDKAFLK.S Y 18.25 1232.6764 11 -65.2 411.8726 3 79.99 1 41878 AEV 2_3_RA2_01_1224.d 0 1 1 427 437 Carbamylation
M.S(+43.01)DSITSGPR.G Y 18.23 961.4465 9 -80.1 481.6920 2 51.87 1 21285 AEV 2_3_RA2_01_1224.d 2.07E5 1 1 2 10 Carbamylation
K.N(+43.01)K(+14.02)LSLAEPYC(+57.02)VAGVDPDDLMLTAC(+57.02)LAASR.K Y 18.08 3206.5410 29 1.9 802.6440 4 81.73 3 49395 AEV_3_3_RA3_01_1233.d 2.55E5 1 1 395 423 Carbamylation; Methylation(KR); Carbamidomethylation
K.V(+42.01)AEFATR(+14.02).G Y 17.94 848.4392 7 16.7 425.2339 2 45.17 2 18024 AEV_1_3_RA2_01_1232.d 2.1E5 1 1 511 517 Acetylation (N-term); Methylation(KR)
R.GEGSWEILGIM(+15.99)PC(+57.02)SDPPR.H Y 17.93 2015.9081 18 -1.0 404.1885 5 77.15 1 39573 AEV 2_3_RA2_01_1224.d 1.87E5 1 1 529 546 Oxidation (M); Carbamidomethylation
K.M(+43.01)LTGDAVGIAR.E Y 17.84 1145.5863 11 -103.4 573.7412 2 67.40 1 31948 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 565 575 Carbamylation
K.K(+14.02)ADTGIAVEGASDAAR(+14.02).S Y 17.81 1558.7950 16 46.6 520.6298 3 57.09 2 24148 AEV_1_3_RA2_01_1232.d 0 1 1 653 668 Methylation(KR)
K.M(+42.01)LTGDAVGIAR.E Y 17.78 1144.5911 11 -5.7 573.2996 2 61.33 2 26785 AEV_1_3_RA2_01_1232.d 0 1 1 565 575 Acetylation (N-term)
R.L(+43.01)GLGGGGTMPGSEVYDFVEAADGFAEVFPQHK(+14.02)YNVVEILQQR.G Y 17.72 4581.2275 42 3.2 917.2557 5 90.05 3 54751 AEV_3_3_RA3_01_1233.d 4.19E5 1 1 593 634 Carbamylation; Methylation(KR)
R.LTEVEAPEVVPGDILQVEEGT(+27.05)IIPADGR.I Y 17.67 2972.5706 28 -14.5 991.8498 3 94.69 3 57090 AEV_3_3_RA3_01_1233.d 0 1 1 197 224 Ethyl amino
K.G(+42.01)IDAIDK(+21.98).A Y 17.64 794.3786 7 -56.6 795.3409 1 94.80 1 53013 AEV 2_3_RA2_01_1224.d 1.31E4 1 1 427 433 Acetylation (N-term); Sodium adduct
R.NGRLTEVEAPEVVPGDILQVE(+14.02)EGTIIPADGR.I Y 17.62 3286.7043 31 5.5 1096.5814 3 92.48 2 48365 AEV_1_3_RA2_01_1232.d 1.33E3 1 1 194 224 Methylation(others)
R.N(+.98)GR(+14.02)LTEVEAPEVVPGDILQVEEGTIIPADGR(+14.02).I Y 17.53 3301.7041 31 5.4 1101.5813 3 93.14 3 56381 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 194 224 Deamidation (NQ); Methylation(KR)
R.NGRLTEVEAPEVVPGDILQVEEGTIIPADGR(+14.02).I Y 17.37 3286.7043 31 -3.5 1096.5715 3 88.51 2 46465 AEV_1_3_RA2_01_1232.d 0 1 1 194 224 Methylation(KR)
R.ETSRQLGLGTNVY(-2.02)NAER.L Y 17.36 1904.9340 17 -22.1 635.9713 3 63.71 2 28371 AEV_1_3_RA2_01_1232.d 2.93E4 1 1 576 592 2-amino-3-oxo-butanoic_acid
R.G(+43.01)LMDQEVLSR.R Y 17.34 1189.5760 10 -89.3 595.7422 2 66.60 1 31324 AEV 2_3_RA2_01_1224.d 4.86E4 1 1 96 105 Carbamylation
R.ETSR(+14.02)QLGLGTNVYNAER(-.98).L Y 17.16 1919.9813 17 -7.2 640.9965 3 64.20 2 28699 AEV_1_3_RA2_01_1232.d 4.92E4 1 1 576 592 Methylation(KR); Amidation
R.RGLMDQEVLSRRK.K Y 17.15 1586.8674 13 -2.8 529.9616 3 74.65 3 43857 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 95 107
K.Y(+42.01)NVVEILQQRGYLVAMTGDGVN(+.98)DAPSLK.K Y 17.07 3092.5488 28 10.1 774.1523 4 87.26 2 45777 AEV_1_3_RA2_01_1232.d 7.18E4 1 1 625 652 Acetylation (N-term); Deamidation (NQ)
K.R(+43.01)(+14.02)GEAFMVITSTGDNTFVGR.A Y 16.96 2114.0215 19 -0.4 705.6808 3 68.70 3 39216 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 262 280 Carbamylation; Methylation(KR)
R.VS(+79.97)TQ(+.98)HEK(+14.02)ST Y 16.94 1110.4595 9 -14.5 1111.4507 1 104.29 1 57098 AEV 2_3_RA2_01_1224.d 0 1 1 921 929 Phosphorylation (STY); Deamidation (NQ); Methylation(KR)
R.NGR(+28.03)LTEVEAPEVVPGDILQVEEGTIIPADGR.I Y 16.85 3300.7200 31 1.3 1101.2487 3 90.06 2 47258 AEV_1_3_RA2_01_1232.d 7.11E4 1 1 194 224 Dimethylation(KR)
K.K(+14.02)VS(-18.01)AVVISPQGER.I Y 16.81 1364.7776 13 -31.0 455.9190 3 51.24 2 21081 AEV_1_3_RA2_01_1232.d 0 2 2 466 478 Methylation(KR); Dehydration
R.LTEVEAPE(+21.98)VVPGDILQ(+.98)VEEGTIIPADGR.I Y 16.72 2968.4893 28 -2.4 990.5013 3 89.70 3 54553 AEV_3_3_RA3_01_1233.d 1.56E5 1 1 197 224 Sodium adduct; Deamidation (NQ)
R.HDTAKTINEAK(+31.99).T Y 16.71 1258.6154 11 7.3 630.3195 2 76.29 2 37618 AEV_1_3_RA2_01_1232.d 7.27E4 1 1 547 557 Dihydroxy
K.TVEEDHAIPEDVDN(+.98)AYKNKVAEFATR.G Y 16.70 2961.3992 26 9.7 741.3643 4 73.18 2 35256 AEV_1_3_RA2_01_1232.d 1.99E5 1 1 492 517 Deamidation (NQ)
K.YNVVEILQQ(+.98)R.G Y 16.38 1261.6666 10 -89.4 631.7842 2 83.39 1 44506 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 625 634 Deamidation (NQ)
K.SVLTQYK(+14.02).V Y 16.28 851.4753 7 -90.9 426.7062 2 67.91 1 32363 AEV 2_3_RA2_01_1224.d 2.72E5 1 1 447 453 Methylation(KR)
K.QRS(+362.14)LEDFVVSLQR.V Y 16.23 1937.9734 13 14.9 647.0081 3 83.79 3 50869 AEV_3_3_RA3_01_1233.d 0 1 1 908 920 Nucleophilic addtion to cytopiloyne
R.QLGLGTN(+15.99)VYNAER.L Y 16.14 1449.7212 13 2.9 484.2491 3 23.10 3 9496 AEV_3_3_RA3_01_1233.d 0 1 1 580 592 Oxidation or Hydroxylation
R.G(+42.01)LM(+31.99)DQEVLSR.R Y 16.12 1220.5707 10 7.3 611.2971 2 57.07 3 30272 AEV_3_3_RA3_01_1233.d 2.82E5 1 1 96 105 Acetylation (N-term); Sulphone
K.YGLNQMKEEK.E Y 16.02 1238.5964 10 31.2 620.3248 2 38.98 3 18790 AEV_3_3_RA3_01_1233.d 0 1 1 109 118
K.T(+79.97)GTLTK.N N 16.00 699.3204 6 27.1 700.3467 1 73.73 3 43142 AEV_3_3_RA3_01_1233.d 7.17E4 1 1 389 394 Phosphorylation (STY)
K.AVVLR.N N 15.90 556.3696 5 -151.7 557.2925 1 99.16 1 55390 AEV 2_3_RA2_01_1224.d 0 1 1 189 193
K.AVVLRNGR(+28.03).L Y 15.83 911.5665 8 7.2 304.8650 3 57.99 3 30940 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 189 196 Dimethylation(KR)
K.S(+42.01)VLTQ(+.98)YK.V Y 15.78 880.4542 7 -5.3 881.4568 1 98.39 3 58513 AEV_3_3_RA3_01_1233.d 3.26E4 1 1 447 453 Acetylation (N-term); Deamidation (NQ)
K.TINEAK(-.98).T Y 15.64 673.3759 6 -55.9 674.3455 1 31.54 1 9828 AEV 2_3_RA2_01_1224.d 2.5E4 1 1 552 557 Amidation
R.Q(+226.08)LGLGTN(+.98)VYNAER.L Y 15.62 1660.7878 13 -56.8 416.1806 4 60.87 1 27123 AEV 2_3_RA2_01_1224.d 0 1 1 580 592 Biotinylation; Deamidation (NQ)
R.GLM(-4.99)DQEVLSRR.K Y 15.44 1297.6851 11 10.2 433.5734 3 64.60 2 28975 AEV_1_3_RA2_01_1232.d 3.11E4 1 1 96 106 Methionine replacement by azido homoalanine
K.VLE(+14.02)FHPFDPVSKK.V Y 15.37 1555.8398 13 -89.0 389.9326 4 81.27 1 42863 AEV 2_3_RA2_01_1224.d 2.69E5 1 1 454 466 Methylation(others)
K.NQKQR(+14.02)S(-18.01)LEDFVVSLQR.V Y 15.29 1942.0385 16 -5.7 648.3497 3 83.57 3 50720 AEV_3_3_RA3_01_1233.d 1.54E4 1 1 905 920 Methylation(KR); Dehydration
K.QRSLEDFVVS(-18.01)LQ(+.98)R.V Y 15.19 1558.8103 13 7.8 390.7129 4 62.20 3 34119 AEV_3_3_RA3_01_1233.d 1.53E5 1 1 908 920 Dehydration; Deamidation (NQ)
K.TINEAKTLGLSIK.M Y 15.14 1386.8082 13 9.5 463.2811 3 66.59 2 30376 AEV_1_3_RA2_01_1232.d 0 1 1 552 564
R.HDTAK(+42.01)TINEAK(+42.01).T Y 15.03 1310.6466 11 -47.6 328.6533 4 61.07 1 27277 AEV 2_3_RA2_01_1224.d 0 1 1 547 557 Acetylation (K)
K.VSAVVIS(+79.97)PQGER.I Y 15.02 1320.6438 12 25.4 661.3459 2 52.70 3 27520 AEV_3_3_RA3_01_1233.d 3.29E4 1 1 467 478 Phosphorylation (STY)
total 316 peptides
C1G5F6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.YDSTHGQFKGDIEHSGGNNLTVNNK.T Y 200.00 2731.2585 25 3.8 683.8245 4 57.58 2 24426 AEV_1_3_RA2_01_1232.d 3.18E6 9 9 48 72
R.VPTANVSVVDLTC(+57.02)RTEKPVTYDQIK.A Y 200.00 2832.4690 25 4.4 709.1276 4 74.59 2 36366 AEV_1_3_RA2_01_1232.d 2E6 6 6 235 259 Carbamidomethylation
K.SYRPDISVLSNASC(+57.02)TTNC(+57.02)LAPLAK.V Y 200.00 2637.2891 24 2.8 880.1061 3 78.86 2 39671 AEV_1_3_RA2_01_1232.d 3.72E6 8 8 139 162 Carbamidomethylation
K.VIHDNFGIAEGLMTTIHSYTATQK.T Y 200.00 2646.3113 24 3.3 530.2713 5 83.57 2 43325 AEV_1_3_RA2_01_1232.d 2.31E6 7 7 163 186
R.NAVEHDDVEIVAVNDPFIETNYAAYMLK.Y Y 161.93 3179.5120 28 5.0 1060.8499 3 87.20 2 45761 AEV_1_3_RA2_01_1232.d 7.34E5 3 3 20 47
K.VIISAPSADAPMFVMGVNEK.S Y 155.12 2075.0430 20 1.9 1038.5308 2 83.32 2 43136 AEV_1_3_RA2_01_1232.d 1.06E6 5 5 119 138
K.KVIISAPSADAPM(+15.99)FVMGVNEK.S Y 147.75 2219.1331 21 0.5 740.7186 3 76.79 2 38034 AEV_1_3_RA2_01_1232.d 2.15E5 2 2 118 138 Oxidation (M)
K.KVIISAPSADAPMFVMGVNEK.S Y 147.58 2203.1379 21 2.8 735.3887 3 79.59 2 40238 AEV_1_3_RA2_01_1232.d 1.49E6 8 8 118 138
R.VPTANVSVVDLTC(+57.02)R.T Y 145.42 1529.7871 14 1.0 765.9016 2 73.71 2 35681 AEV_1_3_RA2_01_1232.d 2.5E6 8 8 235 248 Carbamidomethylation
K.HGVDYVVESTGVFTTTEK.A Y 144.27 1967.9476 18 1.4 656.9907 3 74.33 2 36124 AEV_1_3_RA2_01_1232.d 2.73E6 7 7 90 107
K.AASEGELKGILGYSEDALVSTDLNGDPR.S Y 142.18 2876.4038 28 -0.7 959.8079 3 83.86 2 43514 AEV_1_3_RA2_01_1232.d 1.48E6 6 6 264 291
K.GILGYSEDALVSTDLNGDPR.S Y 132.50 2091.0120 20 3.4 1046.5168 2 82.23 2 42319 AEV_1_3_RA2_01_1232.d 7.72E5 6 6 272 291
K.HGVDYVVESTGVFTTTEKAK.A Y 121.58 2167.0796 20 19.2 542.7876 4 70.82 2 33520 AEV_1_3_RA2_01_1232.d 1.54E6 6 6 90 109
R.SSIFDASAGIALNDRFVK.L Y 116.93 1909.9897 18 -0.9 956.0013 2 80.55 2 40998 AEV_1_3_RA2_01_1232.d 1.74E6 6 6 292 309
K.KVIISAPSADAPM(+15.99)FVM(+15.99)GVNEK.S Y 116.92 2235.1279 21 -0.2 746.0497 3 72.46 3 42154 AEV_3_3_RA3_01_1233.d 1.56E5 1 1 118 138 Oxidation (M)
R.VLDLIAYIAKVDAGK Y 114.16 1587.9236 15 3.0 530.3167 3 86.01 2 45005 AEV_1_3_RA2_01_1232.d 7.19E5 5 5 324 338
K.VIHDNFGIAEGLM(+15.99)TTIHSYTATQK.T Y 111.02 2662.3062 24 8.0 533.4728 5 79.31 2 40009 AEV_1_3_RA2_01_1232.d 4.9E5 3 3 163 186 Oxidation (M)
R.RVLDLIAYIAK.V Y 110.42 1273.7758 11 -36.9 425.5835 3 83.21 2 43054 AEV_1_3_RA2_01_1232.d 6.81E5 5 5 323 333
K.LISWYDNEWGYSR.R Y 106.68 1687.7631 13 -2.8 844.8865 2 81.28 3 49058 AEV_3_3_RA3_01_1233.d 3.25E5 3 3 310 322
K.SYRPDISVLSNASC(+57.02)TTNC(+57.02)LAPLAK(+14.02).V Y 104.01 2651.3047 24 2.2 884.7775 3 79.78 2 40386 AEV_1_3_RA2_01_1232.d 5.16E5 3 3 139 162 Carbamidomethylation; Methylation(KR)
R.TAAQNIIPSSTGAAK.A Y 102.13 1428.7572 15 1.4 715.3869 2 58.43 2 24992 AEV_1_3_RA2_01_1232.d 1.45E7 14 14 201 215
K.HGVDYVVESTGVFTTTEK(+14.02).A Y 101.74 1981.9633 18 1.2 661.6625 3 76.69 2 37929 AEV_1_3_RA2_01_1232.d 3.66E5 2 2 90 107 Methylation(KR)
K.SYRPDISVLSNASC(+57.02)TTN(+.98)C(+57.02)LAPLAK.V Y 101.38 2638.2729 24 5.7 880.4366 3 78.60 3 46976 AEV_3_3_RA3_01_1233.d 1.55E6 4 4 139 162 Carbamidomethylation; Deamidation (NQ)
K.GDIEHSGGNNLTVNNK.T Y 101.09 1667.7863 16 1.0 834.9012 2 36.75 3 17423 AEV_3_3_RA3_01_1233.d 2.15E6 8 8 57 72
R.VLDLIAYIAK.V Y 101.06 1117.6747 10 1.9 559.8457 2 85.22 2 44480 AEV_1_3_RA2_01_1232.d 1.81E6 6 6 324 333
R.NAVEHDDVEIVAVNDPFIETNYAAYM(+15.99)LK.Y Y 100.48 3195.5071 28 5.5 1066.1821 3 84.38 2 43883 AEV_1_3_RA2_01_1232.d 2.6E5 2 2 20 47 Oxidation (M)
R.TEKPVTYDQIK.A Y 99.87 1320.6925 11 2.6 441.2393 3 41.30 2 16130 AEV_1_3_RA2_01_1232.d 5.59E6 14 14 249 259
K.VIISAPSADAPMFVM(+15.99)GVNEK.S Y 98.27 2091.0381 20 1.2 1046.5276 2 80.02 2 40597 AEV_1_3_RA2_01_1232.d 2.3E5 2 2 119 138 Oxidation (M)
K.SYR(+14.02)PDISVLSNASC(+57.02)TTNC(+57.02)LAPLAK.V Y 96.37 2651.3047 24 2.6 884.7778 3 78.80 2 39633 AEV_1_3_RA2_01_1232.d 1.84E5 2 2 139 162 Methylation(KR); Carbamidomethylation
R.RVLDLIAYIAKVDAGK Y 95.68 1744.0247 16 1.6 582.3497 3 85.31 2 44524 AEV_1_3_RA2_01_1232.d 4.55E5 3 3 323 338
K.TIHFYQERDPTNIPWGK.H Y 93.14 2101.0381 17 1.8 526.2678 4 72.05 3 41835 AEV_3_3_RA3_01_1233.d 3.04E6 8 8 73 89
K.GILGYSEDALVSTDLN(+.98)GDPR.S Y 93.14 2091.9961 20 2.6 1047.0081 2 82.67 2 42633 AEV_1_3_RA2_01_1232.d 7.21E5 5 5 272 291 Deamidation (NQ)
K.AASEGELK(+14.02)GILGYSEDALVSTDLNGDPR.S Y 91.17 2890.4194 28 0.8 964.4812 3 84.65 3 51455 AEV_3_3_RA3_01_1233.d 2.93E5 2 2 264 291 Methylation(KR)
K.AASEGELKGILGYSEDALVSTDLNGDPR(+14.02).S Y 89.63 2890.4194 28 0.9 964.4813 3 84.18 3 51180 AEV_3_3_RA3_01_1233.d 3.75E5 2 2 264 291 Methylation(KR)
R.TAAQNIIPSSTGAAKAVGK.V Y 87.64 1783.9791 19 -0.6 595.6666 3 60.94 3 33152 AEV_3_3_RA3_01_1233.d 1.43E5 2 2 201 219
K.KVIISAPSADAPMFVMGVNEK(+14.02).S Y 85.65 2217.1538 21 3.2 740.0609 3 80.85 2 41230 AEV_1_3_RA2_01_1232.d 2.33E5 2 2 118 138 Methylation(KR)
K.LTGM(+15.99)AM(+15.99)RVPTANVSVVDLTC(+57.02)R.T Y 85.31 2322.1494 21 13.8 775.0677 3 72.01 3 41808 AEV_3_3_RA3_01_1233.d 1.31E5 2 2 228 248 Oxidation (M); Carbamidomethylation
R.GGRTAAQNIIPSSTGAAK.A Y 84.93 1698.9012 18 -0.8 567.3073 3 50.13 3 25812 AEV_3_3_RA3_01_1233.d 1.13E6 9 9 198 215
K.YDSTHGQFKGDIEHSGGN(+.98)NLTVNNK.T Y 84.88 2732.2427 25 0.9 547.4563 5 57.44 3 30538 AEV_3_3_RA3_01_1233.d 1.02E6 2 2 48 72 Deamidation (NQ)
R.VPTANVSVVDLTC(+57.02)R(+14.02)TEKPVTYDQIK.A Y 84.31 2846.4849 25 -4.8 949.8311 3 76.16 3 45042 AEV_3_3_RA3_01_1233.d 1.02E5 2 2 235 259 Carbamidomethylation; Methylation(KR)
K.TVDGPSHKDWR.G Y 83.66 1296.6211 11 13.6 433.2202 3 24.65 3 10418 AEV_3_3_RA3_01_1233.d 4.75E6 18 18 187 197
K.YDSTHGQFK.G Y 82.50 1081.4829 9 3.8 541.7508 2 19.72 2 6304 AEV_1_3_RA2_01_1232.d 7.45E5 7 7 48 56
K.VIISAPSADAPM(+15.99)FVM(+15.99)GVNEK.S Y 82.35 2107.0330 20 0.6 1054.5244 2 76.96 3 45662 AEV_3_3_RA3_01_1233.d 1.45E5 2 2 119 138 Oxidation (M)
K.LISWYDNEWGYSRR.V Y 80.95 1843.8641 14 0.2 615.6288 3 76.93 3 45636 AEV_3_3_RA3_01_1233.d 3.04E5 2 2 310 323
R.NAVEHDDVEIVAVNDPFIE(+14.02)TNYAAYMLK.Y Y 80.41 3193.5278 28 2.8 1065.5195 3 88.40 3 53833 AEV_3_3_RA3_01_1233.d 6.46E4 1 1 20 47 Methylation(others)
K.VIHDN(+.98)FGIAEGLMTTIHSYTATQK.T Y 80.34 2647.2952 24 7.9 662.8363 4 83.76 2 43437 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 163 186 Deamidation (NQ)
K.AASEGELKGILGYSEDALVSTDLN(+.98)GDPR.S Y 80.27 2877.3879 28 7.6 960.1439 3 83.92 2 43563 AEV_1_3_RA2_01_1232.d 1.08E6 4 4 264 291 Deamidation (NQ)
R.VPTANVSVVDLTC(+57.02)RTEKPVTYDQIK(+14.02).A Y 80.18 2846.4849 25 -6.1 712.6241 4 75.51 3 44532 AEV_3_3_RA3_01_1233.d 5.94E4 1 1 235 259 Carbamidomethylation; Methylation(KR)
R.VPTANVSVVDLTC(+57.02)R(+14.02).T Y 79.59 1543.8029 14 1.9 772.9102 2 75.52 2 37077 AEV_1_3_RA2_01_1232.d 1.16E5 3 3 235 248 Carbamidomethylation; Methylation(KR)
K.AHLSGGAKK.V Y 79.48 867.4926 9 4.8 434.7556 2 8.14 2 1913 AEV_1_3_RA2_01_1232.d 1.77E4 2 2 110 118
K.AASEGELKGILGYSE(+14.02)DALVSTDLNGDPR.S Y 78.79 2890.4194 28 2.7 964.4830 3 86.11 2 45049 AEV_1_3_RA2_01_1232.d 7.9E5 3 3 264 291 Methylation(others)
K.VIISAPSADAPMFVMGVNEK(+14.02).S Y 78.78 2089.0588 20 4.6 1045.5415 2 84.64 2 44082 AEV_1_3_RA2_01_1232.d 2.79E5 4 4 119 138 Methylation(KR)
R.VPTANVSVVDLTC(+57.02)RTEKPVTYDQIKAAVK.A Y 77.40 3201.7068 29 -15.4 641.3387 5 75.53 3 44545 AEV_3_3_RA3_01_1233.d 1.52E5 2 2 235 263 Carbamidomethylation
K.YDSTHGQFKGDIEHSGGNNLTVN(+.98)NK.T Y 77.17 2732.2427 25 3.3 684.0702 4 57.41 3 30521 AEV_3_3_RA3_01_1233.d 2.54E5 2 2 48 72 Deamidation (NQ)
K.VIHDNFGIAE(+14.02)GLMTTIHSYTATQK.T Y 75.66 2660.3269 24 13.2 666.0978 4 83.81 2 43476 AEV_1_3_RA2_01_1232.d 5.91E5 3 3 163 186 Methylation(others)
K.YDSTHGQFKGDIEHSGGNNLTVNNK(+14.02).T Y 75.43 2745.2742 25 1.8 550.0631 5 58.23 3 31107 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 48 72 Methylation(KR)
R.TAAQNIIPSSTGAAK(+14.02).A Y 73.99 1442.7728 15 -3.2 722.3914 2 61.32 3 33518 AEV_3_3_RA3_01_1233.d 1.06E6 3 3 201 215 Methylation(KR)
K.AASEGELKGILGYSED(+14.02)ALVSTDLNGDPR.S Y 73.26 2890.4194 28 0.7 964.4811 3 85.82 3 52292 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 264 291 Methylation(others)
K.VIPALNGK.L Y 73.01 810.4963 8 -2.0 811.5020 1 47.01 3 23823 AEV_3_3_RA3_01_1233.d 2.48E6 10 10 220 227
K.YDSTHGQFKGDIEH(+14.02)SGGNNLTVNNK.T Y 72.89 2745.2742 25 -5.0 550.0594 5 58.92 3 31608 AEV_3_3_RA3_01_1233.d 2.8E5 1 1 48 72 Methylation(others)
R.SSIFDASAGIALNDR.F Y 71.58 1535.7579 15 -3.5 512.9248 3 78.77 3 47108 AEV_3_3_RA3_01_1233.d 7.67E5 6 6 292 306
R.NAVEHDDVE(+14.02)IVAVNDPFIETNYAAYMLK.Y Y 69.52 3193.5278 28 0.5 1065.5171 3 87.86 3 53506 AEV_3_3_RA3_01_1233.d 1.84E5 2 2 20 47 Methylation(others)
K.VIHDNFGIAEGLM(-4.99)TTIHSYTATQK.T Y 69.28 2641.3250 24 22.9 529.2844 5 83.60 2 43321 AEV_1_3_RA2_01_1232.d 7.44E4 1 1 163 186 Methionine replacement by azido homoalanine
K.AASEGE(+14.02)LKGILGYSEDALVSTDLNGDPR.S Y 69.16 2890.4194 28 2.7 964.4830 3 85.50 2 44653 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 264 291 Methylation(others)
K.SYRPDISVLSNASC(+57.02)T(-2.02)TNC(+57.02)LAPLAK.V Y 69.01 2635.2734 24 43.8 879.4702 3 79.44 2 40114 AEV_1_3_RA2_01_1232.d 7.56E4 1 1 139 162 Carbamidomethylation; 2-amino-3-oxo-butanoic_acid
K.VGINGFGR.I Y 67.45 818.4399 8 3.5 410.2286 2 58.89 2 25161 AEV_1_3_RA2_01_1232.d 2.67E6 6 6 5 12
K.AVGKVIPALNGK.L Y 67.18 1165.7183 12 -4.9 389.5781 3 58.60 2 24993 AEV_1_3_RA2_01_1232.d 6.12E5 4 4 216 227
K.AAVKAASEGELK.G Y 66.85 1172.6400 12 -23.8 587.3134 2 25.10 3 10640 AEV_3_3_RA3_01_1233.d 6.89E4 3 3 260 271
K.TIHFYQER.D Y 65.97 1092.5352 8 4.3 547.2772 2 47.98 2 19450 AEV_1_3_RA2_01_1232.d 2.63E6 10 10 73 80
R.TEKPVTYDQ(+.98)IK.A Y 65.73 1321.6765 11 -0.9 661.8450 2 42.63 3 21054 AEV_3_3_RA3_01_1233.d 8.32E5 4 4 249 259 Deamidation (NQ)
R.VLDLIAYIAK(+14.02).V Y 64.28 1131.6903 10 1.4 566.8532 2 86.65 3 52800 AEV_3_3_RA3_01_1233.d 1.22E5 2 2 324 333 Methylation(KR)
K.AKAHLSGGAK.K Y 61.83 938.5297 10 -18.2 470.2636 2 9.08 3 2195 AEV_3_3_RA3_01_1233.d 6.66E3 2 2 108 117
K.GDIEHSGGNNLTVNNK(+14.02).T Y 61.81 1681.8020 16 5.9 561.6113 3 45.18 2 18030 AEV_1_3_RA2_01_1232.d 1.66E5 2 2 57 72 Methylation(KR)
R.TAAQN(+.98)IIPSSTGAAK.A Y 61.62 1429.7412 15 11.8 715.8863 2 57.82 3 30825 AEV_3_3_RA3_01_1233.d 1.66E6 7 7 201 215 Deamidation (NQ)
K.HGVDYVVE(+14.02)STGVFTTTEK.A Y 61.36 1981.9633 18 5.9 661.6656 3 75.48 3 44602 AEV_3_3_RA3_01_1233.d 1.79E5 1 1 90 107 Methylation(others)
K.GILGYSEDALVSTDLNGDPR(+14.02).S Y 60.05 2105.0276 20 -1.6 1053.5194 2 82.74 3 50125 AEV_3_3_RA3_01_1233.d 1.78E5 2 2 272 291 Methylation(KR)
K.VIPALN(+.98)GKLTGMAMR.V Y 59.79 1571.8528 15 0.6 524.9585 3 76.34 2 37657 AEV_1_3_RA2_01_1232.d 1.62E5 1 1 220 234 Deamidation (NQ)
K.VIISAPSADAPM(+15.99)FVMGVNEK.S Y 59.06 2091.0381 20 2.4 1046.5288 2 80.45 2 40918 AEV_1_3_RA2_01_1232.d 1.7E5 1 1 119 138 Oxidation (M)
K.GD(+14.02)IEHSGGNNLTVNNK.T Y 58.52 1681.8020 16 3.6 561.6100 3 47.75 2 19359 AEV_1_3_RA2_01_1232.d 9.99E4 1 1 57 72 Methylation(others)
K.VIH(+40.03)DNFGIAEGLMTTIHSYTATQK.T Y 58.34 2686.3425 24 30.6 538.2922 5 83.68 2 43378 AEV_1_3_RA2_01_1232.d 0 1 1 163 186 Propionaldehyde +40
K.VGIN(+.98)GFGR.I Y 57.88 819.4239 8 -1.7 410.7185 2 59.54 3 32069 AEV_3_3_RA3_01_1233.d 3.74E6 11 11 5 12 Deamidation (NQ)
K.AASE(+14.02)GELKGILGYSEDALVSTDLNGDPR.S Y 56.63 2890.4194 28 1.9 964.4822 3 85.49 3 52031 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 264 291 Methylation(others)
K.YDSTHGQFK(+14.02)GDIEHSGGNNLTVNNK.T Y 56.20 2745.2742 25 -0.6 687.3254 4 58.90 3 31600 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 48 72 Methylation(KR)
R.TAAQ(+.98)NIIPSSTGAAK.A Y 54.38 1429.7412 15 0.2 715.8780 2 59.57 3 32195 AEV_3_3_RA3_01_1233.d 1.85E6 3 3 201 215 Deamidation (NQ)
K.VIHDNFGIAEGLMTTIHSYTATQK(+14.02).T Y 53.87 2660.3269 24 -1.7 666.0879 4 83.64 3 50786 AEV_3_3_RA3_01_1233.d 5.35E5 2 2 163 186 Methylation(KR)
R.VLDLIAYIAKVDAGK(+14.02) Y 53.78 1601.9392 15 3.5 534.9889 3 86.57 2 45343 AEV_1_3_RA2_01_1232.d 1.11E5 2 2 324 338 Methylation(KR)
R.TEK(+14.02)PVTYDQIK.A Y 53.59 1334.7081 11 4.0 445.9117 3 50.08 2 20477 AEV_1_3_RA2_01_1232.d 9.42E5 4 4 249 259 Methylation(KR)
K.HGVDYVVE(+14.02)STGVFTTTEKAK.A Y 53.53 2181.0952 20 3.2 546.2828 4 72.45 2 34698 AEV_1_3_RA2_01_1232.d 0 1 1 90 109 Methylation(others)
R.DPTNIPWGK.H Y 52.78 1026.5134 9 -91.0 514.2173 2 71.18 1 34864 AEV 2_3_RA2_01_1224.d 5.37E5 3 3 81 89
R.T(-18.01)EK(+14.02)PVTYDQIK.A Y 51.59 1316.6976 11 -8.6 439.9027 3 39.47 3 19065 AEV_3_3_RA3_01_1233.d 7.86E4 3 3 249 259 Dehydration; Methylation(KR)
K.SYRPDISVLSNASC(+57.02)TTN(+.98)C(+57.02)LAPLAK(+14.02).V Y 51.20 2652.2888 24 3.8 885.1069 3 79.71 2 40329 AEV_1_3_RA2_01_1232.d 2.99E5 3 3 139 162 Carbamidomethylation; Deamidation (NQ); Methylation(KR)
K.HGVDYVVESTGVFTTTEK(-.98).A Y 51.14 1966.9636 18 7.3 984.4963 2 73.68 3 43102 AEV_3_3_RA3_01_1233.d 6.21E4 1 1 90 107 Amidation
K.TIHFYQERDPTNIPWGK(+14.02).H Y 51.11 2115.0537 17 1.9 529.7717 4 73.22 3 42777 AEV_3_3_RA3_01_1233.d 3.69E5 2 2 73 89 Methylation(KR)
R.TAAQ(+.98)N(+.98)IIPSSTGAAK.A Y 50.51 1430.7252 15 -0.9 716.3693 2 61.98 3 33953 AEV_3_3_RA3_01_1233.d 0 1 1 201 215 Deamidation (NQ)
K.VIISAPSADAPMFVMGVN(+.98)EK.S Y 49.33 2076.0271 20 5.8 1039.0269 2 84.08 2 43670 AEV_1_3_RA2_01_1232.d 0 1 1 119 138 Deamidation (NQ)
K.HGVDYVVES(-2.02)TGVFTTTEK.A Y 47.85 1965.9320 18 27.3 656.3358 3 74.37 2 36157 AEV_1_3_RA2_01_1232.d 4.85E4 3 3 90 107 2-amino-3-oxo-butanoic_acid
K.SYRPDISVLSN(+.98)ASC(+57.02)TTNC(+57.02)LAPLAK.V Y 47.80 2638.2729 24 0.6 1320.1445 2 79.56 3 47733 AEV_3_3_RA3_01_1233.d 2.8E5 2 2 139 162 Deamidation (NQ); Carbamidomethylation
K.VIPALN(+.98)GK.L Y 47.79 811.4803 8 0.4 812.4879 1 55.05 2 23031 AEV_1_3_RA2_01_1232.d 3.76E6 16 16 220 227 Deamidation (NQ)
R.NAVEH(+14.02)DDVEIVAVNDPFIETNYAAYMLK.Y Y 47.67 3193.5278 28 0.7 1065.5173 3 87.56 2 45947 AEV_1_3_RA2_01_1232.d 1.5E5 1 1 20 47 Methylation(others)
K.VGIN(+.98)GFGR(+14.02).I Y 43.84 833.4395 8 -1.1 417.7266 2 62.35 3 34234 AEV_3_3_RA3_01_1233.d 3.31E5 2 2 5 12 Deamidation (NQ); Methylation(KR)
K.AHLSGGAK.K Y 43.26 739.3976 8 -0.1 370.7061 2 8.56 2 2025 AEV_1_3_RA2_01_1232.d 5.62E3 1 1 110 117
R.VPTANVSVVDLTC(+57.02)R(+.98)TEKPVTYDQIK.A Y 43.03 2833.4531 25 0.2 709.3707 4 75.84 2 37264 AEV_1_3_RA2_01_1232.d 7.14E4 1 1 235 259 Carbamidomethylation; Deamidation (R)
K.TIHFYQER(+14.02)DPTNIPWGK.H Y 42.49 2115.0537 17 7.5 529.7747 4 75.60 2 37072 AEV_1_3_RA2_01_1232.d 4.12E5 2 2 73 89 Methylation(KR)
K.AKAHLSGGAKK.V Y 41.08 1066.6246 11 -12.4 534.3130 2 8.82 3 2110 AEV_3_3_RA3_01_1233.d 1.74E4 3 3 108 118
R.TAAQ(+.98)NIIPSSTGAAK(+14.02).A Y 41.08 1443.7568 15 9.0 722.8922 2 63.59 2 28283 AEV_1_3_RA2_01_1232.d 4.57E4 1 1 201 215 Deamidation (NQ); Methylation(KR)
K.V(+42.01)IIS(+79.97)APSADAPMFVM(+15.99)GVNEK.S Y 39.17 2213.0149 20 12.6 738.6882 3 76.51 2 37800 AEV_1_3_RA2_01_1232.d 1.09E4 1 1 119 138 Acetylation (N-term); Phosphorylation (STY); Oxidation (M)
R.TEKPVTYDQIK(+14.02).A Y 37.31 1334.7081 11 -14.6 668.3516 2 54.44 2 22718 AEV_1_3_RA2_01_1232.d 1.71E5 3 3 249 259 Methylation(KR)
K.T(+114.04)VDGPSHKDWR.G Y 37.13 1410.6641 11 55.1 353.6927 4 24.73 3 10425 AEV_3_3_RA3_01_1233.d 2.83E5 1 1 187 197 Ubiquitin
R.RVLDLIAYIAKVDAGK(+14.02) Y 35.57 1758.0403 16 -95.4 440.4754 4 97.04 1 54404 AEV 2_3_RA2_01_1224.d 3.86E4 1 1 323 338 Methylation(KR)
K.TIHFYQER(+14.02).D Y 34.65 1106.5509 8 -1.2 369.8571 3 56.54 3 29891 AEV_3_3_RA3_01_1233.d 3.32E5 4 4 73 80 Methylation(KR)
R.SSIFDASAGIALNDRFVK(+14.02).L Y 34.61 1924.0054 18 0.1 642.3425 3 81.63 2 41842 AEV_1_3_RA2_01_1232.d 3.38E5 2 2 292 309 Methylation(KR)
K.T(+79.96)IHFYQER.D Y 34.57 1172.4921 8 35.3 391.8517 3 48.40 2 19647 AEV_1_3_RA2_01_1232.d 3.7E4 1 1 73 80 Sulfation
M.VVKVGINGFGR.I Y 33.53 1144.6716 11 -40.9 573.3197 2 61.83 3 33863 AEV_3_3_RA3_01_1233.d 1.33E5 2 2 2 12
K.TVDGPSHKDWRGGR.T Y 33.42 1566.7651 14 4.7 523.2648 3 23.82 3 9890 AEV_3_3_RA3_01_1233.d 8.47E4 1 1 187 200
R.S(+44.01)SIFDASAGIALNDRFVK.L Y 33.18 1953.9982 18 -28.2 652.3217 3 80.31 3 48310 AEV_3_3_RA3_01_1233.d 1.52E5 1 1 292 309 S-Ethylcystine from Serine
K.GILGYSEDALVSTD(+14.02)LNGDPR.S Y 32.74 2105.0276 20 4.5 1053.5258 2 84.80 2 44182 AEV_1_3_RA2_01_1232.d 2.51E5 1 1 272 291 Methylation(others)
K.AASE(+14.02)GELK.G Y 32.51 817.4181 8 -88.6 818.3529 1 35.67 1 12026 AEV 2_3_RA2_01_1224.d 2.57E4 1 1 264 271 Methylation(others)
K.S(+43.01)YR(+14.02)PDISVLSNASC(+57.02)TTNC(+57.02)LAPLAK.V Y 32.36 2694.3105 24 3.6 899.1140 3 79.46 2 40135 AEV_1_3_RA2_01_1232.d 1.43E5 1 1 139 162 Carbamylation; Methylation(KR); Carbamidomethylation
K.HGVDYVVESTGVFTTTEK(+14.02)AK.A Y 32.34 2181.0952 20 -1.8 728.0377 3 73.64 2 35610 AEV_1_3_RA2_01_1232.d 2.82E4 1 1 90 109 Methylation(KR)
R.NAVEHDDVEIVAVNDPFIETNYAAYMLK(+14.02).Y Y 31.88 3193.5278 28 4.9 1065.5217 3 88.35 2 46380 AEV_1_3_RA2_01_1232.d 1.71E5 1 1 20 47 Methylation(KR)
K.GILGYSE(+14.02)DALVSTDLNGDPR.S Y 31.66 2105.0276 20 2.5 1053.5237 2 84.84 3 51589 AEV_3_3_RA3_01_1233.d 3.74E5 2 2 272 291 Methylation(others)
K.AASEGELK.G Y 30.78 803.4025 8 -87.2 402.6735 2 23.13 1 5798 AEV 2_3_RA2_01_1224.d 2.87E5 2 2 264 271
K.VIHDNFGIAEGLMT(-18.01)TIHSYTATQK.T Y 30.49 2628.3005 24 -0.6 526.6671 5 83.65 2 43360 AEV_1_3_RA2_01_1232.d 4.47E4 1 1 163 186 Dehydration
K.TVDGPSHK.D Y 30.44 839.4137 8 -58.8 840.3716 1 85.90 1 46492 AEV 2_3_RA2_01_1224.d 3.04E3 2 2 187 194
R.VPTANVS(-2.02)VVDLTC(+57.02)R.T Y 29.10 1527.7715 14 44.9 510.2873 3 73.73 2 35676 AEV_1_3_RA2_01_1232.d 4.88E4 1 1 235 248 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.RVLDLIAYIAK(+14.02).V Y 29.08 1287.7914 11 -90.2 430.2324 3 94.86 1 53054 AEV 2_3_RA2_01_1224.d 5.94E4 1 1 323 333 Methylation(KR)
K.AASEGELK(+14.02)GILGYSEDALVSTDLNGDPR(+14.02).S Y 28.98 2904.4351 28 16.3 969.1681 3 85.32 2 44533 AEV_1_3_RA2_01_1232.d 8.67E4 1 1 264 291 Methylation(KR)
K.LTGM(+15.99)AM(+15.99)R.V Y 28.85 810.3728 7 -101.3 406.1526 2 20.93 1 5034 AEV 2_3_RA2_01_1224.d 3.68E5 3 3 228 234 Oxidation (M)
R.T(+56.06)AAQNIIPSSTGAAK.A Y 28.81 1484.8198 15 19.3 743.4315 2 58.15 3 31056 AEV_3_3_RA3_01_1233.d 0 1 1 201 215 Diethylation
K.AVGKVIPALN(+.98)GK.L Y 28.79 1166.7023 12 1.1 389.9084 3 59.42 3 31973 AEV_3_3_RA3_01_1233.d 2E5 2 2 216 227 Deamidation (NQ)
K.V(+42.01)DAGK(+43.01) Y 26.14 573.2758 5 -48.0 574.2556 1 61.81 1 27854 AEV 2_3_RA2_01_1224.d 7.5E4 1 1 334 338 Acetylation (N-term); Carbamylation
K.KVIISAPSADAPMFVM(+15.99)GVNEK(+14.02).S Y 26.09 2233.1487 21 2.5 745.3920 3 77.84 2 38839 AEV_1_3_RA2_01_1232.d 9.52E3 1 1 118 138 Oxidation (M); Methylation(KR)
K.GDIE(+14.02)HSGGNNLTVNNK.T Y 26.08 1681.8020 16 2.2 561.6092 3 46.02 3 23198 AEV_3_3_RA3_01_1233.d 6.23E4 1 1 57 72 Methylation(others)
K.LTGMAM(+15.99)RVPTANVSVVDLTC(+57.02)R.T Y 24.51 2306.1545 21 -10.6 769.7173 3 75.99 3 44910 AEV_3_3_RA3_01_1233.d 8.71E4 1 1 228 248 Oxidation (M); Carbamidomethylation
K.VIISAPSADAPM(+15.99)FVMGVNEK(+14.02).S Y 24.35 2105.0537 20 1.9 1053.5361 2 81.64 2 41849 AEV_1_3_RA2_01_1232.d 9.42E4 1 1 119 138 Oxidation (M); Methylation(KR)
K.VDAGK(+21.98) Y 24.32 510.2414 5 -79.2 511.2083 1 46.30 1 18055 AEV 2_3_RA2_01_1224.d 8.47E4 4 4 334 338 Sodium adduct
K.AASEGELKGILGYSE(+28.03)DALVSTDLNGDPR.S Y 23.88 2904.4351 28 -1.1 969.1512 3 86.89 3 52939 AEV_3_3_RA3_01_1233.d 2.09E5 1 1 264 291 Ethylation
K.LISWYDNE(+14.02)WGYSR.R Y 23.84 1701.7787 13 5.8 851.9016 2 83.50 2 43250 AEV_1_3_RA2_01_1232.d 0 1 1 310 322 Methylation(others)
K.KVIISAPSAD(+53.92)APMFVMGVNEK.S Y 23.68 2257.0574 21 64.0 565.3077 4 72.71 2 34902 AEV_1_3_RA2_01_1232.d 6.65E4 1 1 118 138 Replacement of 2 protons by iron
K.VDAGK(+43.01) Y 23.20 531.2653 5 -38.2 532.2523 1 49.25 2 20071 AEV_1_3_RA2_01_1232.d 0 1 1 334 338 Carbamylation
K.GILGYSEDALVSTDLN(+.98)GDPR(+14.02).S Y 22.94 2106.0117 20 -1.1 1054.0120 2 83.65 3 50775 AEV_3_3_RA3_01_1233.d 1.66E4 1 1 272 291 Deamidation (NQ); Methylation(KR)
K.LTGMAM(+15.99)R.V Y 22.45 794.3779 7 26.2 398.2066 2 30.00 3 13384 AEV_3_3_RA3_01_1233.d 0 1 1 228 234 Oxidation (M)
K.LTGM(+15.99)AMRVPT(-18.01)ANVSVVDLTC(+57.02)RTEKPVTYDQIK.A Y 22.40 3590.8259 32 11.0 719.1804 5 78.47 2 39347 AEV_1_3_RA2_01_1232.d 0 1 1 228 259 Oxidation (M); Dehydration; Carbamidomethylation
K.YDSTHGQFK(-1.03)GDIEHSGGNNLTVNNK.T Y 22.17 2730.2271 25 30.9 547.0696 5 58.01 2 24641 AEV_1_3_RA2_01_1232.d 7.16E4 1 1 48 72 Lysine oxidation to aminoadipic semialdehyde
K.VDAGK Y 22.16 488.2594 5 -31.0 489.2516 1 34.31 3 15914 AEV_3_3_RA3_01_1233.d 1.07E5 3 3 334 338
R.D(+42.01)(-18.01)PTNIPWGK.H Y 21.38 1050.5134 9 28.2 526.2788 2 72.54 2 34761 AEV_1_3_RA2_01_1232.d 0 1 1 81 89 Acetylation (N-term); Dehydration
K.TVDGPSHK(+31.99)DWR.G Y 21.13 1328.6108 11 7.2 443.8807 3 14.15 2 4023 AEV_1_3_RA2_01_1232.d 5.34E4 1 1 187 197 Dihydroxy
R.VPTANVSVVDLT(-18.01)C(+57.02)R(+14.02)TEKPVTYDQIK.A Y 20.97 2828.4741 25 2.3 708.1274 4 74.91 2 36556 AEV_1_3_RA2_01_1232.d 0 1 1 235 259 Dehydration; Carbamidomethylation; Methylation(KR)
K.LISWYDNEWGYSR(+14.02)R.V Y 20.81 1857.8798 14 4.3 620.3032 3 78.97 3 47263 AEV_3_3_RA3_01_1233.d 5.6E4 1 1 310 323 Methylation(KR)
K.GDIEHSGGNNLT(-2.02)VNNK.T Y 20.47 1665.7706 16 -47.4 556.2379 3 50.55 1 20549 AEV 2_3_RA2_01_1224.d 0 1 1 57 72 2-amino-3-oxo-butanoic_acid
K.HGVDYVVESTGVFT(+14.02)TTEK.A Y 20.34 1981.9633 18 -88.8 991.9009 2 81.44 1 42966 AEV 2_3_RA2_01_1224.d 1.23E4 1 1 90 107 Methylation(others)
K.TVDGPSHKDWR(+21.98).G Y 20.32 1318.6030 11 -42.4 330.6440 4 66.43 1 31206 AEV 2_3_RA2_01_1224.d 2.89E4 1 1 187 197 Sodium adduct
K.VDAGK(+14.96) Y 20.25 503.2227 5 -69.5 504.1950 1 31.76 1 9965 AEV 2_3_RA2_01_1224.d 0 1 1 334 338 Alpha-amino adipic acid
K.YDSTHGQFK(+14.02).G Y 20.18 1095.4985 9 28.2 548.7720 2 31.87 2 11581 AEV_1_3_RA2_01_1232.d 0 1 1 48 56 Methylation(KR)
K.LTGMAMR.V Y 19.59 778.3830 7 14.8 390.2045 2 39.45 3 19051 AEV_3_3_RA3_01_1233.d 2.61E4 2 2 228 234
R.TAAQNIIPS(+79.97)STGAAK(+21.98).A Y 19.39 1530.7054 15 -19.1 511.2327 3 80.51 1 42245 AEV 2_3_RA2_01_1224.d 2.36E5 1 1 201 215 Phosphorylation (STY); Sodium adduct
R.TAAQNIIP(+13.98)SSTGAAK.A Y 19.21 1442.7365 15 -63.5 722.3297 2 68.20 1 32617 AEV 2_3_RA2_01_1224.d 5.56E5 2 2 201 215 Proline oxidation to pyroglutamic acid
K.TVDGPS(+79.97)HK.D Y 19.20 919.3801 8 -13.0 920.3754 1 97.76 1 54846 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 187 194 Phosphorylation (STY)
K.VDAGK(+31.99) Y 19.07 520.2493 5 59.1 521.2873 1 56.01 3 29537 AEV_3_3_RA3_01_1233.d 0 1 1 334 338 Dihydroxy
R.GGRTAAQNIIPSSTGAAK(+14.02).A Y 18.76 1712.9169 18 11.8 571.9863 3 56.37 3 29775 AEV_3_3_RA3_01_1233.d 4.84E4 1 1 198 215 Methylation(KR)
K.A(+42.01)ASEGELK(+27.99).G Y 18.60 873.4080 8 -72.3 874.3521 1 87.69 1 47869 AEV 2_3_RA2_01_1224.d 0 1 1 264 271 Acetylation (N-term); Formylation
K.AASEGELK(+14.02)GILGYSEDALVSTDLN(+.98)GDPR.S Y 18.55 2891.4036 28 1.1 964.8096 3 85.23 2 44469 AEV_1_3_RA2_01_1232.d 5.13E4 1 1 264 291 Methylation(KR); Deamidation (NQ)
K.VGIN(-17.03)GFGR.I Y 18.55 801.4133 8 -3.8 401.7124 2 67.13 3 37956 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 5 12 Ammonia-loss (N)
K.AASEGE(+14.02)LK.G Y 18.54 817.4181 8 -89.3 409.6798 2 32.51 1 10361 AEV 2_3_RA2_01_1224.d 8.85E4 1 1 264 271 Methylation(others)
K.VIISAPSADAP(+31.99)MFVMGVNEK(+14.02).S Y 18.51 2121.0486 20 6.8 425.2199 5 62.65 3 34466 AEV_3_3_RA3_01_1233.d 0 1 1 119 138 Dihydroxy; Methylation(KR)
K.Y(+41.03)DSTHGQFK.G Y 18.32 1122.5094 9 -46.4 375.1597 3 33.01 1 10631 AEV 2_3_RA2_01_1224.d 0 1 1 48 56 Amidination of lysines or N-terminal amines with methyl acetimidate
R.D(+42.01)PT(-18.01)NIPWGK.H Y 18.01 1050.5134 9 6.3 526.2673 2 72.41 3 42113 AEV_3_3_RA3_01_1233.d 0 1 1 81 89 Acetylation (N-term); Dehydration
K.K(+14.02)VIISAPS(-18.01)ADAPMFVMGVNEK.S Y 17.94 2199.1431 21 -7.6 734.0494 3 79.45 3 47641 AEV_3_3_RA3_01_1233.d 2.25E4 1 1 118 138 Methylation(KR); Dehydration
R.TAAQN(+.98)IIPSSTGAAK(-.98).A Y 17.93 1428.7572 15 4.8 358.1983 4 31.70 3 14390 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 201 215 Deamidation (NQ); Amidation
K.SYRPDISVLSNASC(+57.02)TT(+13.03)NC(+57.02)LAPLAK.V Y 17.77 2650.3206 24 16.4 884.4619 3 81.26 2 41555 AEV_1_3_RA2_01_1232.d 5.24E3 1 1 139 162 Carbamidomethylation; Michael addition with methylamine
K.LISWYDNEWGYSR(+14.02).R Y 17.71 1701.7787 13 7.2 851.9028 2 81.45 3 49176 AEV_3_3_RA3_01_1233.d 9.69E4 1 1 310 322 Methylation(KR)
K.VGINGFGR(+14.02).I Y 17.59 832.4555 8 -1.9 417.2343 2 59.48 3 32077 AEV_3_3_RA3_01_1233.d 1.77E5 1 1 5 12 Methylation(KR)
K.V(+27.99)DAGK Y 17.55 516.2543 5 -0.3 517.2615 1 42.13 3 20743 AEV_3_3_RA3_01_1233.d 0 1 1 334 338 Formylation
K.VIISAPSADAPMFVM(+15.99)GVNEK(+42.01).S Y 17.53 2133.0486 20 -78.4 711.9677 3 81.54 1 43037 AEV 2_3_RA2_01_1224.d 1.62E5 1 1 119 138 Oxidation (M); Acetylation (K)
K.VIPALN(+.98)GK(+14.02).L Y 17.51 825.4960 8 -86.5 413.7195 2 67.51 1 32033 AEV 2_3_RA2_01_1224.d 1.67E5 2 2 220 227 Deamidation (NQ); Methylation(KR)
K.LTGMAMR(+14.02)VPT(-18.01)ANVSVVDLTC(+57.02)R.T Y 17.47 2286.1646 21 -1.4 763.0611 3 85.65 3 52137 AEV_3_3_RA3_01_1233.d 0 1 1 228 248 Methylation(KR); Dehydration; Carbamidomethylation
K.HGVDYVVESTGVFTTTEKAK(-.98).A Y 17.27 2166.0957 20 -18.6 723.0258 3 69.89 3 40147 AEV_3_3_RA3_01_1233.d 8.03E4 1 1 90 109 Amidation
K.KVIISAPSADAPMFVMGVNEK(+114.04).S Y 17.12 2317.1809 21 3.6 580.3046 4 65.23 2 29411 AEV_1_3_RA2_01_1232.d 1.35E5 1 1 118 138 Ubiquitin
K.LTGMAMRVPTANVSVVDLTC(+57.02)R.T Y 16.96 2290.1597 21 -27.6 764.3727 3 74.89 2 36534 AEV_1_3_RA2_01_1232.d 6.47E4 1 1 228 248 Carbamidomethylation
K.DWRGGRT(-15.99)AAQNIIPSSTGAAK.A Y 16.85 2140.1138 21 25.9 536.0496 4 50.23 2 20556 AEV_1_3_RA2_01_1232.d 0 1 1 195 215 Deoxy
K.AHLSGGAK(+42.01)K(+42.01).V Y 16.75 951.5137 9 22.6 318.1857 3 31.60 2 11459 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 110 118 Acetylation (K)
K.HGVDYVVE(+6.01)STGVFTTTEK.A Y 16.41 1973.9558 18 26.7 659.0101 3 74.46 2 36219 AEV_1_3_RA2_01_1232.d 0 1 1 90 107 Replacement of proton by lithium
K.TIHFYQERD(+21.98)PTNIPWGK.H Y 16.34 2123.0200 17 37.7 531.7823 4 75.61 2 37081 AEV_1_3_RA2_01_1232.d 0 1 1 73 89 Sodium adduct
K.T(+42.01)VDGPS(+79.97)HK.D Y 16.25 961.3906 8 11.6 481.7082 2 26.33 1 7142 AEV 2_3_RA2_01_1224.d 1.64E5 1 1 187 194 Acetylation (N-term); Phosphorylation (STY)
R.S(+56.06)SIFDASAGIALNDRFVK.L Y 15.84 1966.0522 18 7.3 656.3628 3 81.04 2 41383 AEV_1_3_RA2_01_1232.d 1.29E4 1 1 292 309 Diethylation
K.LTGM(+15.99)AMRVPTANVSVVDLTC(+57.02)R.T Y 15.56 2306.1545 21 -61.4 769.6783 3 73.81 2 35757 AEV_1_3_RA2_01_1232.d 4.4E4 1 1 228 248 Oxidation (M); Carbamidomethylation
K.VGINGFGR(+28.03).I Y 15.30 846.4711 8 -37.5 424.2270 2 61.32 3 33443 AEV_3_3_RA3_01_1233.d 0 1 1 5 12 Dimethylation(KR)
K.A(+42.01)AVKAAS(-18.01)EGELK.G Y 15.27 1196.6400 12 -33.0 300.1574 4 35.57 3 16672 AEV_3_3_RA3_01_1233.d 0 1 1 260 271 Acetylation (N-term); Dehydration
K.AASE(+28.03)GELKGILGYSEDALVSTDLNGDPR.S Y 15.25 2904.4351 28 8.1 969.1602 3 86.40 2 45242 AEV_1_3_RA2_01_1232.d 1.7E5 1 1 264 291 Ethylation
R.GGRTAAQNIIPSSTGAAK(+70.04).A Y 15.23 1768.9431 18 15.5 443.2499 4 54.80 2 22901 AEV_1_3_RA2_01_1232.d 0 1 1 198 215 Crotonaldehyde
K.AVGK(+43.01)VIPALN(+.98)GK.L Y 15.17 1209.7081 12 -32.9 404.2300 3 51.08 3 26433 AEV_3_3_RA3_01_1233.d 0 1 1 216 227 Carbamylation; Deamidation (NQ)
total 191 peptides
C1G065
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.NFVVTGPPISLYGLNLR.L Y 159.66 1859.0305 17 5.5 620.6875 3 87.82 2 46097 AEV_1_3_RA2_01_1232.d 1.41E6 6 6 388 404
R.HGSAIEQPVHFENPIPLSGKTPLNLR.A Y 152.60 2850.5139 26 -1.0 571.1095 5 77.54 2 38601 AEV_1_3_RA2_01_1232.d 3.63E5 2 2 1547 1572
R.FTSVAGQPSLLQSYSELDTPYPSVEK.I Y 148.63 2842.3911 26 1.8 948.4727 3 83.74 2 43451 AEV_1_3_RA2_01_1232.d 8.63E5 4 4 970 995
K.Q(-17.03)AIAEAEGVDDDRWEDTYKGPAGGVITVR.S Y 142.35 3100.4736 29 1.7 1034.5002 3 79.95 3 48051 AEV_3_3_RA3_01_1233.d 3.5E5 2 2 830 858 Pyro-glu from Q
R.GFATIPLKGIDVPFHSTFLR.S Y 137.76 2215.2153 20 -4.1 554.8088 4 83.87 2 43535 AEV_1_3_RA2_01_1232.d 1.44E6 6 6 1992 2011
K.TPLNLRAPASNETYAR.V Y 136.67 1772.9169 16 2.9 591.9813 3 63.66 2 28333 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 1567 1582
R.VFSSYANLPGTITHGMYTSAAVR.S Y 131.97 2442.2002 23 4.3 815.0775 3 79.62 2 40259 AEV_1_3_RA2_01_1232.d 5.06E5 2 2 1595 1617
R.HGSAIEQPVHFENPIPLSGK.T Y 129.61 2156.1013 20 6.3 540.0360 4 72.70 2 34884 AEV_1_3_RA2_01_1232.d 9.45E5 3 3 1547 1566
K.ILSAYPEAASQLISAQDVQHFLLLC(+57.02)QR.R Y 129.35 3070.5908 27 2.4 768.6568 4 89.32 2 46898 AEV_1_3_RA2_01_1232.d 3.84E5 4 4 996 1022 Carbamidomethylation
R.ADGVPIEGLTIGAGVPSIEVANEYIQTLGIK.H Y 127.00 3123.6702 31 4.4 1042.2352 3 95.26 2 49436 AEV_1_3_RA2_01_1232.d 8.16E5 7 7 682 712
R.TSLAPSILQDSIENGEGVPTPMLSIR.D Y 123.52 2724.4004 26 -0.9 1363.2063 2 88.12 2 46257 AEV_1_3_RA2_01_1232.d 1.42E5 2 2 329 354
R.TAEGGVVPLC(+57.02)FR.F Y 122.53 1304.6547 12 1.5 653.3356 2 74.24 2 36101 AEV_1_3_RA2_01_1232.d 1.18E6 5 5 1251 1262 Carbamidomethylation
K.YSNTVDEPVKDILDGIHNDHIK.G Y 121.72 2521.2449 22 3.4 631.3206 4 77.41 2 38496 AEV_1_3_RA2_01_1232.d 1.28E6 4 4 1075 1096
R.SPTGLLSATQFTQPALTLMEK.A Y 121.52 2233.1665 21 -0.8 1117.5896 2 87.22 3 53132 AEV_3_3_RA3_01_1233.d 3.55E5 3 3 1795 1815
R.GGGHHSFEDFHQPILLMYSR.I Y 121.48 2327.0906 20 4.0 582.7822 4 76.60 2 37863 AEV_1_3_RA2_01_1232.d 3.09E5 3 3 748 767
R.TTGDREISLTLFEGR.T Y 120.38 1693.8635 15 1.8 565.6295 3 76.30 2 37635 AEV_1_3_RA2_01_1232.d 1.04E6 7 7 1236 1250
R.DNFSASLPAPTDELAQDDEPSSVEELVAR.Y Y 119.32 3101.4312 29 1.7 1551.7255 2 86.00 3 52373 AEV_3_3_RA3_01_1233.d 2.9E5 4 4 50 78
R.DGKPIMEVTSQFLYR.G Y 119.23 1782.8975 15 1.4 595.3073 3 80.71 2 41120 AEV_1_3_RA2_01_1232.d 5.02E5 4 4 1423 1437
R.NSAGDTVDLEDMTYTEVVHR.M Y 115.45 2251.0063 20 3.8 751.3456 3 77.00 3 45700 AEV_3_3_RA3_01_1233.d 2.14E5 3 3 918 937
R.IFKDVNENSTSYTYR.S Y 114.92 1835.8689 15 -0.1 612.9635 3 60.72 3 32994 AEV_3_3_RA3_01_1233.d 1.56E6 6 6 1780 1794
K.SLRIPVYDTNTGEDLR.A Y 114.54 1847.9377 16 -5.8 616.9830 3 71.99 3 41792 AEV_3_3_RA3_01_1233.d 4.26E5 3 3 464 479
R.ILAPTPGMFVEIQYPNDAK.R Y 113.88 2103.0710 19 4.9 702.0344 3 84.43 2 43918 AEV_1_3_RA2_01_1232.d 2.51E5 2 2 1195 1213
K.TSVGQTFVDTK.M Y 107.94 1181.5928 11 3.1 591.8055 2 56.46 2 23838 AEV_1_3_RA2_01_1232.d 1.23E6 7 7 583 593
R.GNDVHAIAGC(+57.02)LPGISAK.K Y 105.88 1678.8461 17 -8.1 560.6181 3 69.57 3 39970 AEV_3_3_RA3_01_1233.d 5.87E5 3 3 116 132 Carbamidomethylation
K.HIGFKPGSMDAIQQVINIAK.A Y 104.45 2166.1619 20 4.4 542.5501 4 81.43 2 41687 AEV_1_3_RA2_01_1232.d 3.25E5 4 4 713 732
R.ILAPTPGMFVEIQYPNDAKR.T Y 103.98 2259.1721 20 1.9 565.8014 4 80.85 3 48724 AEV_3_3_RA3_01_1233.d 6.38E5 4 4 1195 1214
K.LRADGVPIEGLTIGAGVPSIEVANEYIQTLGIK.H Y 103.24 3392.8555 33 1.6 1131.9609 3 92.47 3 56031 AEV_3_3_RA3_01_1233.d 2.94E5 2 2 680 712
R.SNYSMC(+57.02)AVNPSR.I Y 100.06 1384.5864 12 1.5 693.3015 2 53.73 3 28190 AEV_3_3_RA3_01_1233.d 3.99E5 4 4 1879 1890 Carbamidomethylation
R.ALDTLTNVLNVLK.A Y 99.99 1412.8239 13 4.0 707.4221 2 87.42 2 45867 AEV_1_3_RA2_01_1232.d 6.07E5 3 3 1935 1947
R.MITRDPVNWEHATVFPNATHLLDFGPGGISGLGVLTNR.N Y 99.64 4102.0845 38 -1.1 821.4233 5 87.53 3 53321 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 492 529
R.VSGDYNPIHVSR.V Y 98.41 1342.6630 12 2.4 448.5627 3 57.10 2 24152 AEV_1_3_RA2_01_1232.d 2.06E6 4 4 1583 1594
R.FSGTTGHSQGIVTAALISTATTWDSFEK.A Y 97.05 2912.4192 28 1.4 971.8151 3 86.73 3 52827 AEV_3_3_RA3_01_1233.d 2.69E5 2 2 279 306
R.GSYNDFETTFQR.K Y 96.54 1463.6317 12 -0.1 732.8231 2 70.09 2 32910 AEV_1_3_RA2_01_1232.d 6.86E5 7 7 1438 1449
K.QAIAEAEGVDDDRWEDTYKGPAGGVITVR.S Y 95.36 3117.5002 29 26.2 780.4028 4 75.90 3 44840 AEV_3_3_RA3_01_1233.d 1.76E5 3 3 830 858
K.ATVTSQAIADFVHAVGNTGEAFVDRPGK.E Y 94.79 2857.4358 28 -0.4 715.3660 4 86.36 3 52608 AEV_3_3_RA3_01_1233.d 2.5E5 1 1 1314 1341
R.VIDGDLLKLVHLSNGFR.M Y 94.50 1895.0629 17 -3.6 474.7713 4 82.81 3 50176 AEV_3_3_RA3_01_1233.d 3.83E5 4 4 1366 1382
K.NNPQELTIHFGGPR.G Y 93.91 1578.7903 14 -1.3 790.4014 2 66.52 3 37474 AEV_3_3_RA3_01_1233.d 1.29E6 7 7 1740 1753
R.FLPITAPFHSQYLASAFEQITEDLDDLVIPSK.S Y 93.24 3604.8340 32 1.3 1202.6201 3 97.66 3 58279 AEV_3_3_RA3_01_1233.d 5.91E4 2 2 432 463
K.ILSAYPEAASQ(+.98)LISAQDVQHFLLLC(+57.02)QR.R Y 91.18 3071.5750 27 7.7 768.9069 4 89.46 2 46969 AEV_1_3_RA2_01_1232.d 1.93E5 1 1 996 1022 Deamidation (NQ); Carbamidomethylation
R.NFVVTGPPISLYGLNLR(+14.02).L Y 90.73 1873.0461 17 3.9 625.3584 3 88.90 2 46672 AEV_1_3_RA2_01_1232.d 2.8E4 1 1 388 404 Methylation(KR)
R.DSDSQPDTDYLVSAPVSLPLIGLVQLAHFMTTC(+57.02)K.V Y 90.07 3717.8269 34 1.4 1240.2847 3 97.75 3 58319 AEV_3_3_RA3_01_1233.d 3.4E4 1 1 233 266 Carbamidomethylation
R.ADKHFIENYGLSIINIVK.N Y 87.77 2073.1257 18 -6.4 519.2854 4 82.36 3 49858 AEV_3_3_RA3_01_1233.d 4.7E5 3 3 1722 1739
R.HISISLVNSAR.N Y 87.64 1195.6672 11 -3.8 399.5615 3 62.16 3 34089 AEV_3_3_RA3_01_1233.d 2.75E5 3 3 377 387
K.YIPNVSAKPFALTK.E Y 86.07 1547.8711 14 4.6 516.9667 3 71.96 2 34316 AEV_1_3_RA2_01_1232.d 3.31E5 3 3 2039 2052
R.IPVYDTNTGEDLR.A Y 85.85 1491.7205 13 2.8 746.8696 2 66.34 2 30223 AEV_1_3_RA2_01_1232.d 8.04E5 3 3 467 479
R.SEM(+15.99)GEPIHK.L Y 85.45 1042.4753 9 6.4 522.2483 2 13.64 3 4378 AEV_3_3_RA3_01_1233.d 1.56E5 3 3 859 867 Oxidation (M)
R.FTYHPETGYAPIR.E Y 85.37 1550.7517 13 -8.2 517.9203 3 65.34 3 36545 AEV_3_3_RA3_01_1233.d 5.28E5 4 4 1263 1275
R.APASNETYAR.V Y 85.16 1078.5043 10 2.5 540.2607 2 19.73 3 7688 AEV_3_3_RA3_01_1233.d 1.09E6 6 6 1573 1582
R.GITVNLIYVNPR.A Y 84.73 1357.7717 12 -1.0 679.8925 2 78.62 3 47023 AEV_3_3_RA3_01_1233.d 6.29E5 6 6 657 668
R.NSAGDTVDLEDM(+15.99)TYTEVVHR.M Y 84.19 2267.0012 20 -9.3 756.6674 3 71.65 3 41528 AEV_3_3_RA3_01_1233.d 5.97E4 1 1 918 937 Oxidation (M)
K.EYFEDVYR.L Y 84.15 1119.4873 8 3.6 560.7529 2 68.56 2 31775 AEV_1_3_RA2_01_1232.d 6.05E5 3 3 2053 2060
K.APTGLDQNRIPYTQR.K Y 83.62 1728.8907 15 0.9 577.3047 3 61.03 3 33245 AEV_3_3_RA3_01_1233.d 5.09E5 1 1 410 424
K.EWFRLDEPDVDLLGQTLTFR.L Y 83.26 2449.2278 20 2.2 817.4183 3 90.49 2 47462 AEV_1_3_RA2_01_1232.d 4.82E4 1 1 1472 1491
R.SNYSM(+15.99)C(+57.02)AVNPSR.I Y 83.13 1400.5813 12 23.6 701.3145 2 36.43 3 17210 AEV_3_3_RA3_01_1233.d 0 1 1 1879 1890 Oxidation (M); Carbamidomethylation
R.FTSVAGQPSLLQSYSELDTPYPSVEK(+14.02).I Y 82.68 2856.4067 26 1.9 1429.2134 2 84.75 3 51531 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 970 995 Methylation(KR)
R.IGSVLANWAKYEEAGVGEKV Y 82.48 2119.0950 20 -1.3 707.3713 3 80.82 3 48703 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 2067 2086
K.SLRIPVYDT(-2.02)NTGEDLRAKDEDIVPALIR.M Y 81.62 3166.6621 28 2.4 634.3412 5 79.92 3 48005 AEV_3_3_RA3_01_1233.d 0 1 1 464 491 2-amino-3-oxo-butanoic_acid
R.SPTGLLSATQFTQPALTLMEK(+14.02).A Y 81.12 2247.1821 21 -1.8 1124.5963 2 88.51 3 53902 AEV_3_3_RA3_01_1233.d 6.88E4 3 3 1795 1815 Methylation(KR)
K.DSLWQSEDLEAVVGQDVGR.V Y 80.43 2101.9917 19 2.8 1052.0061 2 85.33 3 51922 AEV_3_3_RA3_01_1233.d 4.65E4 1 1 1045 1063
R.AKDEDIVPALIR.M Y 78.68 1338.7506 12 -8.0 447.2539 3 70.73 2 33400 AEV_1_3_RA2_01_1232.d 2.4E5 4 4 480 491
R.QFGYPPMPFDGC(+57.02)LFGSR.M Y 78.18 1974.8756 17 6.5 988.4515 2 87.43 2 45871 AEV_1_3_RA2_01_1232.d 1.7E5 2 2 799 815 Carbamidomethylation
R.AMAWQIPLIGK.L Y 77.71 1226.6846 11 -5.7 614.3461 2 83.79 3 50871 AEV_3_3_RA3_01_1233.d 9.65E4 2 2 669 679
R.LSPSTSASLPDLDRWLR.L Y 76.19 1913.0006 17 1.2 638.6749 3 81.71 2 41897 AEV_1_3_RA2_01_1232.d 2.52E5 2 2 1146 1162
K.ANPTFPVIMQWTGGR.G Y 76.14 1673.8347 15 0.3 837.9249 2 83.99 3 51012 AEV_3_3_RA3_01_1233.d 5.13E5 4 4 733 747
R.TFISVREPSQSGR.L Y 75.73 1462.7528 13 -1.4 488.5909 3 56.89 3 30138 AEV_3_3_RA3_01_1233.d 9.56E5 5 5 1215 1227
K.YEEAGVGEKV Y 75.73 1079.5134 10 1.3 540.7647 2 43.95 3 21889 AEV_3_3_RA3_01_1233.d 3.43E5 4 4 2077 2086
R.LSPSTSASLPDLDR.W Y 74.65 1457.7361 14 0.3 729.8755 2 69.91 2 32785 AEV_1_3_RA2_01_1232.d 7.56E4 1 1 1146 1159
M(+42.01)(+15.99)YGTSTGPQTGINTPR.S Y 74.58 1737.7992 16 0.0 869.9069 2 66.15 3 37191 AEV_3_3_RA3_01_1233.d 5.82E4 1 1 1 16 Acetylation (Protein N-term); Oxidation (M)
K.LLVVQAYYAGR.A Y 73.67 1251.6975 11 -23.1 626.8416 2 74.05 3 43390 AEV_3_3_RA3_01_1233.d 0 1 1 134 144
R.DSDSQPDTDYLVSAPVSLPLIGLVQLAHFM(+15.99)TTC(+57.02)K.V Y 73.02 3733.8218 34 5.4 1245.6212 3 96.73 3 57928 AEV_3_3_RA3_01_1233.d 5.81E4 2 2 233 266 Oxidation (M); Carbamidomethylation
R.SLVETWAAENNIGR.V Y 72.18 1558.7739 14 -4.6 780.3907 2 76.68 3 45502 AEV_3_3_RA3_01_1233.d 2.66E5 3 3 1618 1631
R.IPVYDTNTGEDLRAKDEDIVPALIR.M Y 71.95 2812.4607 25 -21.0 704.1077 4 79.29 2 39989 AEV_1_3_RA2_01_1232.d 2.06E5 2 2 467 491
R.AM(+15.99)AWQIPLIGK.L Y 70.63 1242.6794 11 5.3 622.3503 2 81.24 2 41541 AEV_1_3_RA2_01_1232.d 1.27E5 1 1 669 679 Oxidation (M)
R.Q(-17.03)FGYPPMPFDGC(+57.02)LFGSR.M Y 69.83 1957.8491 17 2.7 979.9345 2 94.75 2 49247 AEV_1_3_RA2_01_1232.d 4.24E5 3 3 799 815 Pyro-glu from Q; Carbamidomethylation
R.DVPFDTPATATFDGGK.A Y 69.37 1637.7573 16 -2.3 819.8841 2 77.48 3 46107 AEV_3_3_RA3_01_1233.d 1.44E5 2 2 1298 1313
K.KLLVVQAYYAGR.A Y 68.99 1379.7925 12 4.4 460.9401 3 69.64 2 32578 AEV_1_3_RA2_01_1232.d 8.95E4 2 2 133 144
K.GPAGGVITVR.S Y 68.44 925.5345 10 -7.3 463.7711 2 49.47 3 25403 AEV_3_3_RA3_01_1233.d 1.37E5 2 2 849 858
R.MIPGAEPLKVGDVLETTAQVNAVINQDSGK.M Y 68.43 3093.6016 30 1.6 1032.2095 3 85.27 3 51881 AEV_3_3_RA3_01_1233.d 1.37E5 2 2 1383 1412
K.GIDVPFHSTFLR.S Y 67.45 1387.7249 12 6.0 463.5850 3 77.78 2 38790 AEV_1_3_RA2_01_1232.d 5.64E5 4 4 2000 2011
M(+42.01)YGTSTGPQTGINTPR.S Y 66.54 1721.8043 16 0.8 861.9101 2 72.61 2 34817 AEV_1_3_RA2_01_1232.d 2E5 2 2 1 16 Acetylation (Protein N-term)
R.TTGDREISLTLFEGR(+14.02).T Y 66.40 1707.8792 15 5.9 570.3037 3 77.94 3 46456 AEV_3_3_RA3_01_1233.d 1.98E5 1 1 1236 1250 Methylation(KR)
R.FLPITAPFHSQYLASAFEQITED(+14.02)LDDLVIPSK.S Y 62.72 3618.8496 32 2.3 1207.2932 3 97.66 3 58285 AEV_3_3_RA3_01_1233.d 3.56E4 1 1 432 463 Methylation(others)
R.HGSAIEQPVHFENPIPLS(-18.01)GK(+14.02)TPLNLR.A Y 62.61 2846.5190 26 -17.2 570.3013 5 76.98 3 45682 AEV_3_3_RA3_01_1233.d 0 1 1 1547 1572 Dehydration; Methylation(KR)
R.DPVNWEHATVFPNATHLLDFGPGGISGLGVLTNR.N Y 61.37 3600.8113 34 1.1 721.1703 5 90.10 3 54772 AEV_3_3_RA3_01_1233.d 8.47E4 1 1 496 529
R.VFSSYANLPGTITHGM(+15.99)YTSAAVR.S Y 61.31 2458.1951 23 -1.8 820.4042 3 76.08 3 44981 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 1595 1617 Oxidation (M)
K.Y(-2.02)IPNVSAKPFALTK.E Y 61.21 1545.8555 14 -26.2 516.2789 3 71.29 3 41238 AEV_3_3_RA3_01_1233.d 3.35E5 1 1 2039 2052 2-amino-3-oxo-butanoic_acid
R.VC(+57.02)ILQGPMAVK.Y Y 60.83 1214.6515 11 -0.7 608.3326 2 72.72 2 34905 AEV_1_3_RA2_01_1232.d 3.39E5 4 4 1064 1074 Carbamidomethylation
R.HGSAIEQPVHFEN(+.98)PIPLSGK.T Y 60.41 2157.0854 20 11.2 540.2847 4 72.89 2 35035 AEV_1_3_RA2_01_1232.d 3.27E5 1 1 1547 1566 Deamidation (NQ)
K.SLRIPVYDTNTGEDLRAK(-1.03)DEDIVPALIR.M Y 60.30 3167.6462 28 27.1 634.5537 5 80.33 2 40826 AEV_1_3_RA2_01_1232.d 0 1 1 464 491 Lysine oxidation to aminoadipic semialdehyde
R.VIDGDLLKLVHLSN(+.98)GFR.M Y 59.99 1896.0469 17 -1.6 475.0182 4 84.08 3 51077 AEV_3_3_RA3_01_1233.d 2.34E5 2 2 1366 1382 Deamidation (NQ)
R.AAANRPTKPHESALLR.A Y 57.54 1730.9540 16 1.9 433.7466 4 36.08 2 13571 AEV_1_3_RA2_01_1232.d 7.16E5 4 4 145 160
K.SM(+15.99)TEALNKIEK.N Y 57.40 1278.6489 11 2.5 640.3333 2 36.49 3 17249 AEV_3_3_RA3_01_1233.d 7.6E4 3 3 640 650 Oxidation (M)
K.ILSAYPEAASQLISAQDVQHFLLLC(+57.02)QR(+14.02).R Y 55.67 3084.6067 27 1.3 772.1599 4 89.03 3 54167 AEV_3_3_RA3_01_1233.d 7.66E4 1 1 996 1022 Carbamidomethylation; Methylation(KR)
K.TSVGQ(+.98)TFVDTK.M Y 55.36 1182.5768 11 14.1 592.3040 2 54.96 3 28956 AEV_3_3_RA3_01_1233.d 3.2E5 1 1 583 593 Deamidation (NQ)
R.IPVYDTNTGED(+14.02)LR.A Y 53.55 1505.7362 13 -3.9 753.8724 2 69.53 3 39872 AEV_3_3_RA3_01_1233.d 5.32E4 1 1 467 479 Methylation(others)
K.SLRIPVY(-2.02)DTNTGEDLR.A Y 53.20 1845.9220 16 8.8 616.3200 3 71.96 3 41767 AEV_3_3_RA3_01_1233.d 0 1 1 464 479 2-amino-3-oxo-butanoic_acid
R.LTGDFIR.R Y 52.97 820.4443 7 -1.8 411.2287 2 59.10 3 31775 AEV_3_3_RA3_01_1233.d 1.02E6 5 5 958 964
K.LVHLSNGFR.M Y 51.95 1041.5719 9 -91.2 348.1662 3 69.66 1 33755 AEV 2_3_RA2_01_1224.d 3.69E5 2 2 1374 1382
R.IWFSDRDVPFDTPATATFDGGK(+14.02).A Y 51.85 2456.1648 22 -7.0 819.7231 3 83.25 2 43058 AEV_1_3_RA2_01_1232.d 7.54E4 1 1 1292 1313 Methylation(KR)
R.GLTMQVAVERDEQGR.S Y 51.38 1687.8312 15 2.4 563.6190 3 62.20 2 27331 AEV_1_3_RA2_01_1232.d 1.44E5 1 1 1864 1878
K.VKAPTGLDQNRIPYTQRK.V Y 51.36 2084.1489 18 7.1 417.8400 5 56.47 3 29844 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 408 425
R.WIDDSLKR.L Y 49.82 1031.5399 8 0.6 344.8541 3 53.69 3 28164 AEV_3_3_RA3_01_1233.d 5.49E5 3 3 950 957
R.ADGVPIEGLT(+14.02)IGAGVPSIEVANEYIQTLGIK.H Y 49.43 3137.6858 31 4.2 1046.9070 3 96.16 3 57712 AEV_3_3_RA3_01_1233.d 2.4E5 1 1 682 712 Methylation(others)
K.EVWDRADKHFIENYGLSIINIVK.N Y 48.93 2758.4441 23 -6.7 552.6924 5 84.70 3 51499 AEV_3_3_RA3_01_1233.d 8.67E4 1 1 1717 1739
K.ASFEDMR.S Y 48.39 854.3593 7 9.3 428.1909 2 43.71 3 21723 AEV_3_3_RA3_01_1233.d 1.53E5 2 2 1816 1822
R.ALDTLTNVLNVLKAQK.I Y 48.30 1740.0145 16 4.9 581.0150 3 84.43 3 51322 AEV_3_3_RA3_01_1233.d 1.5E4 1 1 1935 1950
R.ADGVPIEGLTIGAGVPSIE(+14.02)VANEYIQTLGIK.H Y 48.22 3137.6858 31 7.0 1046.9099 3 95.56 3 57459 AEV_3_3_RA3_01_1233.d 2.4E5 1 1 682 712 Methylation(others)
R.DGKPIMEVTSQFLYR(+14.02).G Y 48.21 1796.9131 15 38.5 600.0013 3 82.04 2 42162 AEV_1_3_RA2_01_1232.d 0 1 1 1423 1437 Methylation(KR)
R.VC(+57.02)ILQGPM(+15.99)AVK.Y Y 47.40 1230.6465 11 3.2 616.3325 2 65.71 2 29743 AEV_1_3_RA2_01_1232.d 3.88E4 1 1 1064 1074 Carbamidomethylation; Oxidation (M)
R.KEEVPMQLHLGSSK.D Y 47.02 1581.8185 14 -2.3 396.4610 4 59.46 3 32011 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 1450 1463
R.GFATIPLK.G Y 46.23 845.5010 8 -3.7 423.7562 2 68.10 3 38727 AEV_3_3_RA3_01_1233.d 3.94E5 3 3 1992 1999
K.LLLNEFER.A Y 45.48 1032.5603 8 -2.3 517.2863 2 74.11 3 43434 AEV_3_3_RA3_01_1233.d 5.17E5 3 3 104 111
R.SQQAYPR.T Y 45.02 848.4141 7 -86.9 425.1774 2 24.66 1 6409 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 322 328
K.KLNADFQKVWFGR.N Y 44.47 1607.8572 13 17.3 402.9785 4 72.90 3 42501 AEV_3_3_RA3_01_1233.d 0 1 1 905 917
K.AITKPIFPR.V Y 44.08 1041.6334 9 2.1 348.2191 3 60.03 2 25917 AEV_1_3_RA2_01_1232.d 1.28E6 5 5 1357 1365
R.LVKTSVGQTFVDTK.M Y 43.84 1521.8402 14 -1.8 508.2864 3 59.89 3 32344 AEV_3_3_RA3_01_1233.d 4.25E4 1 1 580 593
R.IWFSDR(+.98)DVPFDTPATATFDGGK.A Y 43.53 2443.1331 22 30.8 815.4100 3 82.87 3 50215 AEV_3_3_RA3_01_1233.d 0 1 1 1292 1313 Deamidation (R)
R.SEM(-48.00)GEPIHK.L Y 43.13 978.4771 9 5.0 490.2482 2 9.84 3 2485 AEV_3_3_RA3_01_1233.d 4.66E4 2 2 859 867 Dethiomethyl
K.DVNENSTSYTYR.S Y 41.71 1447.6216 12 -48.7 724.7828 2 55.30 1 23359 AEV 2_3_RA2_01_1224.d 0 2 2 1783 1794
K.QPGEVLER.F Y 41.45 926.4821 8 -0.3 464.2482 2 35.65 3 16727 AEV_3_3_RA3_01_1233.d 4.68E5 3 3 271 278
R.DGKPIM(+15.99)EVTSQFLYR.G Y 41.31 1798.8923 15 -17.0 600.6279 3 76.49 3 45293 AEV_3_3_RA3_01_1233.d 6.57E4 2 2 1423 1437 Oxidation (M)
K.TSVGQTFVDTK(+14.02).M Y 41.06 1195.6084 11 14.1 598.8199 2 61.70 3 33739 AEV_3_3_RA3_01_1233.d 8.96E4 2 2 583 593 Methylation(KR)
R.APASNETYAR(+14.02).V Y 40.86 1092.5199 10 22.7 547.2796 2 27.37 3 11881 AEV_3_3_RA3_01_1233.d 2.49E5 6 6 1573 1582 Methylation(KR)
R.DLPRPAVQEHIDATNQHLPKDR.H Y 40.07 2549.3098 22 4.5 510.8715 5 60.94 3 33141 AEV_3_3_RA3_01_1233.d 0 1 1 355 376
K.NALTM(+15.99)LFWIGM(+15.99)R.S Y 39.57 1483.7316 12 -15.6 742.8615 2 87.42 2 45897 AEV_1_3_RA2_01_1232.d 4.28E4 1 1 310 321 Oxidation (M)
K.LVHLSN(+.98)GFR(+14.02).M Y 39.54 1056.5717 9 7.7 353.2005 3 64.80 3 36120 AEV_3_3_RA3_01_1233.d 0 1 1 1374 1382 Deamidation (NQ); Methylation(KR)
R.SGVKPFR.S Y 39.47 789.4497 7 2.3 395.7330 2 22.12 2 7311 AEV_1_3_RA2_01_1232.d 2.17E5 3 3 2012 2018
R.ILAPTPGMFVEIQ(+.98)YPNDAKR.T Y 39.21 2260.1560 20 -3.8 754.3898 3 81.56 3 49258 AEV_3_3_RA3_01_1233.d 7.76E4 1 1 1195 1214 Deamidation (NQ)
R.HGSAIEQPVHFENPIPLS(-18.01)GK(+14.02).T Y 38.75 2152.1064 20 -19.3 539.0235 4 72.14 3 41908 AEV_3_3_RA3_01_1233.d 0 1 1 1547 1566 Dehydration; Methylation(KR)
R.SLVETWAAENNIGR(+14.02).V Y 38.21 1572.7896 14 -17.9 787.3879 2 77.55 3 46168 AEV_3_3_RA3_01_1233.d 5.64E4 1 1 1618 1631 Methylation(KR)
R.FTSVAGQPSLLQ(+.98)SYSELDTPYPSVEK(+14.02).I Y 37.43 2857.3909 26 6.3 953.4769 3 84.90 2 44250 AEV_1_3_RA2_01_1232.d 6.5E4 1 1 970 995 Deamidation (NQ); Methylation(KR)
K.VGDVLETTAQVNAVINQDSGK.M Y 37.31 2157.0913 21 -3.3 720.0353 3 79.31 3 47532 AEV_3_3_RA3_01_1233.d 2.11E4 1 1 1392 1412
R.TFISVR.E Y 36.80 721.4122 6 1.5 361.7139 2 56.47 2 23802 AEV_1_3_RA2_01_1232.d 6.73E5 5 5 1215 1220
R.LDEPDVDLLGQTLTFR.L Y 36.42 1830.9363 16 2.0 916.4772 2 86.82 3 52883 AEV_3_3_RA3_01_1233.d 5.11E5 3 3 1476 1491
K.LNADFQKVWFGR.N Y 36.35 1479.7622 12 -0.1 494.2613 3 77.43 3 46053 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 906 917
R.TFISVREPSQSGR(+14.02).L Y 35.73 1476.7684 13 -7.2 493.2599 3 62.83 3 34601 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 1215 1227 Methylation(KR)
K.HIGFK(-1.03)PGSMDAIQQVINIAK.A Y 34.66 2165.1304 20 0.3 542.2900 4 80.77 3 48666 AEV_3_3_RA3_01_1233.d 0 1 1 713 732 Lysine oxidation to aminoadipic semialdehyde
R.LQSLVR.F Y 34.41 714.4388 6 -0.7 358.2264 2 39.16 2 15060 AEV_1_3_RA2_01_1232.d 1.31E6 3 3 1492 1497
R.TAE(+14.02)GGVVPLC(+57.02)FR.F Y 34.21 1318.6703 12 -0.2 660.3423 2 76.98 2 38162 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 1251 1262 Methylation(others); Carbamidomethylation
K.VE(+14.02)ASNQATEEK.V Y 34.14 1218.5728 11 -7.2 610.2892 2 17.02 3 6211 AEV_3_3_RA3_01_1233.d 1.52E4 1 1 1667 1677 Methylation(others)
K.HIGFK(+14.02)PGSMDAIQ(+.98)QVINIAK.A Y 33.92 2181.1616 20 -1.9 546.2966 4 77.34 3 46019 AEV_3_3_RA3_01_1233.d 3.77E5 1 1 713 732 Methylation(KR); Deamidation (NQ)
R.HGSAIEQ(+.98)PVHFENPIPLSGK.T Y 33.84 2157.0854 20 6.0 540.2819 4 73.28 3 42806 AEV_3_3_RA3_01_1233.d 0 1 1 1547 1566 Deamidation (NQ)
K.N(+42.01)(+.98)IPPGRGITVNLIYVNPR.A Y 33.59 2035.1215 18 -37.1 679.3560 3 79.15 2 39883 AEV_1_3_RA2_01_1232.d 7.51E4 1 1 651 668 Acetylation (N-term); Deamidation (NQ)
R.GGGHHSFEDFHQ(+.98)PILLM(+15.99)YSR.I Y 33.19 2344.0693 20 -2.0 469.8202 5 71.68 3 41544 AEV_3_3_RA3_01_1233.d 7.64E4 1 1 748 767 Deamidation (NQ); Oxidation (M)
K.A(+42.01)ITKPIFPR.V Y 33.02 1083.6440 9 -53.5 362.2026 3 60.11 2 25954 AEV_1_3_RA2_01_1232.d 5.72E4 1 1 1357 1365 Acetylation (N-term)
R.AMAWQIPLIGK(+14.02).L Y 32.76 1240.7002 11 -11.3 621.3503 2 84.39 2 43889 AEV_1_3_RA2_01_1232.d 2.13E4 1 1 669 679 Methylation(KR)
K.TTIDPSKLVGK.Y Y 32.59 1157.6655 11 -5.5 386.8936 3 62.90 3 34656 AEV_3_3_RA3_01_1233.d 3.71E5 2 2 2028 2038
K.M(-48.00)VEVC(+57.02)GTIKR.D Y 32.35 1143.6071 10 0.9 382.2100 3 24.93 3 10526 AEV_3_3_RA3_01_1233.d 2.12E5 1 1 1413 1422 Dethiomethyl; Carbamidomethylation
K.YIPNVSAKPFALTKEYFEDVYR.L Y 32.29 2649.3479 22 -0.1 884.1232 3 82.06 3 49640 AEV_3_3_RA3_01_1233.d 9.6E4 1 1 2039 2060
K.TPLNLR.A Y 31.37 712.4232 6 0.9 357.2192 2 44.24 2 17559 AEV_1_3_RA2_01_1232.d 1.12E6 4 4 1567 1572
R.AMAWQIPLIGKLR.A Y 31.29 1495.8696 13 -5.2 499.6279 3 83.04 3 50336 AEV_3_3_RA3_01_1233.d 2.7E4 1 1 669 681
R.SEMGEPIHKLATR.G Y 31.05 1467.7504 13 -9.1 367.9415 4 47.19 3 23925 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 859 871
K.NIPPGR.G Y 30.83 652.3656 6 -46.3 653.3427 1 76.45 3 45262 AEV_3_3_RA3_01_1233.d 8.38E3 2 2 651 656
R.VIDGDLLK.L Y 30.59 871.5015 8 3.3 436.7595 2 69.03 2 32115 AEV_1_3_RA2_01_1232.d 1.81E5 2 2 1366 1373
K.VWFGR.N Y 30.04 663.3492 5 3.3 332.6830 2 60.32 2 26088 AEV_1_3_RA2_01_1232.d 5.95E5 3 3 913 917
R.T(+117.00)AEGGVVPLC(+57.02)FR.F Y 29.30 1421.6526 12 26.9 711.8527 2 61.59 3 33666 AEV_3_3_RA3_01_1233.d 5.87E5 3 3 1251 1262 Phospho-propargylamine; Carbamidomethylation
K.YAVDWVKEHGPR.L Y 29.12 1455.7258 12 -13.5 364.9338 4 60.68 3 32935 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 568 579
R.IFKDVNENSTSYTYR(+14.02).S Y 28.81 1849.8846 15 -1.3 617.6347 3 63.25 3 34931 AEV_3_3_RA3_01_1233.d 5.7E4 1 1 1780 1794 Methylation(KR)
R.NSAGDTVDLEDMTYTEVVHR(+14.02).M Y 28.57 2265.0220 20 -3.2 756.0122 3 79.50 2 40168 AEV_1_3_RA2_01_1232.d 3.65E4 1 1 918 937 Methylation(KR)
R.KIIKVEASNQATEEK.V Y 28.25 1686.9152 15 -32.3 563.2942 3 37.56 2 14299 AEV_1_3_RA2_01_1232.d 0 1 1 1663 1677
R.HISISLVNSAR(-.98).N Y 28.07 1194.6832 11 53.9 399.2565 3 63.67 2 28335 AEV_1_3_RA2_01_1232.d 5.06E5 1 1 377 387 Amidation
K.M(+15.99)VEVC(+57.02)GTIKR.D Y 27.98 1207.6053 10 -8.6 604.8047 2 35.70 3 16756 AEV_3_3_RA3_01_1233.d 1.06E4 1 1 1413 1422 Oxidation (M); Carbamidomethylation
R.IPVY(-18.01)DTNTGEDLRAK(+14.02)DEDIVPALIR.M Y 27.77 2808.4656 25 -13.8 703.1140 4 79.08 3 47352 AEV_3_3_RA3_01_1233.d 0 1 1 467 491 Dehydration; Methylation(KR)
R.VFSSY(-2.02)ANLPGTITHGMYTSAAVR.S Y 27.41 2440.1846 23 -42.4 814.3677 3 79.73 2 40344 AEV_1_3_RA2_01_1232.d 0 1 1 1595 1617 2-amino-3-oxo-butanoic_acid
K.DVAVLQSK(+27.99).E Y 26.92 886.4760 8 -29.7 887.4569 1 92.25 2 48275 AEV_1_3_RA2_01_1232.d 1.45E5 4 4 1464 1471 Formylation
R.GFATIPLKGIDVPFHSTFLR(+14.02).S Y 26.11 2229.2310 20 -2.1 558.3138 4 84.49 2 43969 AEV_1_3_RA2_01_1232.d 6.25E4 1 1 1992 2011 Methylation(KR)
K.LVHLSNGFR(+6.01).M Y 26.06 1047.5801 9 -20.0 350.1936 3 9.21 2 2220 AEV_1_3_RA2_01_1232.d 7.36E3 1 1 1374 1382 Replacement of proton by lithium
R.DYIIKK.L Y 26.02 778.4589 6 -125.0 390.1880 2 44.74 1 17141 AEV 2_3_RA2_01_1224.d 0 1 1 900 905
K.IFSLDK.A Y 25.95 721.4010 6 4.8 722.4117 1 53.84 3 28258 AEV_3_3_RA3_01_1233.d 4E5 4 4 883 888
R.AAADGNAR.L Y 25.90 744.3514 8 43.1 745.3908 1 112.26 2 54375 AEV_1_3_RA2_01_1232.d 1.75E4 3 3 161 168
K.EYFEDVYRLTNSPR.I Y 25.88 1787.8478 14 3.9 596.9589 3 77.08 2 38244 AEV_1_3_RA2_01_1232.d 2.39E4 1 1 2053 2066
R.SEMGEPIHK.L Y 25.87 1026.4805 9 1.2 514.2481 2 24.65 3 10374 AEV_3_3_RA3_01_1233.d 4.43E5 2 2 859 867
R.SPTGLLSATQFTQPALTLMEKASFEDMRSK(+88.00).G Y 25.84 3372.6404 30 23.3 1125.2469 3 83.34 3 50556 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 1795 1824 3-sulfanylpropanoyl
K.T(+42.01)TIDPSK.L Y 25.38 802.4072 7 -48.4 402.1915 2 34.79 1 11589 AEV 2_3_RA2_01_1224.d 0 1 1 2028 2034 Acetylation (N-term)
R.S(+162.05)QQAYPR.T Y 25.37 1010.4669 7 -8.9 506.2362 2 52.16 1 21457 AEV 2_3_RA2_01_1224.d 0 1 1 322 328 Hexose (NSY)
K.IFS(+79.96)LDKAK.R Y 25.21 1000.4899 8 -6.9 334.5016 3 49.67 2 20279 AEV_1_3_RA2_01_1232.d 0 1 1 883 890 Sulfation
M.YGTSTGPQTGINTPR.S Y 25.21 1548.7532 15 8.2 775.3902 2 53.77 3 28214 AEV_3_3_RA3_01_1233.d 0 1 1 2 16
K.VM(+15.99)GKQPGEVLER.F Y 24.54 1357.7024 12 15.7 679.8691 2 77.14 2 38307 AEV_1_3_RA2_01_1232.d 3.67E5 1 1 267 278 Oxidation (M)
K.LNADFQK.V Y 24.54 834.4235 7 6.2 418.2216 2 36.74 2 13888 AEV_1_3_RA2_01_1232.d 9.41E4 1 1 906 912
R.ILAPTPGMFVE(+14.02)IQYPNDAKR.T Y 24.35 2273.1877 20 0.7 758.7371 3 82.26 2 42322 AEV_1_3_RA2_01_1232.d 3.35E4 1 1 1195 1214 Methylation(others)
K.YAVDWVK.E Y 24.12 879.4490 7 17.1 440.7393 2 63.88 3 35408 AEV_3_3_RA3_01_1233.d 1.08E6 2 2 568 574
R.TTGDR(+14.02)EISLTLFEGR.T Y 24.03 1707.8792 15 -0.1 570.3003 3 78.26 2 39176 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 1236 1250 Methylation(KR)
K.ILSAYPEAASQLIS(-18.01)AQDVQHFLLLC(+57.02)QR(+14.02).R Y 23.99 3066.5959 27 -7.8 767.6503 4 89.34 2 46907 AEV_1_3_RA2_01_1232.d 7.62E4 1 1 996 1022 Dehydration; Carbamidomethylation; Methylation(KR)
K.HIGFKPGSMDAIQQVIN(+.98)IAK.A Y 23.70 2167.1460 20 22.6 542.8060 4 82.60 2 42580 AEV_1_3_RA2_01_1232.d 1.61E5 1 1 713 732 Deamidation (NQ)
K.IFSLDKAK.R Y 23.63 920.5331 8 -47.4 461.2520 2 52.27 2 21614 AEV_1_3_RA2_01_1232.d 0 1 1 883 890
K.ILSAYPEAASQLISAQDVQHFLLLC(+57.02)QR(-.98).R Y 23.63 3069.6069 27 -11.5 768.4002 4 89.08 3 54194 AEV_3_3_RA3_01_1233.d 2.01E5 1 1 996 1022 Carbamidomethylation; Amidation
R.SGVKPFRSFLLK.K Y 23.50 1377.8132 12 -0.7 345.4603 4 68.26 3 38865 AEV_3_3_RA3_01_1233.d 4.24E4 1 1 2012 2023
K.FQTNPMK.R Y 22.89 864.4164 7 -87.4 433.1777 2 34.75 1 11562 AEV 2_3_RA2_01_1224.d 0 2 2 1187 1193
K.VEASNQATE(+43.99)EK.V Y 22.86 1248.5470 11 -19.2 625.2688 2 52.19 1 21476 AEV 2_3_RA2_01_1224.d 6.58E4 1 1 1667 1677 Carboxylation (E)
R.IKEFYYR.I Y 22.84 1017.5283 7 14.3 509.7787 2 52.50 2 21751 AEV_1_3_RA2_01_1232.d 1.26E5 1 1 1285 1291
R.LTGD(+43.99)FIR.R Y 22.77 864.4341 7 -4.7 433.2223 2 18.06 2 5596 AEV_1_3_RA2_01_1232.d 0 2 2 958 964 Carboxylation (DKW)
R.GS(-2.02)YNDFETTFQR.K Y 22.70 1461.6161 12 48.8 731.8510 2 69.81 3 40087 AEV_3_3_RA3_01_1233.d 3.61E4 1 1 1438 1449 2-amino-3-oxo-butanoic_acid
R.GIT(-2.02)VNLIYVNPR.A Y 22.69 1355.7561 12 -44.1 678.8554 2 78.85 3 47168 AEV_3_3_RA3_01_1233.d 1.7E5 1 1 657 668 2-amino-3-oxo-butanoic_acid
R.MMTAKEAHTSK(-1.03).A Y 22.69 1232.5530 11 4.8 617.2867 2 59.93 2 25846 AEV_1_3_RA2_01_1232.d 7.48E4 1 1 816 826 Lysine oxidation to aminoadipic semialdehyde
R.MIPGAEP(+13.98)LK.V Y 22.64 968.5001 9 -17.7 969.4902 1 97.56 3 58226 AEV_3_3_RA3_01_1233.d 0 1 1 1383 1391 Proline oxidation to pyroglutamic acid
R.DNFSASLPAPTDELAQDDE(+14.02)PSSVEELVAR.Y Y 22.24 3115.4468 29 23.7 1039.5142 3 87.38 3 53226 AEV_3_3_RA3_01_1233.d 9.35E3 1 1 50 78 Methylation(others)
R.M(+15.99)IPGAEPLK.V Y 21.61 970.5157 9 -93.4 486.2198 2 72.92 1 36231 AEV 2_3_RA2_01_1224.d 2.91E4 2 2 1383 1391 Oxidation (M)
K.E(+27.99)HGPR.L Y 21.59 622.2823 5 36.9 623.3125 1 19.33 3 7475 AEV_3_3_RA3_01_1233.d 9.13E3 1 1 575 579 Formylation
K.K(+42.01)LNADFQ(+.98)K.V Y 21.39 1005.5131 8 -14.1 503.7567 2 60.40 2 26137 AEV_1_3_RA2_01_1232.d 0 1 1 905 912 Acetylation (N-term); Deamidation (NQ)
K.RDYIIK(+72.02).K Y 21.28 878.4861 6 -16.8 879.4786 1 88.46 3 53868 AEV_3_3_RA3_01_1233.d 4.73E4 1 1 899 904 Carboxyethyl
K.T(+42.01)TIDPSK(+27.99).L Y 21.21 830.4022 7 -62.2 831.3578 1 90.86 1 50242 AEV 2_3_RA2_01_1224.d 2.52E4 1 1 2028 2034 Acetylation (N-term); Formylation
K.ASFEDMRSK.G Y 21.19 1069.4862 9 -7.3 535.7465 2 30.83 3 13876 AEV_3_3_RA3_01_1233.d 1.41E4 1 1 1816 1824
K.T(+79.97)PLNLR.A Y 21.03 792.3895 6 39.4 397.2176 2 44.85 3 22464 AEV_3_3_RA3_01_1233.d 1.54E5 1 1 1567 1572 Phosphorylation (STY)
R.WEDTY(+79.97)KGPAGGVITVR(+14.02)S(+79.97)EMGEPIHK.L Y 21.01 2930.3074 25 -36.3 587.0475 5 78.91 1 40974 AEV 2_3_RA2_01_1224.d 1.51E6 1 1 843 867 Phosphorylation (STY); Methylation(KR)
R.AAANRPT(-2.02)KPHESALLR.A Y 20.81 1728.9382 16 -34.5 433.2269 4 31.74 3 14414 AEV_3_3_RA3_01_1233.d 0 1 1 145 160 2-amino-3-oxo-butanoic_acid
K.TT(+79.97)IDPSKLVGK(+14.02).Y Y 20.76 1251.6476 11 7.7 313.9216 4 19.81 3 7728 AEV_3_3_RA3_01_1233.d 4.64E4 1 1 2028 2038 Phosphorylation (STY); Methylation(KR)
R.LSPST(+79.97)SAS(+79.97)LPDLDR.W Y 20.69 1617.6688 14 21.3 324.5479 5 76.71 1 39226 AEV 2_3_RA2_01_1224.d 0 1 1 1146 1159 Phosphorylation (STY)
K.SM(-48.00)TEALNKIEK.N Y 20.68 1214.6506 11 0.1 405.8909 3 21.09 3 8427 AEV_3_3_RA3_01_1233.d 2.73E5 1 1 640 650 Dethiomethyl
R.TSLAPSILQDSIE(+14.02)NGEGVPTPMLSIR.D Y 20.67 2738.4160 26 1.3 913.8138 3 89.59 2 47029 AEV_1_3_RA2_01_1232.d 2.97E2 1 1 329 354 Methylation(others)
R.TTGDR.E Y 20.60 548.2554 5 34.5 549.2816 1 22.80 3 9324 AEV_3_3_RA3_01_1233.d 1.03E4 1 1 1236 1240
K.QAIAEAEGVDDDR(-.98).W Y 20.57 1386.6375 13 1.3 347.6671 4 73.73 1 36873 AEV 2_3_RA2_01_1224.d 5.75E4 1 1 830 842 Amidation
R.GLTMQVAVERDEQGR(+14.02).S Y 20.56 1701.8468 15 4.7 568.2922 3 64.60 3 35969 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 1864 1878 Methylation(KR)
K.QAIAEAEGVDDDR.W Y 20.52 1387.6215 13 -41.3 694.7894 2 66.26 1 31068 AEV 2_3_RA2_01_1224.d 4.57E4 1 1 830 842
K.SLRIPVYDTNT(+13.03)GEDLR.A Y 20.40 1860.9694 16 -4.6 621.3275 3 74.61 3 43825 AEV_3_3_RA3_01_1233.d 0 1 1 464 479 Michael addition with methylamine
R.G(+42.01)LTMQVAVER(+14.02).D Y 20.27 1158.6067 10 -7.4 580.3063 2 83.74 3 50835 AEV_3_3_RA3_01_1233.d 2.28E5 1 1 1864 1873 Acetylation (N-term); Methylation(KR)
R.NFVVTGPPISLYGLNLR(-.98)(+14.02).L Y 20.24 1872.0621 17 -22.8 625.0137 3 88.71 3 54021 AEV_3_3_RA3_01_1233.d 1.97E4 1 1 388 404 Amidation; Methylation(KR)
K.DVAVLQSK.E Y 20.14 858.4811 8 -3.6 430.2463 2 40.71 3 19812 AEV_3_3_RA3_01_1233.d 2.18E5 1 1 1464 1471
R.SLVETWAAEN(+.98)NIGR.V Y 20.00 1559.7579 14 1.8 780.8876 2 75.13 3 44223 AEV_3_3_RA3_01_1233.d 5.92E4 1 1 1618 1631 Deamidation (NQ)
R.AAANR(+14.02)PT(-18.01)KPHESALLR.A Y 19.95 1726.9590 16 -34.5 432.7321 4 36.15 2 13615 AEV_1_3_RA2_01_1232.d 1.48E5 1 1 145 160 Methylation(KR); Dehydration
K.ILSAYPEAASQLISAQDVQHFLLLC(+57.02)QRR.G Y 19.92 3226.6921 28 -0.5 807.6799 4 86.46 3 52682 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 996 1023 Carbamidomethylation
K.VMGK(+14.02)QPGEVLER.F Y 19.90 1355.7231 12 -5.0 452.9128 3 36.07 3 16986 AEV_3_3_RA3_01_1233.d 0 1 1 267 278 Methylation(KR)
R.KEEVPMQLHLGS(+79.97)SK.D Y 19.65 1661.7848 14 -58.4 831.8511 2 89.47 1 49230 AEV 2_3_RA2_01_1224.d 5.43E4 1 1 1450 1463 Phosphorylation (STY)
R.L(+42.01)TGDFIR.R Y 19.64 862.4548 7 -13.1 432.2291 2 41.50 3 20331 AEV_3_3_RA3_01_1233.d 7.7E4 1 1 958 964 Acetylation (N-term)
R.VSGDYNPIHVSR(+14.02).V Y 19.58 1356.6786 12 -1.3 453.2329 3 59.90 2 25816 AEV_1_3_RA2_01_1232.d 1.15E5 1 1 1583 1594 Methylation(KR)
R.APASNE(+14.02)TYAR.V Y 19.39 1092.5199 10 2.4 547.2686 2 29.95 2 10687 AEV_1_3_RA2_01_1232.d 0 1 1 1573 1582 Methylation(others)
R.MVELMYVKHESR.W Y 19.21 1520.7479 12 41.1 381.2099 4 57.85 3 30847 AEV_3_3_RA3_01_1233.d 0 1 1 938 949
K.L(+27.99)NADFQK(+14.02).V Y 19.10 876.4341 7 18.8 439.2325 2 18.03 2 5582 AEV_1_3_RA2_01_1232.d 4.91E4 1 1 906 912 Formylation; Methylation(KR)
K.SM(+15.99)TEALNK.I Y 19.08 908.4273 8 25.9 909.4581 1 94.64 2 49210 AEV_1_3_RA2_01_1232.d 4.71E4 1 1 640 647 Oxidation (M)
R.LDE(+14.02)PDVDLLGQTLTFR.L Y 19.01 1844.9519 16 2.5 923.4855 2 88.80 3 54050 AEV_3_3_RA3_01_1233.d 0 1 1 1476 1491 Methylation(others)
K.ASKNALT(+79.97)MLFWIGM(+15.99)RSQ(+.98)QAYPR.T Y 18.98 2665.2546 22 -14.6 667.3112 4 86.77 1 47168 AEV 2_3_RA2_01_1224.d 3.36E5 1 1 307 328 Phosphorylation (STY); Oxidation (M); Deamidation (NQ)
R.DIDGLT(+79.97)VSEDANK(+14.02).I Y 18.86 1469.6287 13 21.2 368.4222 4 63.52 1 29196 AEV 2_3_RA2_01_1224.d 7.59E5 1 1 1129 1141 Phosphorylation (STY); Methylation(KR)
K.Q(+42.01)AIAEAEGVDDDRWEDTYK(+43.01).G Y 18.85 2294.9927 19 5.4 766.0090 3 86.00 1 46569 AEV 2_3_RA2_01_1224.d 0 1 1 830 848 Acetylation (N-term); Carbamylation
R.G(+42.01)FATIPLK(+42.01).G Y 18.83 929.5222 8 6.7 310.8501 3 37.13 2 14088 AEV_1_3_RA2_01_1232.d 1.97E4 1 1 1992 1999 Acetylation (N-term); Acetylation (K)
K.VGDVLETTAQVN(+.98)AVINQDSGK(+14.02).M Y 18.66 2172.0911 21 12.6 544.0369 4 71.07 3 41064 AEV_3_3_RA3_01_1233.d 3.66E5 1 1 1392 1412 Deamidation (NQ); Methylation(KR)
R.Q(-17.03)FGYPPMPFDGC(+57.02)LFGSR(+14.02).M Y 18.64 1971.8647 17 10.6 986.9501 2 94.43 2 49132 AEV_1_3_RA2_01_1232.d 5.44E4 1 1 799 815 Pyro-glu from Q; Carbamidomethylation; Methylation(KR)
K.F(+42.01)QTNPMK.R Y 18.61 906.4269 7 -57.8 454.1945 2 35.98 1 12180 AEV 2_3_RA2_01_1224.d 9.58E4 1 1 1187 1193 Acetylation (N-term)
K.TVE(+43.99)VRTTGDR.E Y 18.59 1176.5735 10 14.5 589.3026 2 75.51 3 44528 AEV_3_3_RA3_01_1233.d 1.73E5 1 1 1231 1240 Carboxylation (E)
K.VKAPTGLDQ(+.98)NR.I Y 18.56 1198.6306 11 -21.9 400.5421 3 67.06 3 37903 AEV_3_3_RA3_01_1233.d 1.73E4 1 1 408 418 Deamidation (NQ)
K.I(+27.99)NKTTIDPSK.L Y 18.53 1143.6135 10 -10.4 382.2078 3 61.07 2 26577 AEV_1_3_RA2_01_1232.d 0 1 1 2025 2034 Formylation
R.VF(+31.99)SSYANLPGTITHGMYTSAAVR(+14.02).S Y 18.49 2488.2056 23 -31.1 623.0393 4 62.38 2 27460 AEV_1_3_RA2_01_1232.d 3.37E4 1 1 1595 1617 Dihydroxy; Methylation(KR)
R.IFKDVNENS(-2.02)TSYTYR.S Y 18.49 1833.8533 15 52.4 612.3237 3 61.61 2 26920 AEV_1_3_RA2_01_1232.d 0 1 1 1780 1794 2-amino-3-oxo-butanoic_acid
K.VMGK(+14.02)Q(+.98)PGEVLER.F Y 18.46 1356.7072 12 -9.2 340.1809 4 19.90 2 6363 AEV_1_3_RA2_01_1232.d 0 1 1 267 278 Methylation(KR); Deamidation (NQ)
K.K(+27.99)LNADFQK(+42.01).V Y 18.34 1032.5239 8 -71.0 345.1575 3 56.52 1 24137 AEV 2_3_RA2_01_1224.d 2.58E5 1 1 905 912 Formylation; Acetylation (K)
R.M(+42.01)(+15.99)IPGAEPLK(+14.02).V Y 18.31 1026.5420 9 -5.0 343.1862 3 34.71 3 16160 AEV_3_3_RA3_01_1233.d 7.36E4 1 1 1383 1391 Acetylation (N-term); Oxidation (M); Methylation(KR)
K.RLPELK.K Y 18.01 754.4701 6 -1.7 378.2417 2 32.42 3 14818 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 891 896
K.EYFEDVYR(+14.02).L Y 17.86 1133.5029 8 24.9 567.7728 2 71.80 2 34196 AEV_1_3_RA2_01_1232.d 0 1 1 2053 2060 Methylation(KR)
K.APTGLDQNR(-.98).I Y 17.73 969.4991 9 -74.8 324.1495 3 54.88 1 23092 AEV 2_3_RA2_01_1224.d 2.6E4 1 1 410 418 Amidation
R.VIDGDLLK(+28.03).L Y 17.70 899.5328 8 -62.0 900.4843 1 108.62 1 58365 AEV 2_3_RA2_01_1224.d 1.46E5 1 1 1366 1373 Dimethylation(KR)
R.D(+226.08)IDGLTVSEDANK.I Y 17.65 1601.7242 13 22.3 401.4473 4 13.57 2 3809 AEV_1_3_RA2_01_1232.d 5.53E4 1 1 1129 1141 Biotinylation
K.IFS(+79.97)LDKAKR(+31.99)LPELK.K Y 17.26 1768.9487 14 -14.7 443.2379 4 74.00 2 35875 AEV_1_3_RA2_01_1232.d 0 1 1 883 896 Phosphorylation (STY); Dihydroxy
R.GSYNDFETTFQ(+.98)R.K Y 17.24 1464.6157 12 29.7 733.3369 2 71.89 2 34264 AEV_1_3_RA2_01_1232.d 0 1 1 1438 1449 Deamidation (NQ)
R.I(+41.03)LAPTPGMFVEIQYPNDAKR.T Y 17.21 2300.1987 20 -5.6 576.0537 4 80.82 3 48704 AEV_3_3_RA3_01_1233.d 2.66E5 1 1 1195 1214 Amidination of lysines or N-terminal amines with methyl acetimidate
R.HISISLVNSAR(+14.02).N Y 17.18 1209.6830 11 -4.9 404.2330 3 31.65 3 14359 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 377 387 Methylation(KR)
K.VEASNQ(+.98)ATEEK(+43.01).V Y 17.15 1248.5470 11 -10.4 625.2743 2 54.05 1 22593 AEV 2_3_RA2_01_1224.d 5.38E4 1 1 1667 1677 Deamidation (NQ); Carbamylation
R.GITVNLIYVNPR(+28.03).A Y 17.09 1385.8031 12 -15.4 462.9345 3 62.53 2 27557 AEV_1_3_RA2_01_1232.d 2.69E4 1 1 657 668 Dimethylation(KR)
R.HGS(+13.03)AIEQPVHFENPIPLSGKTPLNLR.A Y 17.03 2863.5457 26 -31.7 573.6982 5 77.71 3 46270 AEV_3_3_RA3_01_1233.d 1.46E5 1 1 1547 1572 Michael addition with methylamine
R.EIMDDRND(+43.99)R.I Y 16.88 1206.4935 9 29.3 604.2717 2 50.07 1 20282 AEV 2_3_RA2_01_1224.d 0 1 1 1276 1284 Carboxylation (DKW)
R.G(+42.01)LTMQVAVER.D Y 16.86 1144.5911 10 -3.6 573.3007 2 40.23 3 19539 AEV_3_3_RA3_01_1233.d 1.86E5 2 2 1864 1873 Acetylation (N-term)
K.M(+15.99)VEVCGTIK.R Y 16.82 994.4827 9 -7.3 498.2450 2 23.73 3 9828 AEV_3_3_RA3_01_1233.d 0 1 1 1413 1421 Oxidation (M)
R.FTYHPETGYAPIREIM(+15.99)DDR.N Y 16.74 2326.0688 19 -19.4 466.2120 5 81.69 1 43155 AEV 2_3_RA2_01_1224.d 2.1E4 1 1 1263 1281 Oxidation (M)
R.LTGDFIRR.V Y 16.72 976.5454 8 -27.3 489.2667 2 77.38 3 46007 AEV_3_3_RA3_01_1233.d 3.45E4 1 1 958 965
R.E(+27.99)IMDDRN(+.98)DR.I Y 16.66 1191.4825 9 -15.5 596.7393 2 65.73 1 30669 AEV 2_3_RA2_01_1224.d 2.33E5 1 1 1276 1284 Formylation; Deamidation (NQ)
K.VEAS(+79.97)NQAT(+79.97)EEK(+14.02).V Y 16.63 1378.5055 11 29.8 690.2806 2 81.55 1 43045 AEV 2_3_RA2_01_1224.d 2.17E5 1 1 1667 1677 Phosphorylation (STY); Methylation(KR)
R.SPTGLLSATQFTQPALT(-18.01)LMEK.A Y 16.59 2215.1558 21 10.0 554.8018 4 75.37 2 36897 AEV_1_3_RA2_01_1232.d 5.05E4 1 1 1795 1815 Dehydration
MYGTSTGPQTGINT(+79.97)P(+31.99)R.S Y 16.54 1791.7499 16 -8.6 598.2521 3 84.33 1 45248 AEV 2_3_RA2_01_1224.d 0 1 1 1 16 Phosphorylation (STY); Dihydroxy
R.APASN(+.98)ETY(+79.97)AR.V Y 16.51 1159.4546 10 -34.6 387.4788 3 27.44 1 7668 AEV 2_3_RA2_01_1224.d 2.95E5 1 1 1573 1582 Deamidation (NQ); Phosphorylation (STY)
K.HIGFKPGSMDAIQ(+.98)QVINIAK.A Y 16.51 2167.1460 20 -82.5 542.7491 4 90.05 1 49657 AEV 2_3_RA2_01_1224.d 9.7E3 1 1 713 732 Deamidation (NQ)
K.M(+15.99)VEVC(+57.02)GT(+79.97)IK.R Y 16.50 1131.4706 9 4.5 566.7451 2 53.76 1 22397 AEV 2_3_RA2_01_1224.d 2.66E5 1 1 1413 1421 Oxidation (M); Carbamidomethylation; Phosphorylation (STY)
R.TFISVR(+.98).E Y 16.48 722.3962 6 -95.2 362.1710 2 50.84 1 20683 AEV 2_3_RA2_01_1224.d 0 1 1 1215 1220 Deamidation (R)
K.GMDIVR.W Y 16.41 689.3530 6 -151.4 690.2559 1 52.29 1 21533 AEV 2_3_RA2_01_1224.d 1.08E6 1 1 224 229
K.TSVGQTFVDT(-18.01)K(+42.01).M Y 16.35 1205.5928 11 46.9 302.4196 4 30.51 3 13688 AEV_3_3_RA3_01_1233.d 4.46E5 1 1 583 593 Dehydration; Acetylation (K)
K.YSNTVDEPVK.D Y 16.24 1150.5505 10 4.3 576.2850 2 63.06 3 34790 AEV_3_3_RA3_01_1233.d 0 1 1 1075 1084
K.AS(-18.01)FEDMR.S Y 16.17 836.3487 7 -42.8 419.1637 2 26.89 1 7405 AEV 2_3_RA2_01_1224.d 6.9E4 1 1 1816 1822 Dehydration
K.EVWD(-18.01)R.A Y 16.16 685.3184 5 -69.8 686.2778 1 38.41 1 13502 AEV 2_3_RA2_01_1224.d 4.98E4 1 1 1717 1721 Dehydration
R.IGSVLAN(+.98)WAK(+43.99).Y Y 16.08 1102.5658 10 -1.2 552.2895 2 49.51 2 20200 AEV_1_3_RA2_01_1232.d 7.17E4 1 1 2067 2076 Deamidation (NQ); Carboxylation (DKW)
R.FTYHPET(-2.02)GYAPIR.E Y 15.99 1548.7361 13 -41.2 517.2314 3 73.41 1 36614 AEV 2_3_RA2_01_1224.d 3.83E4 1 1 1263 1275 2-amino-3-oxo-butanoic_acid
K.T(+42.01)VEVR(+14.02).T Y 15.99 658.3650 5 -147.0 659.2755 1 86.75 1 47155 AEV 2_3_RA2_01_1224.d 0 1 1 1231 1235 Acetylation (N-term); Methylation(KR)
R.E(+175.04)ISLTLFEGR.T Y 15.97 1338.6608 10 -2.5 670.3360 2 62.16 2 27299 AEV_1_3_RA2_01_1232.d 6.19E4 1 1 1241 1250 Naphthalene-2,3-dicarboxaldehyde
R.L(+226.08)TNSPR.I Y 15.94 912.4487 6 -20.2 305.1507 3 37.15 1 12795 AEV 2_3_RA2_01_1224.d 1.63E5 1 1 2061 2066 Biotinylation
K.E(+42.01)AHTSKAAKQAIAEAEGVDDDR.W Y 15.92 2353.1145 22 -46.2 589.2587 4 85.80 1 46420 AEV 2_3_RA2_01_1224.d 1.98E5 1 1 821 842 Acetylation (N-term)
R.T(+42.01)TGD(-18.01)R.E Y 15.91 572.2554 5 -80.7 573.2166 1 24.77 1 6447 AEV 2_3_RA2_01_1224.d 0 1 1 1236 1240 Acetylation (N-term); Dehydration
R.DIDGLT(+79.96)VSEDANK(+14.02)ISYR.L Y 15.91 1988.8997 17 31.9 498.2480 4 71.91 3 41737 AEV_3_3_RA3_01_1233.d 9.82E4 1 1 1129 1145 Sulfation; Methylation(KR)
K.LLVVQAYYAGR(-.98)(+14.02).A Y 15.74 1264.7291 11 22.5 317.1967 4 69.05 2 32133 AEV_1_3_RA2_01_1232.d 3.98E5 1 1 134 144 Amidation; Methylation(KR)
K.RTFISVR(+21.98).E Y 15.72 899.4953 7 -13.0 300.8351 3 9.65 2 2366 AEV_1_3_RA2_01_1232.d 1.14E4 1 1 1214 1220 Sodium adduct
K.L(+27.99)NADFQK.V Y 15.65 862.4185 7 8.9 432.2203 2 43.55 3 21635 AEV_3_3_RA3_01_1233.d 2.24E5 1 1 906 912 Formylation
K.Y(+42.01)SNTVDEPVK(+28.03).D Y 15.56 1220.5924 10 -38.6 611.2799 2 31.35 1 9754 AEV 2_3_RA2_01_1224.d 1.37E5 1 1 1075 1084 Acetylation (N-term); Dimethylation(KR)
K.NIPPGR(+14.02).G Y 15.55 666.3813 6 -10.6 667.3815 1 86.21 2 45111 AEV_1_3_RA2_01_1232.d 0 1 1 651 656 Methylation(KR)
R.LT(+79.97)NSPR.I Y 15.51 766.3375 6 -38.6 767.3152 1 91.82 1 50938 AEV 2_3_RA2_01_1224.d 1.22E5 1 1 2061 2066 Phosphorylation (STY)
K.TSVGQ(+.98)T(+79.97)FVDTK(+42.01).M Y 15.49 1304.5537 11 -26.3 653.2670 2 51.84 1 21264 AEV 2_3_RA2_01_1224.d 4.74E4 1 1 583 593 Deamidation (NQ); Phosphorylation (STY); Acetylation (K)
K.QPGEVLER(+14.02).F Y 15.47 940.4977 8 6.6 471.2592 2 43.93 3 21878 AEV_3_3_RA3_01_1233.d 5.8E4 1 1 271 278 Methylation(KR)
R.VIDGDLLK(+43.01).L Y 15.44 914.5073 8 -12.5 305.8392 3 40.12 3 19479 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 1366 1373 Carbamylation
R.M(+31.99)M(+15.99)TAKEAHTSK.A Y 15.33 1281.5693 11 -51.8 641.7587 2 73.94 1 37044 AEV 2_3_RA2_01_1224.d 1.04E5 1 1 816 826 Sulphone; Oxidation (M)
R.SLVETWAAENNIGR(+160.04)VR.S Y 15.32 1973.9806 16 -4.7 658.9977 3 80.71 2 41129 AEV_1_3_RA2_01_1232.d 1.34E5 1 1 1618 1633 Condensation product of glucosone
R.IGSVLANWAK.Y Y 15.30 1057.5920 10 -94.3 529.7534 2 80.37 1 42131 AEV 2_3_RA2_01_1224.d 5.46E4 1 1 2067 2076
R.H(+15.99)ISISLVNSAR.N Y 15.30 1211.6622 11 14.0 404.9004 3 57.82 3 30823 AEV_3_3_RA3_01_1233.d 0 1 1 377 387 Oxidation (HW)
R.TTGDREISLTLFEGRTAEGGVVPLC(+57.02)FR.F Y 15.28 2980.5076 27 -51.0 746.0961 4 82.66 3 50070 AEV_3_3_RA3_01_1233.d 0 1 1 1236 1262 Carbamidomethylation
R.VIDGDLLK(+226.08).L Y 15.23 1097.5791 8 32.2 366.8788 3 42.13 2 16536 AEV_1_3_RA2_01_1232.d 1.28E4 1 1 1366 1373 Biotinylation
R.HISISLVN(+.98)S(+79.97)AR.N Y 15.22 1276.6177 11 14.3 639.3253 2 58.59 2 24987 AEV_1_3_RA2_01_1232.d 0 1 1 377 387 Deamidation (NQ); Phosphorylation (STY)
R.S(+27.99)QQAYPR.T Y 15.15 876.4089 7 -53.5 877.3693 1 94.03 1 52497 AEV 2_3_RA2_01_1224.d 4.84E4 1 1 322 328 Formylation
R.GLT(+79.96)MQVAVER.D Y 15.15 1182.5372 10 9.8 395.1902 3 50.84 1 20679 AEV 2_3_RA2_01_1224.d 0 1 1 1864 1873 Sulfation
K.DGTGVR.I Y 15.12 603.2976 6 -34.5 604.2841 1 19.62 3 7641 AEV_3_3_RA3_01_1233.d 5.79E4 1 1 532 537
R.GSYN(+.98)DFETTFQR.K Y 15.12 1464.6157 12 35.2 733.3409 2 72.05 3 41831 AEV_3_3_RA3_01_1233.d 0 1 1 1438 1449 Deamidation (NQ)
total 302 peptides
C1GHS5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VSGHPTVGIASTTGVIGPMASNLDDLALSYR.I Y 172.03 3098.5706 31 1.5 1033.8657 3 85.55 2 44712 AEV_1_3_RA2_01_1232.d 1.31E6 6 6 306 336
R.IMAAPDPSSMTSSSFPDPLTTIPSSQSLSSRPK.V Y 162.14 3419.6587 33 0.6 1140.8942 3 82.91 2 42842 AEV_1_3_RA2_01_1232.d 6.07E5 3 3 337 369
R.NPHHEDYYTGGSSGGSGYAVGVGLVPIALGADGGGSIR.I Y 151.69 3643.7290 38 4.2 911.9434 4 81.09 2 41436 AEV_1_3_RA2_01_1232.d 7.26E5 3 3 251 288
R.VSGHPTVGIASTTGVIGPM(+15.99)ASNLDDLALSYR.I Y 150.51 3114.5654 31 3.3 1039.1992 3 81.82 2 41984 AEV_1_3_RA2_01_1232.d 3.29E5 2 2 306 336 Oxidation (M)
K.VIGVFPDWVNRADPAVLALFNK.A Y 146.90 2440.3267 22 -2.7 611.0873 4 90.91 2 47672 AEV_1_3_RA2_01_1232.d 5.6E5 4 4 370 391
R.DGEGMLGFDAAATDTSTAATPK.G Y 138.38 2125.9473 22 -0.2 1063.9807 2 77.62 2 38685 AEV_1_3_RA2_01_1232.d 5.01E5 3 3 566 587
R.YDPTVTPIANPSEAK.H Y 136.80 1601.7937 15 3.9 801.9073 2 66.08 2 30053 AEV_1_3_RA2_01_1232.d 4.27E6 8 8 79 93
R.RDTNPC(+57.02)GEYSIGFLETK.A Y 136.75 1985.9153 17 3.0 662.9810 3 73.66 2 35618 AEV_1_3_RA2_01_1232.d 5.15E5 3 3 139 155 Carbamidomethylation
K.TSMHELGLDTTNNNPNVGTPR.N Y 130.82 2267.0601 21 5.3 756.6979 3 65.69 2 29739 AEV_1_3_RA2_01_1232.d 1.21E6 7 7 230 250
K.TSM(+15.99)HELGLDTTNNNPNVGTPR.N Y 122.46 2283.0549 21 0.7 762.0261 3 60.56 3 32871 AEV_3_3_RA3_01_1233.d 5.43E5 6 6 230 250 Oxidation (M)
R.YKNGNPLGPLDGVPVAVKDEVDIEGYKR.T Y 118.77 3041.5820 28 3.7 609.3259 5 78.57 2 39419 AEV_1_3_RA2_01_1232.d 9.37E5 5 5 170 197
R.ADPAVLALFNK.A Y 109.71 1157.6444 11 -13.6 579.8216 2 80.79 2 41204 AEV_1_3_RA2_01_1232.d 6.55E5 5 5 381 391
R.DTNPC(+57.02)GEYSIGFLETK.A Y 108.29 1829.8141 16 0.0 915.9143 2 79.43 3 47651 AEV_3_3_RA3_01_1233.d 7.04E5 3 3 140 155 Carbamidomethylation
R.RDTNPC(+57.02)GEYSIGFLETKADIAR.A Y 107.36 2512.2017 22 -0.1 629.0576 4 75.43 3 44464 AEV_3_3_RA3_01_1233.d 2.05E5 3 3 139 160 Carbamidomethylation
R.DTNPC(+57.02)GEYSIGFLETKADIAR.A Y 107.29 2356.1006 21 -0.6 1179.0569 2 79.56 3 47727 AEV_3_3_RA3_01_1233.d 2.09E5 2 2 140 160 Carbamidomethylation
R.DGEGM(+15.99)LGFDAAATDTSTAATPK.G Y 107.06 2141.9421 22 -0.1 1071.9783 2 71.69 2 34112 AEV_1_3_RA2_01_1232.d 5.48E5 3 3 566 587 Oxidation (M)
K.AHALTILAEIESHLSLDQISK.L Y 106.76 2288.2375 21 -1.3 573.0659 4 87.98 2 46182 AEV_1_3_RA2_01_1232.d 3.12E5 2 2 418 438
K.VIGVFPDWVNRADPAVLALFNKAIDYYR.N Y 105.95 3221.7024 28 -0.7 806.4323 4 93.50 3 56577 AEV_3_3_RA3_01_1233.d 1.79E5 2 2 370 397
R.IPASFC(+57.02)GIYGLKPSHGR.V Y 103.77 1858.9512 17 4.9 465.7473 4 69.35 2 32363 AEV_1_3_RA2_01_1232.d 1.16E6 3 3 289 305 Carbamidomethylation
R.TLGSKLDFTGAENR.T Y 102.49 1507.7631 14 6.6 503.5983 3 65.19 2 29382 AEV_1_3_RA2_01_1232.d 1.57E6 5 5 198 211
R.RDGLGYYTSADYHALYLSGELTPTAVVEALLPLIR.R Y 99.19 3836.9988 35 -44.6 960.2142 4 96.74 3 57938 AEV_3_3_RA3_01_1233.d 6.15E4 2 2 104 138
R.NNQGYTVVDISIPLLPEGQK.A Y 94.17 2184.1426 20 2.4 729.0565 3 85.88 2 44901 AEV_1_3_RA2_01_1232.d 5.48E4 2 2 398 417
R.IIMAVGGNPTR.A Y 92.60 1127.6121 11 3.3 564.8152 2 61.62 2 26946 AEV_1_3_RA2_01_1232.d 1.58E6 8 8 445 455
R.YKN(+.98)GNPLGPLDGVPVAVKDEVDIEGYKR.T Y 92.25 3042.5662 28 -4.0 609.5181 5 79.41 3 47653 AEV_3_3_RA3_01_1233.d 1.89E5 1 1 170 197 Deamidation (NQ)
R.YDPTVTPIANPSEAK(+14.02).H Y 89.30 1615.8093 15 1.3 808.9130 2 68.32 2 31629 AEV_1_3_RA2_01_1232.d 7.37E5 3 3 79 93 Methylation(KR)
R.IMAAPDPSSM(+15.99)TSSSFPDPLTTIPSSQSLSSRPK.V Y 86.89 3435.6538 33 -0.5 1146.2246 3 80.49 3 48446 AEV_3_3_RA3_01_1233.d 1.48E5 2 2 337 369 Oxidation (M)
K.TSMHELGLDTTNNNPNVGTPR(+14.02).N Y 86.73 2281.0757 21 -1.6 761.3646 3 67.21 3 38021 AEV_3_3_RA3_01_1233.d 7.21E4 2 2 230 250 Methylation(KR)
R.RDTNPC(+57.02)GEYSIGFLETK(+14.02).A Y 85.82 1999.9309 17 -29.0 667.6316 3 75.58 2 37056 AEV_1_3_RA2_01_1232.d 0 2 2 139 155 Carbamidomethylation; Methylation(KR)
R.FYNYPIPR.K Y 83.78 1068.5392 8 2.0 535.2780 2 69.36 2 32405 AEV_1_3_RA2_01_1232.d 1.97E6 8 8 11 18
R.VSGHPTVGIASTTGVIGPMASNLDDLALSYR(+14.02).I Y 82.48 3112.5862 31 -2.2 1038.5337 3 86.48 3 52722 AEV_3_3_RA3_01_1233.d 2.12E5 2 2 306 336 Methylation(KR)
R.NVPGLNDYQPR.Y Y 80.96 1271.6259 11 4.3 636.8229 2 64.09 2 28646 AEV_1_3_RA2_01_1232.d 2.52E6 8 8 68 78
K.HSSLPSPSQR.R Y 80.92 1094.5469 10 22.6 548.2931 2 23.36 3 9625 AEV_3_3_RA3_01_1233.d 1.67E6 9 9 94 103
R.VSGHPTVGIASTTGVIGPMAS(+58.03)NLDDLALSYR.I Y 79.93 3156.5999 31 -2.6 790.1552 4 78.85 2 39647 AEV_1_3_RA2_01_1232.d 1.43E5 1 1 306 336 2,3-dihydro-2,2-dimethyl-7-benzofuranol N-methyl carbamate
R.DTNPC(+57.02)GEYSIGFLETK(+14.02).A Y 79.76 1843.8298 16 -1.7 922.9206 2 80.65 3 48569 AEV_3_3_RA3_01_1233.d 8.8E4 3 3 140 155 Carbamidomethylation; Methylation(KR)
K.HSSLPSPSQRR.D Y 79.52 1250.6479 11 5.3 417.8922 3 20.10 2 6449 AEV_1_3_RA2_01_1232.d 1.77E6 10 10 94 104
R.IMAAPDPS(+114.04)SMTSSSFPDPLTTIPSSQSLSSRPK.V Y 79.25 3533.7017 33 -1.6 707.7465 5 73.56 2 35553 AEV_1_3_RA2_01_1232.d 2.88E5 1 1 337 369 Ubiquitin
R.YDPTVTPIANPS(+14.02)EAK.H Y 77.90 1615.8093 15 -1.1 808.9111 2 67.85 3 38560 AEV_3_3_RA3_01_1233.d 4.15E5 1 1 79 93 Methylation(others)
K.KWEEAGAVVIGK.T Y 77.37 1285.7030 12 -2.8 429.5737 3 62.08 3 34026 AEV_3_3_RA3_01_1233.d 1.84E5 2 2 218 229
K.LDFTGAENR.T Y 77.35 1021.4828 9 6.1 511.7518 2 55.59 2 23313 AEV_1_3_RA2_01_1232.d 1.4E6 6 6 203 211
K.GGLKAPDTTNGGK.W Y 76.15 1214.6255 13 -1.9 608.3188 2 21.91 3 8852 AEV_3_3_RA3_01_1233.d 4.29E5 7 7 588 600
K.VIGVFPDWVNR.A Y 75.21 1300.6927 11 5.1 434.5737 3 81.98 3 49579 AEV_3_3_RA3_01_1233.d 8.24E5 6 6 370 380
R.IMAAP(+31.99)DPSSMTSS(+79.97)SFPDPLTTIPSSQSLSSRPK.V Y 73.22 3531.6150 33 49.6 707.3653 5 73.71 2 35657 AEV_1_3_RA2_01_1232.d 0 1 1 337 369 Dihydroxy; Phosphorylation (STY)
R.KGPNVPFNYLPSSNPLIR.G Y 71.73 2012.0842 18 -3.1 671.7000 3 79.41 3 47610 AEV_3_3_RA3_01_1233.d 1.42E6 6 6 19 36
K.GGLKAPDTTN(+.98)GGKWVDVIGK.V Y 70.60 2013.0531 20 0.1 672.0250 3 72.14 3 41902 AEV_3_3_RA3_01_1233.d 4.68E5 3 3 588 607 Deamidation (NQ)
R.VSGHPTVGIASTTGVIGPMASN(+.98)LDDLALSYR.I Y 67.60 3099.5547 31 -1.0 775.8951 4 85.37 3 51951 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 306 336 Deamidation (NQ)
K.TSMHE(+14.02)LGLDTTNNNPNVGTPR.N Y 66.93 2281.0757 21 0.9 761.3665 3 67.61 3 38346 AEV_3_3_RA3_01_1233.d 8.41E4 2 2 230 250 Methylation(others)
R.IIM(+15.99)AVGGNPTR.A Y 65.68 1143.6071 11 -1.0 572.8102 2 45.88 3 23107 AEV_3_3_RA3_01_1233.d 1.19E6 11 11 445 455 Oxidation (M)
R.ADPAVLALFNKAIDYYR.N Y 65.68 1939.0203 17 -4.3 647.3446 3 87.36 3 53242 AEV_3_3_RA3_01_1233.d 3.29E5 3 3 381 397
R.GVSDVDSSTR.S Y 64.22 1021.4676 10 4.5 511.7434 2 21.52 2 7060 AEV_1_3_RA2_01_1232.d 8.53E5 8 8 507 516
R.IM(+15.99)AAPDPSSMTSSSFPDPLTTIPSSQSLSSRPK.V Y 63.50 3435.6538 33 2.9 1146.2285 3 81.30 3 49068 AEV_3_3_RA3_01_1233.d 6.66E4 1 1 337 369 Oxidation (M)
R.YD(+14.02)PTVTPIANPSEAK.H Y 62.72 1615.8093 15 -0.8 808.9113 2 66.43 3 37413 AEV_3_3_RA3_01_1233.d 1.05E5 2 2 79 93 Methylation(others)
K.ILKGNADLAR.G Y 62.49 1069.6244 10 2.9 535.8210 2 34.50 3 16026 AEV_3_3_RA3_01_1233.d 2.2E6 9 9 497 506
R.AAAAASTERYK.N Y 59.82 1137.5778 11 7.5 569.8004 2 14.90 2 4304 AEV_1_3_RA2_01_1232.d 6.07E4 2 2 161 171
R.VSGHPTVGIASTTGVIGPMASNLDD(+14.02)LALSYR.I Y 59.33 3112.5862 31 3.2 1038.5393 3 86.41 2 45249 AEV_1_3_RA2_01_1232.d 9.31E4 1 1 306 336 Methylation(others)
K.TSMHELGLDTTN(+.98)NNPNVGTPR.N Y 58.26 2268.0442 21 9.8 757.0294 3 66.85 2 30546 AEV_1_3_RA2_01_1232.d 3.11E4 1 1 230 250 Deamidation (NQ)
R.NVPGLNDYQPR(+14.02).Y Y 57.62 1285.6415 11 -4.1 643.8254 2 66.38 3 37434 AEV_3_3_RA3_01_1233.d 2.47E5 2 2 68 78 Methylation(KR)
K.GGLKAPDTTN(+.98)GGK.W Y 56.76 1215.6095 13 1.6 608.8130 2 24.20 3 10120 AEV_3_3_RA3_01_1233.d 4.66E5 5 5 588 600 Deamidation (NQ)
R.RFYNYPIPR.K Y 55.94 1224.6404 9 -92.6 409.1829 3 75.39 1 38245 AEV 2_3_RA2_01_1224.d 1.09E5 3 3 10 18
R.DGE(+14.02)GMLGFDAAATDTSTAATPK.G Y 55.87 2139.9629 22 -1.6 1070.9871 2 79.26 3 47495 AEV_3_3_RA3_01_1233.d 7.26E4 1 1 566 587 Methylation(others)
R.D(+71.04)GEGMLGFDAAATDTSTAATPK.G Y 54.94 2196.9844 22 0.7 733.3359 3 67.75 3 38457 AEV_3_3_RA3_01_1233.d 2.75E5 2 2 566 587 Propionamide (K, X@N-term)
R.YKN(+.98)GNPLGPLDGVPVAVKDEVDIEGYK(+14.02)R.T Y 54.02 3056.5818 28 -4.2 612.3210 5 80.80 3 48688 AEV_3_3_RA3_01_1233.d 0 1 1 170 197 Deamidation (NQ); Methylation(KR)
R.IAGFDVVR.N Y 53.95 875.4865 8 -4.2 438.7487 2 67.50 3 38285 AEV_3_3_RA3_01_1233.d 1.36E6 6 6 60 67
R.YDPTVTPIANP(+13.98)SEAK.H Y 53.92 1615.7729 15 -65.1 808.8412 2 72.96 1 36290 AEV 2_3_RA2_01_1224.d 4.63E5 2 2 79 93 Proline oxidation to pyroglutamic acid
R.RDTNPC(+57.02)GE(+14.02)YSIGFLETK.A Y 52.87 1999.9309 17 -25.3 667.6340 3 75.38 3 44425 AEV_3_3_RA3_01_1233.d 0 1 1 139 155 Carbamidomethylation; Methylation(others)
K.GGLKAPDTTNGGKWVDVIGK.V Y 51.80 2012.0691 20 0.9 504.0250 4 69.25 3 39650 AEV_3_3_RA3_01_1233.d 1.69E5 3 3 588 607
R.YDPTVTPIANPSEAKHSSLPSPSQRR.D Y 51.51 2834.4312 26 15.2 709.6259 4 62.23 3 34143 AEV_3_3_RA3_01_1233.d 8.01E4 2 2 79 104
K.T(+42.01)SM(+15.99)HELGLDTTNNNPNVGTPR.N Y 48.68 2325.0654 21 11.7 582.2805 4 56.70 2 23938 AEV_1_3_RA2_01_1232.d 2.94E4 1 1 230 250 Acetylation (N-term); Oxidation (M)
K.WVDVIGK.V Y 48.26 815.4541 7 4.0 408.7360 2 65.68 2 29721 AEV_1_3_RA2_01_1232.d 8.31E5 10 10 601 607
R.NVPGLN(+.98)DYQPR.Y Y 47.20 1272.6099 11 -0.7 637.3118 2 64.73 3 36066 AEV_3_3_RA3_01_1233.d 4.24E5 3 3 68 78 Deamidation (NQ)
R.VSGHPTVGIASTTGVIGPMASNLD(+6.01)DLALSYR.I Y 45.81 3104.5789 31 -2.1 1035.8647 3 81.53 3 49239 AEV_3_3_RA3_01_1233.d 6.78E4 1 1 306 336 Replacement of proton by lithium
R.YDPTVTPIAN(+.98)PSEAK.H Y 45.81 1602.7777 15 -1.8 802.3947 2 67.08 3 37919 AEV_3_3_RA3_01_1233.d 1.2E5 2 2 79 93 Deamidation (NQ)
R.IMAAPDPSSMTSSSFPDPLTTIPSSQSLSSRPK(+14.02).V Y 43.56 3433.6746 33 1.4 1145.5670 3 82.92 2 42818 AEV_1_3_RA2_01_1232.d 7.06E4 1 1 337 369 Methylation(KR)
R.VSGHPTVGIASTTGVIGPM(-4.99)ASNLDDLALSYR.I Y 43.51 3093.5842 31 -0.7 774.4028 4 85.37 3 51950 AEV_3_3_RA3_01_1233.d 0 1 1 306 336 Methionine replacement by azido homoalanine
R.GVSDVDSSTR(+14.02).S Y 42.58 1035.4833 10 2.0 518.7499 2 32.33 3 14765 AEV_3_3_RA3_01_1233.d 4.13E5 2 2 507 516 Methylation(KR)
R.DTNPC(+57.02)GE(+14.02)YSIGFLETK.A Y 41.72 1843.8298 16 -0.3 922.9219 2 80.99 3 48836 AEV_3_3_RA3_01_1233.d 9.5E4 2 2 140 155 Carbamidomethylation; Methylation(others)
R.NNQGYTVVDIS(-2.02)IPLLPEGQK.A Y 39.30 2182.1270 20 3.3 728.3853 3 86.16 2 45082 AEV_1_3_RA2_01_1232.d 5.23E4 1 1 398 417 2-amino-3-oxo-butanoic_acid
R.VSGHPTVGIASTTGVIGPMASNLDDLALSYR(-.98).I Y 37.88 3097.5867 31 -14.9 1033.5208 3 85.46 2 44625 AEV_1_3_RA2_01_1232.d 0 1 1 306 336 Amidation
R.AAAAASTER(+14.02).Y Y 37.79 860.4352 9 7.1 431.2279 2 13.58 2 3812 AEV_1_3_RA2_01_1232.d 2.13E5 4 4 161 169 Methylation(KR)
K.K(+14.02)WEEAGAVVIGK.T Y 36.93 1299.7186 12 -8.0 434.2433 3 65.00 3 36272 AEV_3_3_RA3_01_1233.d 0 1 1 218 229 Methylation(KR)
R.DTNPC(+57.02)GEYSIGFLETK(+14.02)ADIAR.A Y 36.90 2370.1162 21 5.6 791.0505 3 81.48 3 49195 AEV_3_3_RA3_01_1233.d 4.5E4 1 1 140 160 Carbamidomethylation; Methylation(KR)
R.TLGSKLDFTGAENR(+14.02).T Y 36.11 1521.7787 14 -1.7 508.2660 3 66.96 2 30624 AEV_1_3_RA2_01_1232.d 1.28E5 2 2 198 211 Methylation(KR)
K.TSM(+15.99)HELGLDTTNNNPNVGTPR(+14.02).N Y 35.32 2297.0706 21 -4.6 766.6940 3 62.94 3 34692 AEV_3_3_RA3_01_1233.d 3.99E4 1 1 230 250 Oxidation (M); Methylation(KR)
R.TLGSK(+31.99).L N 35.19 536.2806 5 -0.5 537.2876 1 65.51 3 36676 AEV_3_3_RA3_01_1233.d 2.85E5 6 6 198 202 Dihydroxy
K.LTPANR.I Y 35.17 670.3762 6 -89.8 336.1653 2 20.13 1 4812 AEV 2_3_RA2_01_1224.d 3.22E4 1 1 439 444
K.VIGVFPDWVNR(+14.02).A Y 34.63 1314.7084 11 -3.2 658.3594 2 82.49 3 49943 AEV_3_3_RA3_01_1233.d 4.85E4 1 1 370 380 Methylation(KR)
R.ARDFLAAQK.L Y 34.33 1018.5559 9 0.6 340.5261 3 36.31 2 13685 AEV_1_3_RA2_01_1232.d 1.69E5 2 2 456 464
K.NGNPLGPLDGVPVAVKDEVDIEGYKR.T Y 33.51 2750.4238 26 2.0 688.6146 4 80.56 2 41005 AEV_1_3_RA2_01_1232.d 1.17E5 2 2 172 197
R.TLGS(+79.97)K(+31.99).L N 33.06 616.2469 5 61.4 617.2920 1 83.86 1 44881 AEV 2_3_RA2_01_1224.d 6.31E4 2 2 198 202 Phosphorylation (STY); Dihydroxy
R.Y(+56.06)DPTVTPIANPSEAK.H Y 33.03 1657.8562 15 -30.1 829.9104 2 66.57 3 37521 AEV_3_3_RA3_01_1233.d 8.1E4 1 1 79 93 Diethylation
R.NVPGLNDYQP(+13.98)R.Y Y 32.58 1285.6051 11 -60.4 643.7710 2 73.20 1 36480 AEV 2_3_RA2_01_1224.d 1.35E5 1 1 68 78 Proline oxidation to pyroglutamic acid
K.HSSLPS(+79.97)PSQR(+14.02)R.D Y 32.48 1344.6299 11 40.8 449.2355 3 65.74 2 29772 AEV_1_3_RA2_01_1232.d 0 1 1 94 104 Phosphorylation (STY); Methylation(KR)
R.IAGFDVVR(+14.02).N Y 32.45 889.5021 8 -0.3 445.7582 2 72.54 2 34767 AEV_1_3_RA2_01_1232.d 2.15E5 2 2 60 67 Methylation(KR)
R.AAAAAST(+291.10)ER.Y Y 32.24 1137.5149 9 -31.9 569.7466 2 28.10 1 7991 AEV 2_3_RA2_01_1224.d 2.71E4 1 1 161 169 N-acetyl neuraminic acid
R.DGEGMLGFDAAATDTSTAATP(+13.98)K.G Y 30.82 2139.9265 22 -72.7 1070.8927 2 82.33 1 43654 AEV 2_3_RA2_01_1224.d 1.02E5 1 1 566 587 Proline oxidation to pyroglutamic acid
R.TLGSK(-1.03)LDFTGAENR.T Y 30.25 1506.7314 14 18.5 503.2604 3 64.11 3 35585 AEV_3_3_RA3_01_1233.d 1.97E5 2 2 198 211 Lysine oxidation to aminoadipic semialdehyde
K.LTPANRIIM(+15.99)AVGGNPTR.A Y 29.43 1795.9727 17 15.0 360.2072 5 41.72 2 16321 AEV_1_3_RA2_01_1232.d 0 1 1 439 455 Oxidation (M)
R.TLGS(+79.97)K(+21.98).L N 28.53 606.2390 5 35.4 304.1375 2 34.47 1 11449 AEV 2_3_RA2_01_1224.d 7.18E5 1 1 198 202 Phosphorylation (STY); Sodium adduct
K.G(+42.01)GLKAPDTTNGGK.W Y 28.51 1256.6360 13 3.5 419.8874 3 23.00 2 7642 AEV_1_3_RA2_01_1232.d 5.36E4 1 1 588 600 Acetylation (N-term)
K.NGNPLGPLDGVPVAVK(-1.03)DEVDIEGYKR.T Y 28.32 2749.3921 26 13.6 688.3646 4 80.12 3 48158 AEV_3_3_RA3_01_1233.d 0 1 1 172 197 Lysine oxidation to aminoadipic semialdehyde
K.AIDYYR.N Y 28.00 799.3864 6 2.4 800.3956 1 40.70 2 15792 AEV_1_3_RA2_01_1232.d 6.76E5 4 4 392 397
R.DGEGMLGFDAAATDTSTAATPK(+14.02).G Y 27.68 2139.9629 22 -3.1 1070.9854 2 79.16 2 39896 AEV_1_3_RA2_01_1232.d 1.7E4 1 1 566 587 Methylation(KR)
R.NNQGYTVVDISIPLLPEGQK(+14.02).A Y 26.28 2198.1582 20 -19.3 733.7125 3 87.27 3 53164 AEV_3_3_RA3_01_1233.d 0 1 1 398 417 Methylation(KR)
R.FYNYPIPR(+14.02).K Y 25.83 1082.5549 8 -7.6 542.2806 2 72.76 3 42393 AEV_3_3_RA3_01_1233.d 2.72E5 2 2 11 18 Methylation(KR)
K.I(+41.03)LKGNADLAR.G Y 25.70 1110.6509 10 -96.8 371.1884 3 37.48 2 14272 AEV_1_3_RA2_01_1232.d 0 1 1 497 506 Amidination of lysines or N-terminal amines with methyl acetimidate
K.VIGVFPDW(+13.98)VNR.A Y 25.10 1314.6720 11 -60.9 658.3032 2 88.70 1 48640 AEV 2_3_RA2_01_1224.d 7.22E4 1 1 370 380 Tryptophan oxidation to oxolactone
R.GVSDVD(+14.02)SSTR.S Y 25.04 1035.4833 10 1.6 518.7498 2 31.98 3 14562 AEV_3_3_RA3_01_1233.d 4.9E5 2 2 507 516 Methylation(others)
K.TSMHELGLDT(-2.02)TNNNPNVGTPR.N Y 24.83 2265.0444 21 -13.9 756.0116 3 66.91 2 30592 AEV_1_3_RA2_01_1232.d 0 1 1 230 250 2-amino-3-oxo-butanoic_acid
R.TAWC(+57.02)VK.K Y 24.49 763.3687 6 1.6 382.6922 2 36.86 3 17553 AEV_3_3_RA3_01_1233.d 4.52E5 2 2 212 217 Carbamidomethylation
R.GVS(+79.97)D(+43.99)VDSSTR.S Y 24.19 1145.4237 10 -36.1 1146.3896 1 112.71 1 59544 AEV 2_3_RA2_01_1224.d 0 1 1 507 516 Phosphorylation (STY); Carboxylation (DKW)
R.I(+226.08)IMAVGGNPTR.A Y 24.18 1353.6897 11 80.4 339.4569 4 20.69 2 6697 AEV_1_3_RA2_01_1232.d 4.45E4 1 1 445 455 Biotinylation
R.IPASFC(+57.02)GIYGLKPSHGR(+14.02).V Y 24.13 1872.9668 17 8.3 469.2529 4 69.42 2 32412 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 289 305 Carbamidomethylation; Methylation(KR)
K.ADIARAAAAASTER.Y Y 23.77 1372.7058 14 22.6 344.1915 4 41.60 2 16258 AEV_1_3_RA2_01_1232.d 3.79E5 1 1 156 169
R.I(+43.01)IMAVGGNPTR.A Y 23.74 1170.6179 11 6.3 391.2157 3 49.29 3 25276 AEV_3_3_RA3_01_1233.d 0 2 2 445 455 Carbamylation
R.ARDFLAAQKLR.N Y 23.68 1287.7411 11 -91.5 322.9131 4 69.23 1 33364 AEV 2_3_RA2_01_1224.d 6.55E4 1 1 456 466
R.A(+27.99)AAAASTER.Y Y 23.64 874.4144 9 32.2 438.2286 2 11.10 3 3065 AEV_3_3_RA3_01_1233.d 6.43E4 1 1 161 169 Formylation
R.TLGSK.L N 23.19 504.2907 5 4.0 505.3000 1 98.84 2 50635 AEV_1_3_RA2_01_1232.d 1.6E4 3 3 198 202
K.I(+42.01)LKGNADLAR(+14.02).G Y 22.83 1125.6505 10 -61.3 376.2011 3 46.55 2 18704 AEV_1_3_RA2_01_1232.d 8.85E4 1 1 497 506 Acetylation (N-term); Methylation(KR)
K.HSSLPS(-2.02)PSQR.R Y 22.80 1092.5312 10 3.8 365.1857 3 40.98 1 14984 AEV 2_3_RA2_01_1224.d 0 1 1 94 103 2-amino-3-oxo-butanoic_acid
K.RTLGSKLDFTGAEN(+.98)R.T Y 21.94 1664.8481 15 -13.2 417.2138 4 20.08 3 7870 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 197 211 Deamidation (NQ)
R.IIMAVGGNPT(+14.02)RAR.D Y 21.82 1368.7660 13 0.9 343.1991 4 59.63 3 32145 AEV_3_3_RA3_01_1233.d 0 1 1 445 457 Methylation(others)
K.GGLKAPDTTN(+.98)GGK(+14.02).W Y 21.78 1229.6251 13 -5.7 308.4118 4 25.13 3 10651 AEV_3_3_RA3_01_1233.d 9.86E4 1 1 588 600 Deamidation (NQ); Methylation(KR)
K.GPNVPFNYLPSSNPLIR.G Y 21.22 1883.9894 17 -0.4 943.0016 2 83.56 2 43292 AEV_1_3_RA2_01_1232.d 1.4E4 1 1 20 36
K.D(+27.99)EVDIEGY(+79.97)KR.T Y 21.21 1330.5442 10 8.1 666.2848 2 39.71 3 19227 AEV_3_3_RA3_01_1233.d 0 1 1 188 197 Formylation; Phosphorylation (STY)
R.TLGS(+79.97)K(+27.99).L N 21.09 612.2520 5 5.0 613.2623 1 88.26 1 48307 AEV 2_3_RA2_01_1224.d 7.8E4 1 1 198 202 Phosphorylation (STY); Formylation
R.A(+42.01)AAAAST(+79.97)ER.Y Y 21.07 968.3964 9 -26.4 485.1927 2 52.16 1 21456 AEV 2_3_RA2_01_1224.d 4E4 1 1 161 169 Acetylation (N-term); Phosphorylation (STY)
K.KWEEAGAVVIGK(-1.03).T Y 21.03 1284.6714 12 12.3 429.2364 3 62.19 3 34117 AEV_3_3_RA3_01_1233.d 6.89E4 1 1 218 229 Lysine oxidation to aminoadipic semialdehyde
R.IIM(-48.00)AVGGNPTR.A Y 20.78 1079.6088 11 -1.6 360.8763 3 32.66 3 14957 AEV_3_3_RA3_01_1233.d 1.28E6 2 2 445 455 Dethiomethyl
K.HS(-18.01)SLPSPSQRR.D Y 20.04 1232.6373 11 -85.7 309.1402 4 40.71 1 14828 AEV 2_3_RA2_01_1224.d 7.73E5 1 1 94 104 Dehydration
K.ADIAR.A N 19.94 544.2969 5 -29.7 545.2880 1 64.08 3 35558 AEV_3_3_RA3_01_1233.d 1.11E5 2 2 156 160
K.NGNPLGPLDGVPVAVK(+42.01).D Y 19.90 1587.8621 16 -90.8 318.5508 5 50.74 1 20622 AEV 2_3_RA2_01_1224.d 1.74E5 1 1 172 187 Acetylation (K)
M(+15.99)TGASETHR.R Y 19.67 1004.4346 9 43.4 503.2463 2 46.89 1 18408 AEV 2_3_RA2_01_1224.d 0 1 1 1 9 Oxidation (M)
R.KGPNVPFNYLPSSNPLIR(-.98).G Y 19.19 2011.1002 18 20.8 671.3879 3 80.18 2 40702 AEV_1_3_RA2_01_1232.d 8.93E4 1 1 19 36 Amidation
K.L(-15.01)DFTGAENR.T Y 18.57 1006.4719 9 56.9 504.2719 2 64.11 3 35601 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 203 211 ISD (z+2)-series
R.TLGS(-18.01)K.L N 18.54 486.2802 5 -49.3 487.2635 1 23.72 3 9823 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 198 202 Dehydration
K.LTPANR(+79.97).I Y 18.34 750.3425 6 -94.5 751.2789 1 81.12 1 42710 AEV 2_3_RA2_01_1224.d 0 1 1 439 444 Phosphorylation (HCDR)
R.T(+42.01)LGSK.L N 18.30 546.3013 5 -22.3 547.2964 1 12.02 3 3505 AEV_3_3_RA3_01_1233.d 2.8E3 1 1 198 202 Acetylation (N-term)
R.N(+.98)VPGLNDYQPR.Y Y 18.15 1272.6099 11 55.6 319.1774 4 34.42 3 16030 AEV_3_3_RA3_01_1233.d 0 1 1 68 78 Deamidation (NQ)
R.TLGS(+79.97)K(+14.02).L N 18.10 598.2727 5 5.8 599.2834 1 77.14 3 45810 AEV_3_3_RA3_01_1233.d 1.29E4 1 1 198 202 Phosphorylation (STY); Methylation(KR)
R.TLGSK(+14.96).L N 18.01 519.2540 5 17.1 520.2702 1 73.16 3 42714 AEV_3_3_RA3_01_1233.d 0 1 1 198 202 Alpha-amino adipic acid
R.TLGSKLDFTGAENRT(+87.05)AWC(+57.02)VK.K Y 17.98 2340.1719 20 17.2 469.0497 5 12.62 3 3820 AEV_3_3_RA3_01_1233.d 1.38E4 1 1 198 217 Phosphorylation to amine thiol; Carbamidomethylation
K.LDFTGAENR(+14.02).T Y 17.92 1035.4985 9 -71.9 346.1486 3 22.04 1 5399 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 203 211 Methylation(KR)
K.GGLK(+31.99)APDTTNGGK.W Y 17.77 1246.6154 13 -12.8 312.6571 4 16.71 3 6051 AEV_3_3_RA3_01_1233.d 0 1 1 588 600 Dihydroxy
R.I(+27.99)IMAVGGNPTR.A Y 17.44 1155.6071 11 53.4 1156.6760 1 101.20 3 59462 AEV_3_3_RA3_01_1233.d 0 1 1 445 455 Formylation
R.IIMAVGGNPTR(+14.02)AR.D Y 17.36 1368.7660 13 2.0 343.1995 4 60.73 3 32969 AEV_3_3_RA3_01_1233.d 0 1 1 445 457 Methylation(KR)
K.D(+42.01)EVDIEGYK(+14.02).R Y 17.26 1122.5081 9 -22.2 375.1683 3 43.72 1 16534 AEV 2_3_RA2_01_1224.d 7.66E4 1 1 188 196 Acetylation (N-term); Methylation(KR)
R.IPASFC(+57.02)GIY(-18.01)GLK(+14.02)PSHGR.V Y 17.19 1854.9563 17 5.8 464.7490 4 68.31 3 38906 AEV_3_3_RA3_01_1233.d 0 1 1 289 305 Carbamidomethylation; Dehydration; Methylation(KR)
M(+42.01)TGASETHR(+14.02).R Y 17.14 1044.4658 9 -22.1 523.2286 2 70.61 1 34428 AEV 2_3_RA2_01_1224.d 1.03E5 1 1 1 9 Acetylation (Protein N-term); Methylation(KR)
R.TLGSK(-.98).L N 16.97 503.3067 5 -191.9 504.2174 1 56.24 1 23981 AEV 2_3_RA2_01_1224.d 1.8E5 1 1 198 202 Amidation
K.APDTTNGGKWVDVIGK.V Y 16.93 1656.8470 16 -84.3 553.2430 3 74.97 1 37850 AEV 2_3_RA2_01_1224.d 1.81E5 1 1 592 607
R.IIMAVGGNP(-30.01)TR.A Y 16.64 1097.6016 11 -9.3 366.8711 3 34.21 3 15851 AEV_3_3_RA3_01_1233.d 0 1 1 445 455 Proline oxidation to pyrrolidinone
R.NVPGLNDYQ(+.98)PR.Y Y 16.59 1272.6099 11 7.3 637.3168 2 65.96 2 29944 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 68 78 Deamidation (NQ)
MTGASETHR.R Y 16.59 988.4396 9 -69.6 330.4642 3 24.00 1 6124 AEV 2_3_RA2_01_1224.d 6.53E4 1 1 1 9
R.T(+79.97)LGSK(+21.98).L N 16.46 606.2390 5 35.8 304.1376 2 33.88 1 11158 AEV 2_3_RA2_01_1224.d 7.18E5 1 1 198 202 Phosphorylation (STY); Sodium adduct
R.TLGS(+79.97)K.L N 16.31 584.2571 5 -52.7 585.2336 1 28.70 1 8311 AEV 2_3_RA2_01_1224.d 3.37E3 1 1 198 202 Phosphorylation (STY)
R.AAAAAST(+79.97)ER.Y Y 16.21 926.3859 9 -45.8 464.1790 2 29.94 1 8937 AEV 2_3_RA2_01_1224.d 2.03E5 1 1 161 169 Phosphorylation (STY)
K.HSSLPSPS(+79.97)Q(+.98)RR.D Y 16.18 1331.5983 11 -23.2 333.8991 4 41.26 1 15145 AEV 2_3_RA2_01_1224.d 2.69E5 1 1 94 104 Phosphorylation (STY); Deamidation (NQ)
K.D(+42.01)EVDIEGYK(+43.99).R Y 16.14 1152.4822 9 20.9 385.1760 3 51.57 1 21084 AEV 2_3_RA2_01_1224.d 0 1 1 188 196 Acetylation (N-term); Carboxylation (DKW)
R.VLEIAASVLPYFGFIQ(+.98)SALWR.I Y 16.06 2380.2830 21 -25.4 596.0629 4 86.16 2 45086 AEV_1_3_RA2_01_1232.d 1.23E4 1 1 39 59 Deamidation (NQ)
R.I(+42.01)IMAVGGN(+.98)PTR.A Y 16.03 1170.6067 11 -102.0 586.2509 2 84.13 1 45089 AEV 2_3_RA2_01_1224.d 4.14E5 1 1 445 455 Acetylation (N-term); Deamidation (NQ)
K.HSSLPSPSQR(+14.02).R Y 16.03 1108.5625 10 7.6 555.2927 2 77.05 2 38219 AEV_1_3_RA2_01_1232.d 8.07E4 1 1 94 103 Methylation(KR)
R.A(+42.01)AAAASTE(+43.99)R.Y Y 15.97 932.4199 9 -79.9 467.1800 2 42.09 1 15631 AEV 2_3_RA2_01_1224.d 1.02E5 1 1 161 169 Acetylation (N-term); Carboxylation (E)
K.AHALTILAEIESHLSLDQISKLTPANR.I Y 15.93 2940.6033 27 18.7 589.1389 5 88.56 2 46493 AEV_1_3_RA2_01_1232.d 2.19E4 1 1 418 444
K.ADIARAAAAAST(+79.97)ER.Y Y 15.91 1452.6721 14 3.3 364.1765 4 62.39 1 28303 AEV 2_3_RA2_01_1224.d 0 1 1 156 169 Phosphorylation (STY)
K.HSSLPSPSQ(+.98)R.R Y 15.89 1095.5309 10 11.9 366.1886 3 55.03 1 23193 AEV 2_3_RA2_01_1224.d 0 1 1 94 103 Deamidation (NQ)
R.T(+79.96)LGS(+79.97)K.L N 15.86 664.2139 5 110.5 665.2946 1 92.78 1 51611 AEV 2_3_RA2_01_1224.d 0 1 1 198 202 Sulfation; Phosphorylation (STY)
R.TLGS(+79.97)KLDFTGAEN(+.98)R.T Y 15.41 1588.7134 14 -3.8 398.1841 4 67.80 1 32277 AEV 2_3_RA2_01_1224.d 0 1 1 198 211 Phosphorylation (STY); Deamidation (NQ)
R.DGEGM(+15.99)LGF(+31.99)DAAATDTSTAATPK.G Y 15.36 2173.9321 22 44.9 725.6838 3 65.43 3 36618 AEV_3_3_RA3_01_1233.d 6.07E4 1 1 566 587 Oxidation (M); Dihydroxy
K.HSSLPS(+79.97)PSQR(+14.02).R Y 15.28 1188.5288 10 -10.0 397.1796 3 47.51 1 18800 AEV 2_3_RA2_01_1224.d 0 1 1 94 103 Phosphorylation (STY); Methylation(KR)
R.IIM(+31.99)AVGGNPTR.A Y 15.18 1159.6019 11 22.3 387.5499 3 45.21 3 22690 AEV_3_3_RA3_01_1233.d 0 1 1 445 455 Sulphone
R.D(+43.01)FLAAQK.L Y 15.04 834.4235 7 -4.6 418.2171 2 39.17 2 15066 AEV_1_3_RA2_01_1232.d 2.64E5 1 1 458 464 Carbamylation
total 170 peptides
C1GEN5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.NIPGVETSSVFSLNLLQLAPGGHLGR.F Y 169.03 2675.4395 26 5.4 669.8707 4 89.03 2 46748 AEV_1_3_RA2_01_1232.d 1.31E6 4 4 228 253
R.GPLVVYNPDVDGKDLVK.A Y 161.01 1826.9778 17 4.4 610.0026 3 74.14 2 35996 AEV_1_3_RA2_01_1232.d 4.41E6 5 5 208 224
R.FIVWTSSAFAALDAIYGSTTTPSALK.K Y 143.22 2717.3953 26 1.9 1359.7075 2 95.09 2 49369 AEV_1_3_RA2_01_1232.d 1.09E5 2 2 254 279
R.RGPLVVYNPDVDGKDLVK.A Y 142.79 1983.0789 18 1.9 496.7779 4 69.95 2 32900 AEV_1_3_RA2_01_1232.d 4.54E6 9 9 207 224
K.DFLLPSNLVSNADITR.L Y 134.44 1773.9260 16 2.0 592.3171 3 85.59 2 44733 AEV_1_3_RA2_01_1232.d 8E6 20 20 281 296
R.FATASALAASSVPALLFAR.G Y 133.87 1863.0254 19 2.4 622.0172 3 88.31 2 46370 AEV_1_3_RA2_01_1232.d 5.06E6 11 11 121 139
R.FIVWTSSAFAALDAIYGSTTTPSALKK.D Y 127.65 2845.4902 27 -1.4 949.5027 3 90.90 3 55211 AEV_3_3_RA3_01_1233.d 2.94E5 3 3 254 280
K.NVGAGPDLVKVEESR.K Y 119.48 1568.8158 15 0.9 785.4159 2 62.91 2 27850 AEV_1_3_RA2_01_1232.d 4E6 7 7 175 189
R.VASVPEVPLVVDSK.A Y 109.71 1437.8079 14 0.2 719.9113 2 76.62 2 37928 AEV_1_3_RA2_01_1232.d 4.41E6 5 5 143 156
R.GPLVVYNPDVDGK.D Y 109.01 1371.7034 13 -10.4 686.8518 2 69.12 3 39588 AEV_3_3_RA3_01_1233.d 4.86E5 3 3 208 220
K.NKRQPYAVSEKAGEQTSAESWGTGR.A Y 108.82 2736.3215 25 2.1 548.2727 5 53.00 3 27704 AEV_3_3_RA3_01_1233.d 7.97E5 3 3 46 70
R.LINSSEVQSALREPK.G Y 108.51 1669.8999 15 4.7 557.6432 3 67.04 2 30683 AEV_1_3_RA2_01_1232.d 7.93E6 10 10 297 311
K.RFATASALAASSVPALLFAR.G Y 108.50 2019.1265 20 0.9 674.0500 3 84.41 3 51307 AEV_3_3_RA3_01_1233.d 3.05E5 4 4 120 139
R.RGPLVVYNPDVDGK.D Y 105.80 1527.8044 14 3.2 510.2771 3 64.44 2 28858 AEV_1_3_RA2_01_1232.d 9.43E5 4 4 207 220
R.AGQAAFGNQC(+57.02)R.A Y 105.60 1178.5250 11 5.5 590.2730 2 27.15 2 9431 AEV_1_3_RA2_01_1232.d 2.93E6 20 20 86 96 Carbamidomethylation
K.AGEQTSAESWGTGR.A Y 103.88 1435.6328 14 3.6 718.8263 2 46.22 2 18546 AEV_1_3_RA2_01_1232.d 2.51E6 8 8 57 70
R.VASVPEVPLVVDSKAFENNAIVK.T Y 100.50 2424.3264 23 -1.2 809.1151 3 81.76 3 49415 AEV_3_3_RA3_01_1233.d 7.49E5 3 3 143 165
R.Q(-17.03)PYAVSEKAGEQTSAESWGTGR.A Y 95.34 2321.0559 22 -2.3 1161.5326 2 70.67 3 40756 AEV_3_3_RA3_01_1233.d 9.78E4 1 1 49 70 Pyro-glu from Q
R.QPYAVSEKAGEQTSAESWGTGR.A Y 94.68 2338.0825 22 -0.5 780.3677 3 62.06 3 34013 AEV_3_3_RA3_01_1233.d 6.02E4 1 1 49 70
K.NVGAGPDLVKVEESRK.I Y 94.15 1696.9108 16 0.6 566.6445 3 56.10 3 29596 AEV_3_3_RA3_01_1233.d 2.07E6 6 6 175 190
K.DFLLPSNLVSN(+.98)ADITR.L Y 91.60 1774.9100 16 2.7 888.4647 2 86.86 2 45530 AEV_1_3_RA2_01_1232.d 9.54E5 6 6 281 296 Deamidation (NQ)
K.DFLLPSNLVSNADITR(+14.02).L Y 91.59 1787.9418 16 1.6 894.9796 2 86.40 2 45257 AEV_1_3_RA2_01_1232.d 1.22E6 6 6 281 296 Methylation(KR)
R.VASVPEVPLVVDSKAFENNAIVKTK.A Y 89.87 2653.4690 25 -14.6 664.3649 4 79.34 3 47614 AEV_3_3_RA3_01_1233.d 1.29E5 1 1 143 167
R.LINSSEVQSALR.E Y 88.87 1315.7096 12 0.2 658.8622 2 67.29 3 38078 AEV_3_3_RA3_01_1233.d 5.06E5 3 3 297 308
K.AFENNAIVK.T Y 87.72 1004.5291 9 2.8 503.2732 2 51.02 2 20960 AEV_1_3_RA2_01_1232.d 5.85E6 11 11 157 165
K.AFENNAIVKTK.A Y 87.57 1233.6718 11 -1.8 617.8420 2 41.19 3 20122 AEV_3_3_RA3_01_1233.d 5.4E5 3 3 157 167
K.AAIALLKNVGAGPDLVKVEESR.K Y 87.46 2249.2742 22 -1.7 563.3249 4 77.75 2 38774 AEV_1_3_RA2_01_1232.d 0 1 1 168 189
R.GPLVVYNPDVDGKDLVKAFR.N Y 87.04 2201.1843 20 -3.9 551.3012 4 79.10 2 39845 AEV_1_3_RA2_01_1232.d 2.44E5 3 3 208 227
R.LINSSEVQSALR(+14.02)EPK.G Y 86.66 1683.9155 15 -1.2 842.9640 2 69.88 3 40139 AEV_3_3_RA3_01_1233.d 2.57E6 6 6 297 311 Methylation(KR)
R.RGPLVVYNPDVDGK(+14.02)DLVK.A Y 85.56 1997.0945 18 -3.9 500.2789 4 69.79 3 40070 AEV_3_3_RA3_01_1233.d 6.31E5 4 4 207 224 Methylation(KR)
K.NKRQPYAVSEK.A Y 85.36 1318.6993 11 1.5 440.5744 3 15.24 3 5252 AEV_3_3_RA3_01_1233.d 7.47E5 3 3 46 56
K.AGEQTSAESWGTGR(+14.02).A Y 82.57 1449.6484 14 0.6 725.8319 2 51.32 3 26616 AEV_3_3_RA3_01_1233.d 3.68E5 3 3 57 70 Methylation(KR)
R.AGQAAFGN(+.98)QC(+57.02)R.A Y 82.45 1179.5090 11 1.4 590.7626 2 29.44 3 13064 AEV_3_3_RA3_01_1233.d 3E6 10 10 86 96 Deamidation (NQ); Carbamidomethylation
K.AGEQTSAESW(+31.99)GTGR.A Y 81.86 1467.6226 14 1.6 734.8198 2 25.51 3 10852 AEV_3_3_RA3_01_1233.d 2.12E5 4 4 57 70 Dihydroxy
R.GPLVVYNPDVDGKDLVK(+14.02).A Y 81.58 1840.9934 17 -4.0 614.6693 3 75.93 3 44862 AEV_3_3_RA3_01_1233.d 3.58E5 2 2 208 224 Methylation(KR)
R.LNPYAAAFSK.Q Y 81.15 1080.5603 10 5.2 541.2902 2 67.27 2 30893 AEV_1_3_RA2_01_1232.d 3.71E6 6 6 336 345
K.NVGAGPDLVKVEESR(+14.02).K Y 81.00 1582.8314 15 -4.4 528.6154 3 64.67 3 36060 AEV_3_3_RA3_01_1233.d 1.37E6 9 9 175 189 Methylation(KR)
R.GHRVASVPEVPLVVDSK.A Y 80.29 1787.9894 17 -37.6 447.9878 4 66.49 3 37449 AEV_3_3_RA3_01_1233.d 1.31E5 2 2 140 156
K.AAIALLKNVGAGPDLVK.V Y 79.52 1648.9875 17 -14.2 550.6620 3 77.42 2 38510 AEV_1_3_RA2_01_1232.d 0 1 1 168 184
R.LIN(+.98)SSEVQSALREPK.G Y 78.55 1670.8839 15 2.6 557.9700 3 69.06 3 39506 AEV_3_3_RA3_01_1233.d 6.83E5 1 1 297 311 Deamidation (NQ)
K.DFLLPSN(+.98)LVSNADITR.L Y 78.20 1774.9100 16 12.1 888.4730 2 85.65 2 44753 AEV_1_3_RA2_01_1232.d 5.83E5 4 4 281 296 Deamidation (NQ)
R.LINSSEVQSALREPKGYAK.T Y 77.98 2089.1167 19 -4.0 523.2844 4 65.84 3 36942 AEV_3_3_RA3_01_1233.d 4.87E5 2 2 297 315
R.GPLVVYNPDVDGK(+14.02)DLVK.A Y 77.89 1840.9934 17 -3.8 614.6694 3 75.05 2 36651 AEV_1_3_RA2_01_1232.d 3.3E4 1 1 208 224 Methylation(KR)
R.FATASALAASSVPALLFAR(+14.02).G Y 77.07 1877.0410 19 -0.4 626.6874 3 89.06 3 54203 AEV_3_3_RA3_01_1233.d 4.15E5 3 3 121 139 Methylation(KR)
K.AGEQTSAESW(+15.99)GTGR.A Y 76.69 1451.6277 14 -2.0 726.8196 2 39.52 3 19105 AEV_3_3_RA3_01_1233.d 5.89E5 8 8 57 70 Oxidation (HW)
R.AGQAAFGNQ(+.98)C(+57.02)R.A Y 75.89 1179.5090 11 5.5 590.7650 2 30.12 2 10781 AEV_1_3_RA2_01_1232.d 1.23E6 6 6 86 96 Deamidation (NQ); Carbamidomethylation
R.AGQAAFGNQC(+57.02)R(+14.02).A Y 75.65 1192.5408 11 1.9 597.2788 2 34.25 3 15902 AEV_3_3_RA3_01_1233.d 1.16E6 7 7 86 96 Carbamidomethylation; Methylation(KR)
K.NVGAGPDLVK.V Y 75.51 968.5291 10 2.2 485.2729 2 51.03 2 20965 AEV_1_3_RA2_01_1232.d 2.69E6 7 7 175 184
R.VASVPEVPLVVDSK(+14.02).A Y 74.92 1451.8235 14 -1.8 726.9177 2 77.11 3 45784 AEV_3_3_RA3_01_1233.d 1.01E6 4 4 143 156 Methylation(KR)
K.AGEQ(+.98)TSAESWGTGR.A Y 73.69 1436.6168 14 4.1 719.3186 2 48.98 3 25065 AEV_3_3_RA3_01_1233.d 3.26E5 4 4 57 70 Deamidation (NQ)
R.LINSSEVQ(+.98)SALREPK.G Y 73.04 1670.8839 15 6.9 557.9724 3 69.86 2 32745 AEV_1_3_RA2_01_1232.d 1.1E6 3 3 297 311 Deamidation (NQ)
R.NIPGVE(+14.02)TSSVFSLNLLQLAPGGHLGR.F Y 69.76 2689.4551 26 1.5 673.3721 4 89.58 3 54498 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 228 253 Methylation(others)
K.AGE(+14.02)QTSAESWGTGR.A Y 69.63 1449.6484 14 0.9 725.8322 2 53.65 3 28167 AEV_3_3_RA3_01_1233.d 4.26E5 5 5 57 70 Methylation(others)
R.AGQ(+.98)AAFGNQC(+57.02)R.A Y 67.96 1179.5090 11 2.4 590.7632 2 30.63 3 13759 AEV_3_3_RA3_01_1233.d 1.21E6 6 6 86 96 Deamidation (NQ); Carbamidomethylation
K.TKAAIALLK.N Y 67.66 927.6117 9 -4.6 464.8110 2 51.10 3 26444 AEV_3_3_RA3_01_1233.d 1.04E6 4 4 166 174
R.Q(-17.03)RRGPLVVYNPDVDGKDLVK.A Y 66.70 2250.2119 20 1.7 563.5612 4 70.13 3 40323 AEV_3_3_RA3_01_1233.d 1.99E5 1 1 205 224 Pyro-glu from Q
R.LINSSE(+14.02)VQSALREPK.G Y 66.50 1683.9155 15 -4.2 562.3101 3 69.00 3 39485 AEV_3_3_RA3_01_1233.d 9.54E5 1 1 297 311 Methylation(others)
K.NVGAGPDLVKVE(+14.02)ESR.K Y 65.75 1582.8314 15 5.0 528.6204 3 68.99 2 32092 AEV_1_3_RA2_01_1232.d 3.19E5 1 1 175 189 Methylation(others)
R.AGQ(+.98)AAFGNQ(+.98)C(+57.02)R.A Y 64.03 1180.4930 11 6.4 591.2576 2 33.71 3 15600 AEV_3_3_RA3_01_1233.d 3.27E5 4 4 86 96 Deamidation (NQ); Carbamidomethylation
K.GLDTGKPDR.A Y 63.35 957.4879 9 1.9 479.7522 2 14.82 3 5044 AEV_3_3_RA3_01_1233.d 2.05E6 6 6 352 360
K.AGEQTSAE(+14.02)SWGTGR.A Y 63.04 1449.6484 14 0.1 725.8315 2 55.64 3 29312 AEV_3_3_RA3_01_1233.d 3.71E5 4 4 57 70 Methylation(others)
R.NIPGVET(+14.02)SSVFSLNLLQLAPGGHLGR.F Y 62.77 2689.4551 26 1.0 673.3717 4 89.86 2 47159 AEV_1_3_RA2_01_1232.d 7.31E4 1 1 228 253 Methylation(others)
K.N(+.98)VGAGPDLVKVEESR(+14.02).K Y 62.54 1583.8154 15 20.9 528.9568 3 66.44 2 30265 AEV_1_3_RA2_01_1232.d 1.37E5 2 2 175 189 Deamidation (NQ); Methylation(KR)
R.RGPLVVYNPD(+14.02)VDGKDLVK.A Y 62.38 1997.0945 18 4.1 500.2829 4 70.61 3 40701 AEV_3_3_RA3_01_1233.d 3.92E5 2 2 207 224 Methylation(others)
R.LNPYAAAFSK(+14.02).Q Y 62.02 1094.5760 10 -4.9 548.2926 2 69.48 3 39908 AEV_3_3_RA3_01_1233.d 4.45E5 2 2 336 345 Methylation(KR)
R.NIPGVETSSVFSLNLLQLAPGGHLGR(+14.02).F Y 61.16 2689.4551 26 -9.6 673.3646 4 88.16 3 53681 AEV_3_3_RA3_01_1233.d 5.8E4 2 2 228 253 Methylation(KR)
K.NVGAGPD(+14.02)LVKVEESR.K Y 60.04 1582.8314 15 -5.0 528.6151 3 62.77 3 34553 AEV_3_3_RA3_01_1233.d 1.64E5 1 1 175 189 Methylation(others)
R.LINSSEVQSALREPK(+14.02).G Y 59.48 1683.9155 15 0.9 842.9658 2 69.42 2 32413 AEV_1_3_RA2_01_1232.d 5.09E4 1 1 297 311 Methylation(KR)
R.LINSSEVQSALR(+28.03)EPK.G Y 57.14 1697.9312 15 4.2 566.9867 3 72.08 3 41857 AEV_3_3_RA3_01_1233.d 2.01E5 1 1 297 311 Dimethylation(KR)
R.GPLVVY(-2.02)NPDVDGKDLVK.A Y 57.02 1824.9622 17 -30.1 609.3097 3 74.22 2 36080 AEV_1_3_RA2_01_1232.d 3.63E4 1 1 208 224 2-amino-3-oxo-butanoic_acid
K.AAIALLKNVGAGPDLVKVEESRK.I Y 56.67 2377.3691 23 -3.1 476.4796 5 74.30 3 43589 AEV_3_3_RA3_01_1233.d 1.49E5 1 1 168 190
R.MFAPTKVWR.K Y 56.37 1134.6008 9 -1.1 379.2072 3 65.37 3 36567 AEV_3_3_RA3_01_1233.d 4.26E5 3 3 100 108
K.ILAQE Y 56.07 572.3170 5 -113.5 573.2593 1 37.13 1 12787 AEV 2_3_RA2_01_1224.d 8.83E4 6 6 368 372
R.AGQ(+.98)AAFGNQC(+57.02)R(+14.02).A Y 54.77 1193.5248 11 3.7 597.7719 2 39.19 3 18960 AEV_3_3_RA3_01_1233.d 9.81E4 1 1 86 96 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
K.RQPYAVSEK.A Y 53.64 1076.5614 9 -1.4 539.2872 2 19.09 3 7457 AEV_3_3_RA3_01_1233.d 9.16E5 8 8 48 56
R.LN(+.98)PYAAAFSK.Q Y 51.71 1081.5443 10 2.9 541.7810 2 68.23 3 38836 AEV_3_3_RA3_01_1233.d 1.87E5 1 1 336 345 Deamidation (NQ)
R.TGVQKKNPLK.N Y 51.62 1111.6713 10 -4.7 371.5626 3 14.73 3 4961 AEV_3_3_RA3_01_1233.d 2.44E5 3 3 319 328
R.NIPGVETSSVFSLNLLQ(+.98)LAPGGHLGR.F Y 51.15 2676.4233 26 7.6 893.1552 3 89.39 3 54371 AEV_3_3_RA3_01_1233.d 9.42E4 2 2 228 253 Deamidation (NQ)
R.NIPGVETSSVFSLNLLQLAPGGHLGRFIVWTSSAFAALDAIYGSTTTPSALKK.D Y 49.62 5502.9189 53 5.2 1101.5968 5 97.51 3 58202 AEV_3_3_RA3_01_1233.d 5.56E4 1 1 228 280
R.M(+15.99)FAPTKVWR.K Y 49.18 1150.5957 9 0.3 384.5393 3 60.73 3 32970 AEV_3_3_RA3_01_1233.d 4.03E5 2 2 100 108 Oxidation (M)
R.AGQAAFGNQ(+.98)C(+57.02)R(+14.02).A Y 49.11 1193.5248 11 2.5 597.7712 2 37.55 3 17929 AEV_3_3_RA3_01_1233.d 2.18E5 4 4 86 96 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
R.N(+15.00)IPGVETSSVFSLNLLQLAPGGHLGR.F Y 48.64 2690.4392 26 12.1 897.8312 3 89.61 3 54507 AEV_3_3_RA3_01_1233.d 4.66E4 1 1 228 253 Deamidation followed by a methylation
K.TKAAIALLKNVGAGPDLVKVEESR.K Y 46.85 2478.4170 24 60.1 496.7205 5 75.32 3 44382 AEV_3_3_RA3_01_1233.d 0 1 1 166 189
R.QRRGPLVVYNPDVDGKDLVK.A Y 46.50 2267.2385 20 -6.3 454.4521 5 65.77 3 36886 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 205 224
R.VAS(-2.02)VPEVPLVVDSKAFENNAIVK.T Y 46.47 2422.3108 23 -46.9 808.4063 3 82.12 2 42223 AEV_1_3_RA2_01_1232.d 0 1 1 143 165 2-amino-3-oxo-butanoic_acid
R.FIVWT(-2.02)SSAFAALDAIYGSTTTPSALKK.D Y 45.23 2843.4744 27 -9.8 948.8228 3 91.15 2 47782 AEV_1_3_RA2_01_1232.d 1.33E5 1 1 254 280 2-amino-3-oxo-butanoic_acid
K.AGEQTSAESW(+13.98)GTGR.A Y 45.04 1449.6121 14 -63.9 725.7670 2 61.69 1 27754 AEV 2_3_RA2_01_1224.d 8.54E4 1 1 57 70 Tryptophan oxidation to oxolactone
K.AFE(+14.02)NNAIVK.T Y 44.18 1018.5447 9 2.7 510.2810 2 60.42 2 26150 AEV_1_3_RA2_01_1232.d 5.78E5 2 2 157 165 Methylation(others)
R.AGQAAFGN(+.98)Q(+.98)C(+57.02)R.A Y 43.37 1180.4930 11 4.1 591.2562 2 35.11 3 16400 AEV_3_3_RA3_01_1233.d 1.5E5 3 3 86 96 Deamidation (NQ); Carbamidomethylation
K.AFEN(+.98)NAIVKTK.A Y 43.36 1234.6558 11 14.9 412.5653 3 41.20 3 20134 AEV_3_3_RA3_01_1233.d 9.97E4 1 1 157 167 Deamidation (NQ)
R.LINSSEVQ(+.98)SALR(+14.02)EPK.G Y 43.19 1684.8995 15 -9.7 562.6350 3 72.55 3 42231 AEV_3_3_RA3_01_1233.d 9.9E4 1 1 297 311 Deamidation (NQ); Methylation(KR)
M.A(+42.01)SRPTVTIANAEGKPSGETHPLPAVFTSPIRPDIVQSVHTGIAK(-.98).N Y 42.55 4587.4561 44 4.7 918.5028 5 79.18 2 39906 AEV_1_3_RA2_01_1232.d 0 1 1 2 45 Acetylation (Protein N-term); Amidation
R.QPYAVSEK.A Y 42.05 920.4603 8 -73.8 461.2035 2 35.46 1 11914 AEV 2_3_RA2_01_1224.d 2.13E5 6 6 49 56
K.K(+14.02)D(-18.01)FLLPSNLVSNADITR.L Y 41.76 1898.0261 17 -29.2 633.6642 3 79.66 2 40293 AEV_1_3_RA2_01_1232.d 7.27E4 1 1 280 296 Methylation(KR); Dehydration
K.NVGAGPDLVKVEESR(+28.03).K Y 40.41 1596.8470 15 -6.0 533.2864 3 71.09 3 41079 AEV_3_3_RA3_01_1233.d 0 1 1 175 189 Dimethylation(KR)
K.AFENN(+.98)AIVK.T Y 40.37 1005.5131 9 4.1 503.7659 2 54.03 3 28374 AEV_3_3_RA3_01_1233.d 4.13E5 2 2 157 165 Deamidation (NQ)
R.MFAPTKVWRK.W Y 40.14 1262.6958 10 3.1 316.6822 4 57.92 3 30896 AEV_3_3_RA3_01_1233.d 5.9E4 1 1 100 109
R.AGETFHK.I Y 40.13 788.3817 7 -85.7 395.1643 2 23.44 1 5903 AEV 2_3_RA2_01_1224.d 3.88E5 5 5 361 367
K.DFLLPSNLVSN(+.98)AD(-18.01)ITR.L Y 38.64 1756.8995 16 0.8 879.4577 2 87.27 3 53166 AEV_3_3_RA3_01_1233.d 2.34E5 1 1 281 296 Deamidation (NQ); Dehydration
K.D(+14.02)FLLPSNLVSNADITR.L Y 38.22 1787.9418 16 1.8 894.9798 2 85.22 2 44463 AEV_1_3_RA2_01_1232.d 1.04E5 2 2 281 296 Methylation(others)
K.NKRQPYAVSEK(+14.02).A Y 37.72 1332.7150 11 -34.8 667.3416 2 21.39 3 8589 AEV_3_3_RA3_01_1233.d 8.05E4 4 4 46 56 Methylation(KR)
R.RGPLVVYNPDVDGKD(-18.01)LVK.A Y 37.63 1965.0682 18 5.4 492.2770 4 69.22 2 32266 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 207 224 Dehydration
K.DFLLPSNLVSN(-17.03)ADITR.L Y 37.59 1756.8995 16 0.7 879.4576 2 87.38 2 45842 AEV_1_3_RA2_01_1232.d 1.47E5 1 1 281 296 Ammonia-loss (N)
K.AAIALLK.N Y 36.76 698.4690 7 -3.8 350.2404 2 62.72 2 27722 AEV_1_3_RA2_01_1232.d 4.22E6 9 9 168 174
R.AGETFHKILAQE Y 36.49 1342.6881 12 -9.1 672.3452 2 61.24 3 33377 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 361 372
R.RGPLVVYNPDVDGKDLVKAFR.N Y 36.31 2357.2854 21 -21.4 590.3160 4 75.91 3 44847 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 207 227
K.INLGQKR.F Y 36.31 827.4977 7 -0.9 414.7557 2 17.58 3 6554 AEV_3_3_RA3_01_1233.d 7.09E5 3 3 114 120
R.AGQ(+.98)AAFGN(+.98)QC(+57.02)R.A Y 35.77 1180.4930 11 16.9 591.2638 2 31.42 3 14214 AEV_3_3_RA3_01_1233.d 2.06E5 2 2 86 96 Deamidation (NQ); Carbamidomethylation
K.ILAQ(+.98)E Y 35.58 573.3010 5 -119.0 574.2400 1 42.71 1 15981 AEV 2_3_RA2_01_1224.d 0 1 1 368 372 Deamidation (NQ)
R.VASVPE(+14.02)VPLVVDSKAFENNAIVK.T Y 34.97 2438.3420 23 -0.1 813.7878 3 82.73 3 50114 AEV_3_3_RA3_01_1233.d 2.19E4 1 1 143 165 Methylation(others)
R.M(+15.99)FAPTK.V Y 34.58 709.3469 6 -88.3 355.6494 2 38.69 1 13649 AEV 2_3_RA2_01_1224.d 2.86E5 3 3 100 105 Oxidation (M)
R.VASVPEVPLVVDSKAFENNAIVK(+14.02).T Y 34.40 2438.3420 23 -0.7 813.7874 3 83.14 3 50403 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 143 165 Methylation(KR)
K.RQPYAVSEK(-1.03)AGEQTSAESWGTGR.A Y 34.24 2493.1521 23 22.7 624.3094 4 58.59 3 31359 AEV_3_3_RA3_01_1233.d 0 2 2 48 70 Lysine oxidation to aminoadipic semialdehyde
K.NPLKNR.Q Y 34.03 740.4293 6 -13.4 371.2170 2 11.11 3 3069 AEV_3_3_RA3_01_1233.d 1.5E5 3 3 325 330
R.G(+58.01)PLVVYNPDVDGKDLVK.A Y 33.42 1884.9833 17 -5.8 629.3314 3 74.12 3 43497 AEV_3_3_RA3_01_1233.d 2.22E5 1 1 208 224 Carboxymethyl (KW, X@N-term)
R.GPLVVYNPD(+14.02)VDGKDLVK.A Y 33.31 1840.9934 17 -3.0 614.6699 3 76.01 2 37405 AEV_1_3_RA2_01_1232.d 1.83E5 2 2 208 224 Methylation(others)
K.A(+27.99)GEQTSAESWGTGRAVAR.I Y 32.87 1860.8715 18 -40.6 621.2726 3 94.18 1 52595 AEV 2_3_RA2_01_1224.d 5.69E4 1 1 57 74 Formylation
R.NIPGVETSSVFSLN(+.98)LLQLAPGGHLGR.F Y 32.64 2676.4233 26 3.4 670.1154 4 90.92 3 55227 AEV_3_3_RA3_01_1233.d 5.94E4 1 1 228 253 Deamidation (NQ)
R.TGVQKKNPLKNR.Q Y 32.51 1381.8153 12 -30.4 346.4506 4 15.59 3 5452 AEV_3_3_RA3_01_1233.d 0 1 1 319 330
R.LIN(+.98)SSEVQSALREPK(+14.02).G Y 31.96 1684.8995 15 -21.1 843.4393 2 70.55 2 33264 AEV_1_3_RA2_01_1232.d 0 1 1 297 311 Deamidation (NQ); Methylation(KR)
R.G(+164.06)PLVVYNPDVDGKDLVK.A Y 31.75 1991.0380 17 -25.1 498.7543 4 69.14 3 39564 AEV_3_3_RA3_01_1233.d 1.53E5 1 1 208 224 O-Diisopropylphosphorylation
K.NKRQPYAVSEK(-1.03)AGEQTSAESWGTGR.A Y 31.32 2735.2898 25 35.0 684.8536 4 53.48 3 28033 AEV_3_3_RA3_01_1233.d 0 1 1 46 70 Lysine oxidation to aminoadipic semialdehyde
K.A(+42.01)GEQ(+.98)TSAESWGT(+79.97)GR.A Y 30.94 1558.5936 14 28.3 780.3262 2 81.64 1 43116 AEV 2_3_RA2_01_1224.d 1.17E5 1 1 57 70 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
K.AAIALLK(-.98).N Y 30.83 697.4850 7 -44.9 698.4609 1 110.42 1 58889 AEV 2_3_RA2_01_1224.d 5.06E5 5 5 168 174 Amidation
K.AFEN(+.98)NAIVK.T Y 30.77 1005.5131 9 4.0 503.7658 2 53.62 3 28124 AEV_3_3_RA3_01_1233.d 6.28E5 2 2 157 165 Deamidation (NQ)
K.INLGQK.R Y 30.58 671.3966 6 -1.4 672.4030 1 23.17 3 9550 AEV_3_3_RA3_01_1233.d 1.1E6 6 6 114 119
R.VSGGGTHR.A Y 29.87 769.3831 8 -107.0 385.6577 2 74.92 1 37811 AEV 2_3_RA2_01_1224.d 3.45E4 2 2 78 85
K.N(+.98)VGAGPD(+21.98)LVK.V Y 28.54 991.4950 10 24.0 496.7667 2 33.91 2 12550 AEV_1_3_RA2_01_1232.d 9.13E4 1 1 175 184 Deamidation (NQ); Sodium adduct
K.GLD(+43.99)TGKPDR.A Y 28.33 1001.4778 9 -53.1 334.8155 3 27.88 1 7883 AEV 2_3_RA2_01_1224.d 8.37E4 1 1 352 360 Carboxylation (DKW)
R.MFAPT(-18.01)K.V Y 28.24 675.3414 6 5.0 676.3521 1 95.18 2 49401 AEV_1_3_RA2_01_1232.d 3.81E4 1 1 100 105 Dehydration
R.R(+43.01)(+14.02)GPLVVYNPDVDGKDLVK.A Y 28.04 2040.1003 18 -11.7 511.0264 4 70.38 2 33135 AEV_1_3_RA2_01_1232.d 1.02E5 1 1 207 224 Carbamylation; Methylation(KR)
K.KNPLKNR.Q Y 27.38 868.5242 7 3.1 435.2708 2 10.93 2 2821 AEV_1_3_RA2_01_1232.d 2.21E4 2 2 324 330
R.A(+56.06)GQAAFGNQC(+57.02)R.A Y 27.27 1234.5876 11 -18.9 618.2894 2 26.50 3 11418 AEV_3_3_RA3_01_1233.d 0 1 1 86 96 Diethylation; Carbamidomethylation
K.AGEQ(+15.00)TSAESWGTGR.A Y 26.39 1450.6324 14 14.1 726.3337 2 57.77 3 30784 AEV_3_3_RA3_01_1233.d 5.4E4 1 1 57 70 Deamidation followed by a methylation
K.DFLLPSN(+.98)LVSNADITR(+28.03).L Y 25.99 1802.9414 16 3.3 902.4810 2 87.11 3 53064 AEV_3_3_RA3_01_1233.d 1.78E4 1 1 281 296 Deamidation (NQ); Dimethylation(KR)
K.LGQKGLDTGKPDR.A Y 25.95 1383.7469 13 -9.1 346.9409 4 23.87 3 9921 AEV_3_3_RA3_01_1233.d 9.29E4 2 2 348 360
K.AGEQTSAESWGTGRAVAR.I Y 25.34 1832.8765 18 1.4 611.9670 3 51.43 3 26663 AEV_3_3_RA3_01_1233.d 1.35E5 1 1 57 74
K.AGEQTSAESWGTGR(+72.02).A Y 25.07 1507.6539 14 9.5 754.8414 2 39.91 3 19351 AEV_3_3_RA3_01_1233.d 1.48E5 1 1 57 70 Dihydroxy methylglyoxal adduct
K.AGEQTSAESWGT(+79.97)GR(+14.02).A Y 24.82 1529.6147 14 -22.6 510.8673 3 36.67 1 12534 AEV 2_3_RA2_01_1224.d 0 1 1 57 70 Phosphorylation (STY); Methylation(KR)
R.F(+149.03)ATASALAASSVPALLFAR.G Y 24.74 2012.0553 19 8.0 671.6978 3 84.47 3 51354 AEV_3_3_RA3_01_1233.d 7.26E3 1 1 121 139 Benzyl isothiocyanate
K.AGEQTS(-18.01)AESWGTGR.A Y 24.34 1417.6222 14 -23.1 473.5371 3 74.71 1 37641 AEV 2_3_RA2_01_1224.d 4.83E4 1 1 57 70 Dehydration
K.IN(+.98)LGQKR.F Y 24.19 828.4818 7 -12.9 415.2428 2 19.69 2 6310 AEV_1_3_RA2_01_1232.d 0 1 1 114 120 Deamidation (NQ)
K.AAIALLK(+14.02).N Y 24.18 712.4847 7 -94.6 357.2159 2 77.62 1 39947 AEV 2_3_RA2_01_1224.d 1.06E5 3 3 168 174 Methylation(KR)
R.VASVPE(+14.02)VPLVVDSK.A Y 24.12 1451.8235 14 -1.0 726.9183 2 78.46 3 46871 AEV_3_3_RA3_01_1233.d 4.26E5 1 1 143 156 Methylation(others)
K.G(+42.01)LDTGKPDR.A Y 23.11 999.4985 9 -76.5 500.7183 2 41.31 1 15166 AEV 2_3_RA2_01_1224.d 4.19E5 1 1 352 360 Acetylation (N-term)
R.GPLVVYNPDVDGK(+71.04)DLVK.A Y 23.08 1898.0149 17 0.3 633.6791 3 75.44 3 44473 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 208 224 Propionamide (K, X@N-term)
R.AGQ(+.98)AAFGN(+.98)Q(+.98)C(+57.02)R.A Y 22.97 1181.4772 11 -1.0 591.7453 2 39.50 1 14121 AEV 2_3_RA2_01_1224.d 4.67E4 1 1 86 96 Deamidation (NQ); Carbamidomethylation
R.LNPYAAAFSK(+21.98).Q Y 22.90 1102.5422 10 38.0 552.2993 2 77.25 2 38375 AEV_1_3_RA2_01_1232.d 0 1 1 336 345 Sodium adduct
R.MFAPTK.V Y 22.87 693.3520 6 2.2 347.6840 2 31.54 3 14287 AEV_3_3_RA3_01_1233.d 3.58E5 2 2 100 105
R.QVLLR.L N 22.63 627.4068 5 -15.8 314.7057 2 32.67 3 14960 AEV_3_3_RA3_01_1233.d 0 2 2 331 335
K.DFLLPSN(+.98)LVSNADITR(+14.02).L Y 22.43 1788.9258 16 -22.5 895.4500 2 87.60 2 45973 AEV_1_3_RA2_01_1232.d 8.86E4 1 1 281 296 Deamidation (NQ); Methylation(KR)
K.GLDTGKPD(-18.01)R.A Y 22.41 939.4774 9 3.9 314.1676 3 30.21 1 9078 AEV 2_3_RA2_01_1224.d 3.98E4 2 2 352 360 Dehydration
R.AGE(+14.02)TFHK.I Y 21.84 802.3973 7 18.2 402.2133 2 16.89 3 6137 AEV_3_3_RA3_01_1233.d 8.84E4 1 1 361 367 Methylation(others)
R.AGKGK(+21.98).M Y 21.67 481.2625 5 -13.5 482.2632 1 11.97 3 3484 AEV_3_3_RA3_01_1233.d 2.5E3 1 1 193 197 Sodium adduct
K.NRQVLLR.L Y 21.65 897.5508 7 -79.2 300.1672 3 73.16 1 36462 AEV 2_3_RA2_01_1224.d 0 1 1 329 335
R.NIPGVETS(+14.02)SVFSLNLLQLAPGGHLGR.F Y 21.62 2689.4551 26 -39.9 897.4565 3 89.55 3 54472 AEV_3_3_RA3_01_1233.d 2.6E4 1 1 228 253 Methylation(others)
R.LINSS(+79.97)EVQSALR.E Y 21.62 1395.6759 12 31.9 349.9374 4 23.47 3 9693 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 297 308 Phosphorylation (STY)
R.LINSSEVQSALR(+282.05).E Y 21.34 1597.7623 12 -52.2 533.5669 3 79.22 1 41222 AEV 2_3_RA2_01_1224.d 0 1 1 297 308 Bis(hydroxphenylglyoxal) arginine
K.NVGAGPD(+37.03)LVKVEESRK.I Y 21.01 1733.9424 16 -40.2 434.4755 4 56.30 3 29723 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 175 190 Propargylamine
K.GLDT(+79.97)GK(+14.02)PDR.A Y 20.87 1051.4698 9 -101.3 526.6890 2 27.23 1 7569 AEV 2_3_RA2_01_1224.d 2.56E4 1 1 352 360 Phosphorylation (STY); Methylation(KR)
R.EPKGYAK(+43.01).T Y 20.85 834.4235 7 12.6 835.4413 1 97.38 3 58135 AEV_3_3_RA3_01_1233.d 3.6E4 1 1 309 315 Carbamylation
K.LGQK(+109.05)GLDTGKPDR.A Y 20.63 1492.7998 13 2.4 374.2081 4 48.68 3 24885 AEV_3_3_RA3_01_1233.d 0 1 1 348 360 Methylpyrroline
R.M(-48.00)FAPTKVWR.K Y 20.61 1086.5974 9 -5.5 363.2044 3 49.78 3 25581 AEV_3_3_RA3_01_1233.d 3.34E5 1 1 100 108 Dethiomethyl
K.A(+226.08)GEQTSAESWGTGR.A Y 20.33 1661.7103 14 -22.3 831.8439 2 87.33 1 47586 AEV 2_3_RA2_01_1224.d 0 1 1 57 70 Biotinylation
R.VASVPEVP(+13.98)LVVDSK.A Y 20.05 1451.7871 14 -63.5 726.8547 2 82.86 1 44102 AEV 2_3_RA2_01_1224.d 2.15E5 1 1 143 156 Proline oxidation to pyroglutamic acid
R.RGPLVVYNPDVDGK(-1.03)DLVKAFR.N Y 19.83 2356.2539 21 -7.6 472.2545 5 76.61 2 37875 AEV_1_3_RA2_01_1232.d 0 1 1 207 227 Lysine oxidation to aminoadipic semialdehyde
K.A(+42.01)GEQTSAESWGT(+79.97)GR.A Y 19.62 1557.6096 14 -18.0 779.7980 2 54.29 1 22735 AEV 2_3_RA2_01_1224.d 6.85E4 1 1 57 70 Acetylation (N-term); Phosphorylation (STY)
K.I(+127.06)NLGQKRFATASALAASSVPALLFAR.G Y 19.57 2799.5759 26 -50.1 934.1525 3 88.59 3 53947 AEV_3_3_RA3_01_1233.d 5.57E5 1 1 114 139 N-Succinimidyl-2-morpholine acetate
K.GYAKT(+79.97)K.R Y 19.43 746.3364 6 -18.2 747.3301 1 25.33 3 10749 AEV_3_3_RA3_01_1233.d 1.64E4 1 1 312 317 Phosphorylation (STY)
K.A(+43.01)GEQTSAESWGTGR.A Y 19.36 1478.6385 14 8.7 740.3330 2 51.55 3 26752 AEV_3_3_RA3_01_1233.d 5.8E4 1 1 57 70 Carbamylation
R.LINSSEVQ(+.98)SALR.E Y 19.01 1316.6936 12 -5.3 659.3506 2 70.70 3 40779 AEV_3_3_RA3_01_1233.d 5.91E4 2 2 297 308 Deamidation (NQ)
R.T(-18.01)GVQK.K Y 18.94 513.2911 5 -49.5 514.2729 1 21.31 3 8543 AEV_3_3_RA3_01_1233.d 0 1 1 319 323 Dehydration
K.N(+42.01)VGAGPDLVKVEESR.K Y 18.88 1610.8263 15 -1.3 537.9487 3 42.76 2 16840 AEV_1_3_RA2_01_1232.d 3.03E4 1 1 175 189 Acetylation (N-term)
R.N(+.98)IPGVETSSVFSLNLLQLAPGGHLGR.F Y 18.39 2676.4233 26 35.6 893.1802 3 91.08 2 47750 AEV_1_3_RA2_01_1232.d 0 1 1 228 253 Deamidation (NQ)
K.AGEQTSAE(+21.98)SWGTGR.A Y 18.15 1457.6147 14 48.0 365.4285 4 61.23 1 27388 AEV 2_3_RA2_01_1224.d 4.29E5 1 1 57 70 Sodium adduct
R.LINSSEVQS(+79.97)ALR(+14.02)EPK(+14.02).G Y 18.02 1777.8975 15 11.1 445.4866 4 64.77 2 29131 AEV_1_3_RA2_01_1232.d 3.25E5 1 1 297 311 Phosphorylation (STY); Methylation(KR)
K.DFLLPSNLVS(+14.02)NADITRLINSSEVQSALREPK.G Y 17.91 3439.8311 31 -2.9 860.9625 4 90.51 3 54992 AEV_3_3_RA3_01_1233.d 0 1 1 281 311 Methylation(others)
K.KDFLLPSNLVSNADITR.L Y 17.81 1902.0210 17 -75.8 634.9662 3 85.08 1 45850 AEV 2_3_RA2_01_1224.d 8.55E4 1 1 280 296
K.AGEQ(+.98)TSAESW(+31.99)GTGR.A Y 17.50 1468.6066 14 47.3 735.3453 2 25.68 3 10960 AEV_3_3_RA3_01_1233.d 0 1 1 57 70 Deamidation (NQ); Dihydroxy
R.QPY(+79.97)AVSE(+21.98)K.A Y 17.28 1022.4086 8 3.7 512.2134 2 34.91 1 11649 AEV 2_3_RA2_01_1224.d 2.13E4 1 1 49 56 Phosphorylation (STY); Sodium adduct
R.LIN(+.98)SS(+79.97)EVQSALR(+14.02)EPK.G Y 17.00 1764.8658 15 16.3 589.3055 3 39.09 3 18854 AEV_3_3_RA3_01_1233.d 4.13E4 1 1 297 311 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
R.AGQAAFGN(+.98)Q(+.98)C(+57.02)R(+14.02).A Y 16.96 1194.5088 11 -77.3 598.2155 2 35.08 1 11723 AEV 2_3_RA2_01_1224.d 6.64E5 2 2 86 96 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
K.N(+.98)VGAGPDLVK(+42.01).V Y 16.93 1011.5236 10 -9.5 338.1786 3 24.24 3 10191 AEV_3_3_RA3_01_1233.d 3.49E5 1 1 175 184 Deamidation (NQ); Acetylation (K)
R.V(+42.01)SGGGT(-18.01)HR.A Y 16.79 793.3831 8 8.5 794.3972 1 77.01 2 38187 AEV_1_3_RA2_01_1232.d 4.65E2 1 1 78 85 Acetylation (N-term); Dehydration
R.FATASALAASSVPALLFAR(+.98).G Y 16.46 1864.0094 19 0.8 622.3442 3 88.02 3 53618 AEV_3_3_RA3_01_1233.d 2.18E5 1 1 121 139 Deamidation (R)
R.L(+42.01)INS(+79.97)SEVQSALR.E Y 16.24 1437.6864 12 43.8 480.2570 3 37.46 2 14258 AEV_1_3_RA2_01_1232.d 0 1 1 297 308 Acetylation (N-term); Phosphorylation (STY)
K.G(+71.04)LDTGKPDR.A Y 16.13 1028.5250 9 23.5 515.2819 2 42.60 3 21034 AEV_3_3_RA3_01_1233.d 2.46E5 1 1 352 360 Propionamide (K, X@N-term)
K.VE(+37.03)ESR.K Y 16.13 655.3289 5 -75.5 656.2867 1 88.44 1 48451 AEV 2_3_RA2_01_1224.d 7.06E3 1 1 185 189 Propargylamine
K.GLDT(-18.01)GKPDR(+14.02).A Y 16.09 953.4930 9 30.3 318.8479 3 8.90 3 2165 AEV_3_3_RA3_01_1233.d 7.42E4 1 1 352 360 Dehydration; Methylation(KR)
R.FAT(-18.01)ASALAASSVPALLFAR.G Y 16.07 1845.0148 19 7.4 616.0167 3 89.87 2 47166 AEV_1_3_RA2_01_1232.d 3.22E4 1 1 121 139 Dehydration
R.L(+42.01)NPYAAAFS(+162.05)K.Q Y 15.94 1284.6237 10 -45.9 429.1955 3 65.73 1 30673 AEV 2_3_RA2_01_1224.d 8.62E4 1 1 336 345 Acetylation (N-term); Hexose (NSY)
R.LINS(-2.02)SEVQSALREPK.G Y 15.64 1667.8842 15 -44.2 556.9441 3 68.81 3 39296 AEV_3_3_RA3_01_1233.d 0 1 1 297 311 2-amino-3-oxo-butanoic_acid
K.DFLLPS(+79.96)N(+.98)LVSNADITR.L Y 15.58 1854.8669 16 33.1 619.3167 3 74.46 3 43710 AEV_3_3_RA3_01_1233.d 9.11E4 1 1 281 296 Sulfation; Deamidation (NQ)
R.QPYAVS(-18.01)EK(+14.02).A Y 15.51 916.4654 8 -73.5 459.2063 2 43.42 1 16401 AEV 2_3_RA2_01_1224.d 0 1 1 49 56 Dehydration; Methylation(KR)
K.N(-17.03)VGAGPDLVK.V Y 15.48 951.5025 10 -5.5 318.1730 3 65.97 3 37044 AEV_3_3_RA3_01_1233.d 0 1 1 175 184 Ammonia-loss (N)
R.A(+42.01)GQ(+.98)AAFGNQC(+57.02)R.A Y 15.42 1221.5197 11 -8.3 611.7620 2 67.03 1 31668 AEV 2_3_RA2_01_1224.d 0 1 1 86 96 Acetylation (N-term); Deamidation (NQ); Carbamidomethylation
R.LINSSE(+43.99)VQSALR.E Y 15.41 1359.6993 12 -14.8 454.2337 3 29.24 3 12954 AEV_3_3_RA3_01_1233.d 1.61E5 1 1 297 308 Carboxylation (E)
R.VSGGGTHR(+28.03).A Y 15.40 797.4144 8 -12.6 798.4116 1 87.30 3 53182 AEV_3_3_RA3_01_1233.d 4.69E4 1 1 78 85 Dimethylation(KR)
R.AVARIPR.V Y 15.33 781.4922 7 -3.9 391.7518 2 23.86 3 9918 AEV_3_3_RA3_01_1233.d 2.17E5 1 1 71 77
K.IN(+.98)LGQ(+.98)K.R Y 15.28 673.3646 6 -5.9 674.3679 1 86.18 2 45099 AEV_1_3_RA2_01_1232.d 8.56E4 1 1 114 119 Deamidation (NQ)
R.AGQAAFGNQ(+.98)CR.A Y 15.22 1122.4877 11 -60.7 562.2170 2 39.37 1 14047 AEV 2_3_RA2_01_1224.d 5.16E4 1 1 86 96 Deamidation (NQ)
K.AGEQ(+.98)TSAESWGTGR(+28.03).A Y 15.22 1464.6481 14 -10.9 733.3234 2 49.22 2 20053 AEV_1_3_RA2_01_1232.d 1.33E4 1 1 57 70 Deamidation (NQ); Dimethylation(KR)
K.LGQ(+.98)KGLDTGKPDR.A Y 15.15 1384.7310 13 45.5 347.2058 4 25.11 2 8541 AEV_1_3_RA2_01_1232.d 0 1 1 348 360 Deamidation (NQ)
R.Q(+42.01)PYAVSE(+43.99)K.A Y 15.14 1006.4607 8 -63.0 504.2059 2 52.06 1 21397 AEV 2_3_RA2_01_1224.d 0 1 1 49 56 Acetylation (N-term); Carboxylation (E)
K.RQ(+.98)PYAVSEK(+14.02).A Y 15.07 1091.5610 9 -21.5 546.7761 2 47.29 3 24001 AEV_3_3_RA3_01_1233.d 6.02E4 1 1 48 56 Deamidation (NQ); Methylation(KR)
total 205 peptides
C1GA17
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IAVQHGVQLVHPGYGFLSENAEFAR.N Y 156.35 2738.3928 25 4.1 685.6083 4 78.57 2 39443 AEV_1_3_RA2_01_1232.d 5.4E5 2 2 114 138
R.ITTEDPTKGFQPDTGKIEVYR.S Y 145.65 2394.2065 21 2.5 599.5604 4 70.14 2 32952 AEV_1_3_RA2_01_1232.d 1.21E6 5 5 387 407
K.AGLVFVGPTPDTIDALGDKVSAR.R Y 139.63 2298.2219 23 2.9 767.0834 3 82.26 2 42317 AEV_1_3_RA2_01_1232.d 1E6 5 5 143 165
R.FEEVKAFTDEYGFPIIIK.A Y 138.67 2145.1033 18 4.6 716.0450 3 85.03 2 44334 AEV_1_3_RA2_01_1232.d 4.69E5 2 2 186 203
R.NVEKAGLVFVGPTPDTIDALGDKVSAR.R Y 135.00 2768.4707 27 2.4 693.1266 4 79.70 2 40324 AEV_1_3_RA2_01_1232.d 2.17E5 2 2 139 165
K.AGLVFVGPTPDTIDALGDKVSARR.L Y 134.80 2454.3230 24 4.8 614.5909 4 79.83 2 40428 AEV_1_3_RA2_01_1232.d 2.53E5 2 2 143 166
R.GQFTPVGAYLAGDEIIR.I Y 130.72 1805.9312 17 -0.1 903.9728 2 82.87 2 42801 AEV_1_3_RA2_01_1232.d 9.27E5 6 6 97 113
R.LDGGNGFAGAIITPHYDSMLVK.C Y 125.41 2275.1306 22 6.4 759.3890 3 81.22 2 41521 AEV_1_3_RA2_01_1232.d 1.62E5 1 1 416 437
K.AFTDEYGFPIIIK.A Y 125.37 1512.7864 13 -7.5 757.3948 2 85.03 2 44396 AEV_1_3_RA2_01_1232.d 1.28E6 5 5 191 203
K.VVEIAPAKDLPVEVRDSILADAVK.L Y 125.34 2546.4319 24 9.2 637.6211 4 82.26 2 42320 AEV_1_3_RA2_01_1232.d 3.96E5 3 3 283 306
R.GANGVAYSSLPDNAIYHFC(+57.02)K.Q Y 119.03 2183.0105 20 -1.3 728.6765 3 76.20 2 37550 AEV_1_3_RA2_01_1232.d 5.54E5 4 4 663 682 Carbamidomethylation
K.VVEIAPAKDLPVEVR.D Y 115.99 1633.9402 15 3.0 545.6556 3 72.86 2 35010 AEV_1_3_RA2_01_1232.d 4.68E5 4 4 283 297
K.RGQFTPVGAYLAGDEIIR.I Y 113.41 1962.0322 18 2.4 655.0196 3 79.25 2 39965 AEV_1_3_RA2_01_1232.d 5.52E5 3 3 96 113
K.MIIDEQGPAAFAK.A Y 112.78 1389.6962 13 3.7 695.8579 2 73.24 2 35324 AEV_1_3_RA2_01_1232.d 1.05E6 5 5 561 573
R.KAVPNVPFQMLLR.G Y 103.05 1511.8646 13 3.6 504.9640 3 79.60 2 40241 AEV_1_3_RA2_01_1232.d 3.34E5 3 3 650 662
K.AGLVFVGPTPDTIDALGDK.V Y 100.71 1884.9833 19 1.2 943.5001 2 83.83 2 43494 AEV_1_3_RA2_01_1232.d 3.08E5 4 4 143 161
K.C(+57.02)GVPVVPGTPGPVGR.F Y 99.59 1447.7605 15 3.0 724.8897 2 68.88 2 32008 AEV_1_3_RA2_01_1232.d 1.39E5 2 2 171 185 Carbamidomethylation
K.AAFGNGTVFVER.F Y 99.22 1266.6356 12 0.1 634.3251 2 70.06 2 32909 AEV_1_3_RA2_01_1232.d 1.39E6 7 7 235 246
K.VVGDLAQFMVSNKLTPDDVVAR.A Y 98.24 2373.2361 22 5.5 792.0903 3 82.95 3 50276 AEV_3_3_RA3_01_1233.d 2.05E5 1 1 928 949
R.VFDALNDIDQLEVGMK.A Y 96.05 1805.8870 16 3.9 903.9543 2 85.76 3 52231 AEV_3_3_RA3_01_1233.d 2.34E5 3 3 694 709
K.M(+15.99)IIDEQGPAAFAK.A Y 92.01 1405.6912 13 4.2 703.8558 2 68.54 2 31759 AEV_1_3_RA2_01_1232.d 3.61E5 3 3 561 573 Oxidation (M)
K.GFQPDTGKIEVYR.S Y 88.81 1508.7623 13 -0.9 503.9276 3 64.65 3 35996 AEV_3_3_RA3_01_1233.d 1.23E6 6 6 395 407
K.LLAYLGDVAVNGSR.I Y 88.80 1446.7831 14 -4.2 724.3958 2 77.68 3 46313 AEV_3_3_RA3_01_1233.d 3.7E5 4 4 509 522
K.AVPNVPFQMLLR.G Y 87.52 1383.7697 12 0.4 692.8924 2 84.75 2 44145 AEV_1_3_RA2_01_1232.d 3.67E5 4 4 651 662
K.LLAYLGDVAVN(+.98)GSR.I Y 87.18 1447.7671 14 -2.0 724.8894 2 79.09 3 47358 AEV_3_3_RA3_01_1233.d 3.08E5 3 3 509 522 Deamidation (NQ)
K.LLAVGPLSEQTGQR.E Y 85.56 1467.8044 14 -10.2 734.9020 2 71.58 2 34055 AEV_1_3_RA2_01_1232.d 6E4 2 2 1076 1089
R.GAN(+.98)GVAYSSLPDNAIYHFC(+57.02)K.Q Y 84.02 2183.9946 20 -9.0 728.9990 3 77.52 2 38584 AEV_1_3_RA2_01_1232.d 4.02E5 3 3 663 682 Deamidation (NQ); Carbamidomethylation
R.Q(-17.03)KADEAYVIGK.R Y 83.93 1203.6135 11 2.8 602.8157 2 59.13 2 25309 AEV_1_3_RA2_01_1232.d 6.71E5 4 4 85 95 Pyro-glu from Q
R.YYFIEINPR.I Y 82.47 1213.6132 9 1.9 607.8150 2 78.01 2 38978 AEV_1_3_RA2_01_1232.d 4.92E5 3 3 329 337
R.Q(-17.03)KADEAYVIGKR.G Y 82.43 1359.7146 12 -4.2 680.8617 2 50.04 3 25761 AEV_3_3_RA3_01_1233.d 9.8E5 8 8 85 96 Pyro-glu from Q
K.ILVANRGEIPIR.I Y 81.72 1349.8142 12 9.4 450.9496 3 65.88 2 29865 AEV_1_3_RA2_01_1232.d 1.76E5 1 1 47 58
R.QVTVDDNMAAVDDTSR.V Y 81.53 1735.7683 16 -1.4 868.8902 2 63.64 3 35235 AEV_3_3_RA3_01_1233.d 5.63E4 1 1 1101 1116
K.AFTDE(+14.02)YGFPIIIK.A Y 80.26 1526.8020 13 2.1 764.4099 2 86.57 2 45341 AEV_1_3_RA2_01_1232.d 2.41E5 2 2 191 203 Methylation(others)
K.EGDSVDGQDLIC(+57.02)K.I Y 79.29 1434.6296 13 0.9 718.3228 2 62.01 3 33974 AEV_3_3_RA3_01_1233.d 1.87E5 2 2 1179 1191 Carbamidomethylation
R.TAHELSLQTVAVYSYEDR.L Y 78.78 2081.0066 18 -17.1 694.6643 3 75.54 3 44549 AEV_3_3_RA3_01_1233.d 0 1 1 62 79
K.AAFGN(+.98)GTVFVER.F Y 78.68 1267.6196 12 2.4 634.8186 2 73.84 2 35786 AEV_1_3_RA2_01_1232.d 1.67E6 8 8 235 246 Deamidation (NQ)
R.NAGTAEFLVDQQNR.Y Y 75.75 1561.7484 14 -1.3 781.8805 2 65.36 3 36561 AEV_3_3_RA3_01_1233.d 9.58E5 8 8 315 328
R.IAVQHGVQLVHPGYGFLSEN(+.98)AEFAR.N Y 72.42 2739.3767 25 5.9 685.8555 4 78.07 3 46555 AEV_3_3_RA3_01_1233.d 5.51E4 1 1 114 138 Deamidation (NQ)
R.VVRDQESLRDSFER.A Y 71.42 1734.8649 14 3.7 579.2977 3 55.23 2 23123 AEV_1_3_RA2_01_1232.d 2.04E6 7 7 215 228
R.ANNGC(+57.02)LIMDTTWR.D Y 70.90 1550.6970 13 15.7 776.3680 2 75.21 3 44288 AEV_3_3_RA3_01_1233.d 5.09E4 1 1 577 589 Carbamidomethylation
R.FLYEDPWDRLR.K Y 70.20 1508.7412 11 -0.7 503.9207 3 78.59 3 46964 AEV_3_3_RA3_01_1233.d 2.68E5 2 2 636 646
K.MIIDE(+14.02)QGPAAFAK.A Y 68.64 1403.7118 13 -2.8 702.8612 2 76.89 3 45611 AEV_3_3_RA3_01_1233.d 8.33E4 1 1 561 573 Methylation(others)
R.GQFTPVGAYLAGDEIIR(+14.02).I Y 68.42 1819.9468 17 -1.7 607.6552 3 84.48 2 43959 AEV_1_3_RA2_01_1232.d 1.94E5 3 3 97 113 Methylation(KR)
K.YGDLSVLPTK.Y Y 66.48 1091.5862 10 1.9 546.8014 2 69.47 2 32455 AEV_1_3_RA2_01_1232.d 2.24E5 2 2 1041 1050
R.TVDLLNIAK.E Y 65.33 985.5807 9 1.6 493.7985 2 74.75 2 36459 AEV_1_3_RA2_01_1232.d 4.1E5 3 3 602 610
R.GSTYEIVR.R Y 65.24 923.4712 8 -0.2 462.7428 2 45.26 3 22809 AEV_3_3_RA3_01_1233.d 7.82E5 4 4 442 449
K.MIIDEQGPAAFAK(+14.02).A Y 63.85 1403.7118 13 -8.5 702.8572 2 75.28 3 44346 AEV_3_3_RA3_01_1233.d 7.3E4 2 2 561 573 Methylation(KR)
R.NAGTAEFLVDQQNRYYFIEINPR.I Y 60.43 2757.3511 23 -5.7 920.1190 3 82.11 3 49670 AEV_3_3_RA3_01_1233.d 2.27E5 2 2 315 337
R.GQ(+.98)FTPVGAYLAGDEIIR.I Y 58.87 1806.9152 17 -2.3 904.4628 2 83.79 2 43503 AEV_1_3_RA2_01_1232.d 1.64E5 2 2 97 113 Deamidation (NQ)
R.NVEKAGLVFVGPTPDTIDALGDK.V Y 57.55 2355.2322 23 -0.9 786.0839 3 80.42 2 40894 AEV_1_3_RA2_01_1232.d 5.33E4 1 1 139 161
R.DAHQSLLATR.V Y 56.79 1110.5781 10 1.2 556.2970 2 41.13 2 16013 AEV_1_3_RA2_01_1232.d 9.73E4 1 1 590 599
R.AIDSYWAQLR.L Y 54.94 1221.6141 10 3.0 611.8162 2 76.45 3 45257 AEV_3_3_RA3_01_1233.d 3.61E5 4 4 850 859
R.FEEVK(+14.02)AFTDEYGFPIIIK.A Y 54.43 2159.1189 18 3.3 720.7159 3 86.21 3 52521 AEV_3_3_RA3_01_1233.d 1.88E4 1 1 186 203 Methylation(KR)
K.YNLDYYLSLVDKVVK.I Y 52.67 1830.9767 15 -2.4 611.3314 3 88.14 2 46270 AEV_1_3_RA2_01_1232.d 3.48E5 2 2 735 749
R.DSILADAVK.L Y 49.44 930.5022 9 -9.4 466.2540 2 66.72 3 37636 AEV_3_3_RA3_01_1233.d 1.21E6 3 3 298 306
K.AAFGGGGR.G Y 48.69 691.3401 8 4.2 346.6788 2 15.65 2 4601 AEV_1_3_RA2_01_1232.d 5.33E5 3 3 204 211
R.NAGTAEFLVDQQNR(+14.02)Y(-18.01)YFIEINPR.I Y 47.60 2753.3562 23 24.5 689.3632 4 82.17 3 49713 AEV_3_3_RA3_01_1233.d 0 2 2 315 337 Methylation(KR); Dehydration
R.FLYEDPWDR.L Y 47.47 1239.5560 9 -87.3 620.7312 2 82.59 1 43852 AEV 2_3_RA2_01_1224.d 3.69E4 1 1 636 644
K.C(+58.01)GVPVVPGTPGPVGR.F Y 47.30 1448.7445 15 -0.4 725.3793 2 71.80 3 41646 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 171 185 Carboxymethyl
R.FEEVKAFTDE(+14.02)YGFPIIIK.A Y 46.06 2159.1189 18 0.1 720.7136 3 86.26 2 45150 AEV_1_3_RA2_01_1232.d 1.4E4 1 1 186 203 Methylation(others)
R.ATSEAK(+43.01)AAFGNGTVFVER.F Y 45.21 1896.9330 18 2.7 633.3200 3 69.79 3 40072 AEV_3_3_RA3_01_1233.d 0 1 1 229 246 Carbamylation
R.GFAIQC(+57.02)R.I Y 44.94 850.4119 7 -84.0 426.1775 2 60.38 1 26759 AEV 2_3_RA2_01_1224.d 1.66E6 7 7 380 386 Carbamidomethylation
R.QKADEAYVIGK.R Y 44.81 1220.6400 11 0.2 611.3274 2 39.09 2 15030 AEV_1_3_RA2_01_1232.d 2.81E5 3 3 85 95
K.VVE(+14.02)IAPAKDLPVEVRDSILADAVK.L Y 44.58 2560.4475 24 4.2 641.1218 4 82.79 2 42722 AEV_1_3_RA2_01_1232.d 6.67E4 1 1 283 306 Methylation(others)
R.VRTVDLLNIAK.E Y 43.97 1240.7502 11 -34.7 414.5764 3 71.33 3 41273 AEV_3_3_RA3_01_1233.d 0 1 1 600 610
K.AAFGNGTVFVER(+14.02).F Y 43.22 1280.6512 12 -1.4 641.3320 2 74.25 2 36063 AEV_1_3_RA2_01_1232.d 1.03E5 2 2 235 246 Methylation(KR)
K.ILVANRGEIPIRIFR.T Y 42.58 1766.0679 15 8.2 442.5279 4 77.09 2 38254 AEV_1_3_RA2_01_1232.d 7.11E4 1 1 47 61
R.ALIEFR.I Y 42.33 747.4279 6 3.3 374.7224 2 66.96 2 30621 AEV_1_3_RA2_01_1232.d 5.56E5 2 2 455 460
R.DQESLRDSFER.A Y 42.28 1380.6270 11 36.9 461.2332 3 55.78 2 23417 AEV_1_3_RA2_01_1232.d 1.84E5 2 2 218 228
K.AAFGN(+.98)GTVFVER(+14.02).F Y 41.42 1281.6353 12 6.5 641.8290 2 76.38 2 37695 AEV_1_3_RA2_01_1232.d 1.58E5 1 1 235 246 Deamidation (NQ); Methylation(KR)
K.AGLVFVGPT(-2.02)PDTIDALGDKVSAR.R Y 40.99 2296.2063 23 -12.0 766.4002 3 82.43 2 42445 AEV_1_3_RA2_01_1232.d 2.54E5 1 1 143 165 2-amino-3-oxo-butanoic_acid
K.LLAYLGDVAVNGSR(+14.02).I Y 40.73 1460.7987 14 -23.8 731.3892 2 78.63 2 39469 AEV_1_3_RA2_01_1232.d 0 1 1 509 522 Methylation(KR)
R.VFDALNDIDQLEVGMK(+14.02).A Y 40.61 1819.9026 16 -2.0 910.9568 2 89.35 2 46912 AEV_1_3_RA2_01_1232.d 2.51E5 1 1 694 709 Methylation(KR)
K.YGVDIFR.V Y 40.41 868.4443 7 -1.6 435.2287 2 71.79 3 41632 AEV_3_3_RA3_01_1233.d 8.49E4 1 1 687 693
R.IAVQHGVQLVHPGY(-2.02)GFLSENAEFAR.N Y 40.38 2736.3772 25 -0.5 913.1326 3 77.99 3 46491 AEV_3_3_RA3_01_1233.d 6.9E4 1 1 114 138 2-amino-3-oxo-butanoic_acid
K.AFTDEYGFPIIIK(+14.02).A Y 39.73 1526.8020 13 -0.9 764.4076 2 86.92 2 45595 AEV_1_3_RA2_01_1232.d 1.92E5 1 1 191 203 Methylation(KR)
R.QKADEAYVIGKR.G Y 39.29 1376.7412 12 1.1 459.9215 3 31.23 3 14106 AEV_3_3_RA3_01_1233.d 5.3E4 2 2 85 96
K.ADEAYVIGKR.G Y 38.81 1120.5876 10 -113.2 561.2377 2 54.70 1 22982 AEV 2_3_RA2_01_1224.d 4.29E5 3 3 87 96
R.FLDKPK.H Y 37.69 746.4326 6 -4.4 374.2219 2 21.28 3 8528 AEV_3_3_RA3_01_1233.d 1.19E6 6 6 247 252
R.VFDALNDIDQLE(+43.99)VGMK.A Y 37.40 1849.8767 16 10.1 463.4811 4 38.51 3 18507 AEV_3_3_RA3_01_1233.d 9.98E5 1 1 694 709 Carboxylation (E)
K.LTPDDVVAR.A Y 37.15 984.5240 9 3.3 493.2709 2 57.70 2 24475 AEV_1_3_RA2_01_1232.d 5.66E4 4 4 941 949
K.EGDSVDGQ(+.98)DLIC(+57.02)K.I Y 36.90 1435.6136 13 -69.1 718.7645 2 66.35 1 31137 AEV 2_3_RA2_01_1224.d 1.07E4 1 1 1179 1191 Deamidation (NQ); Carbamidomethylation
K.GFQPDTGK.I Y 36.64 848.4028 8 -90.1 425.1705 2 33.10 1 10680 AEV 2_3_RA2_01_1224.d 4.86E5 3 3 395 402
R.VFDALN(+.98)DIDQLEVGMK.A Y 36.38 1806.8710 16 18.2 904.4592 2 85.84 2 44877 AEV_1_3_RA2_01_1232.d 9.39E4 1 1 694 709 Deamidation (NQ)
K.AAFGGGGR(+14.02).G Y 34.69 705.3558 8 -87.2 353.6544 2 37.53 1 13003 AEV 2_3_RA2_01_1224.d 1.49E5 1 1 204 211 Methylation(KR)
R.VVRDQESLR.D Y 33.81 1100.5938 9 -11.7 551.2977 2 20.63 3 8176 AEV_3_3_RA3_01_1233.d 1.13E4 1 1 215 223
K.VVE(+14.02)IAPAKDLPVEVR.D Y 33.76 1647.9559 15 -18.7 550.3157 3 74.28 2 36088 AEV_1_3_RA2_01_1232.d 4.63E4 1 1 283 297 Methylation(others)
K.ADEAYVIGK.R Y 33.72 964.4865 9 3.3 483.2521 2 48.72 2 19808 AEV_1_3_RA2_01_1232.d 3.04E5 1 1 87 95
R.Q(-17.03)KADEAYVIGK(+14.02).R Y 33.45 1217.6292 11 -86.4 609.7692 2 69.00 1 33184 AEV 2_3_RA2_01_1224.d 5.65E4 1 1 85 95 Pyro-glu from Q; Methylation(KR)
R.RHQKVVEIAPAKDLPVEVR(+14.02).D Y 33.16 2197.2695 19 -43.0 550.3010 4 74.71 2 36404 AEV_1_3_RA2_01_1232.d 0 1 1 279 297 Methylation(KR)
R.VVRDQESLR(+14.02)DSFER.A Y 32.93 1748.8805 14 4.8 438.2295 4 57.99 3 30958 AEV_3_3_RA3_01_1233.d 2.94E5 1 1 215 228 Methylation(KR)
K.IKANLLEQFGTATEC(+57.02)DVASYAMYPK.V Y 32.87 2819.3508 25 -4.4 940.7867 3 85.20 3 51828 AEV_3_3_RA3_01_1233.d 8.64E4 1 1 1005 1029 Carbamidomethylation
R.A(+42.01)TSEAK(+14.02)AAFGNGTVFVER(+14.02).F Y 31.87 1923.9690 18 -5.4 642.3268 3 77.36 2 38459 AEV_1_3_RA2_01_1232.d 0 1 1 229 246 Acetylation (N-term); Methylation(KR)
R.H(+15.99)QKVVEIAPAK.D Y 30.42 1234.7034 11 -15.8 309.6783 4 56.90 3 30148 AEV_3_3_RA3_01_1233.d 8.7E4 1 1 280 290 Oxidation (HW)
R.ITTEDPTKGFQPDTGKIEVYR(+14.02).S Y 30.22 2408.2224 21 -18.3 603.0519 4 71.04 3 41040 AEV_3_3_RA3_01_1233.d 0 1 1 387 407 Methylation(KR)
R.DSILADAVKLAK.S Y 29.94 1242.7183 12 0.6 415.2469 3 79.38 2 40065 AEV_1_3_RA2_01_1232.d 6.77E4 2 2 298 309
K.VVEIAPAK.D Y 29.79 825.4960 8 -89.6 413.7183 2 51.07 1 20813 AEV 2_3_RA2_01_1224.d 3.47E5 1 1 283 290
K.VFEDYRK.F Y 29.55 955.4763 7 -1.4 478.7448 2 29.13 3 12921 AEV_3_3_RA3_01_1233.d 1.43E5 1 1 1030 1036
K.KYGVDIFR.V Y 29.40 996.5392 8 -3.9 499.2749 2 64.50 3 35875 AEV_3_3_RA3_01_1233.d 1.24E6 2 2 686 693
R.FEEVKAFTDEY(-2.02)GFPIIIK.A Y 29.33 2143.0876 18 4.5 715.3730 3 84.87 3 51608 AEV_3_3_RA3_01_1233.d 0 1 1 186 203 2-amino-3-oxo-butanoic_acid
K.HIEVQLLGDN(+.98)HGNIVHLYER.D Y 29.07 2356.1924 20 -76.5 472.2097 5 83.81 1 44842 AEV 2_3_RA2_01_1224.d 4.41E4 1 1 253 272 Deamidation (NQ)
K.A(+42.01)AFGNGTVFVER.F Y 28.26 1308.6462 12 38.7 328.1815 4 33.99 2 12577 AEV_1_3_RA2_01_1232.d 0 1 1 235 246 Acetylation (N-term)
K.IEVYR.S Y 27.76 678.3701 5 -57.6 679.3383 1 81.81 2 41978 AEV_1_3_RA2_01_1232.d 6.01E4 2 2 403 407
R.ATSEAK(+43.99)AAFGNGTVFVER(+14.02).F Y 27.31 1911.9326 18 27.4 638.3356 3 74.34 2 36168 AEV_1_3_RA2_01_1232.d 1.1E5 1 1 229 246 Carboxylation (DKW); Methylation(KR)
R.KAVPNVPFQM(+15.99)LLR.G Y 26.93 1527.8595 13 -41.9 510.2725 3 76.39 2 37697 AEV_1_3_RA2_01_1232.d 0 1 1 650 662 Oxidation (M)
K.VVEIAPAKDLPVE(+14.02)VRDSILADAVK.L Y 26.69 2560.4475 24 7.2 641.1238 4 83.33 2 43124 AEV_1_3_RA2_01_1232.d 8.09E4 1 1 283 306 Methylation(others)
R.ISTRGFAIQC(+57.02)R.I Y 26.55 1307.6768 11 2.7 327.9273 4 22.32 2 7379 AEV_1_3_RA2_01_1232.d 2.63E5 2 2 376 386 Carbamidomethylation
K.DLPVEVRDSILADAVKLAK.S Y 25.91 2051.1626 19 5.1 513.8005 4 84.52 2 43987 AEV_1_3_RA2_01_1232.d 3.02E4 1 1 291 309
R.NAGT(+14.02)AEFLVDQQNR.Y Y 25.84 1575.7642 14 19.2 526.2721 3 69.25 2 32293 AEV_1_3_RA2_01_1232.d 1.89E4 1 1 315 328 Methylation(others)
R.ITTEDPTK.G Y 25.19 903.4549 8 -87.1 452.6954 2 29.60 1 8760 AEV 2_3_RA2_01_1224.d 1.25E5 2 2 387 394
R.IKGQIGEPK.F Y 23.68 968.5654 9 -93.8 485.2446 2 38.51 1 13552 AEV 2_3_RA2_01_1224.d 4.94E5 3 3 523 531
R.FLYEDPWDRLRK.L Y 23.20 1636.8361 12 2.4 410.2173 4 74.01 3 43357 AEV_3_3_RA3_01_1233.d 0 1 1 636 647
K.GQIGEPK(+43.99)FK.G Y 22.78 1046.5396 9 7.8 524.2811 2 35.72 3 16761 AEV_3_3_RA3_01_1233.d 2.85E5 1 1 525 533 Carboxylation (DKW)
K.RGQFTPVGAYLAGDEIIR(-.98).I Y 22.56 1961.0482 18 -3.1 491.2678 4 79.22 2 39942 AEV_1_3_RA2_01_1232.d 1.11E5 1 1 96 113 Amidation
R.IK(+117.02)GQIGEPK.F Y 22.52 1085.5903 9 6.1 1086.6042 1 86.45 2 45274 AEV_1_3_RA2_01_1232.d 1.47E4 1 1 523 531 N-Homocysteine thiolactone
K.GFQPDTGKIEVYR(+14.02).S Y 22.30 1522.7780 13 6.8 508.6034 3 67.79 2 31215 AEV_1_3_RA2_01_1232.d 4.98E4 1 1 395 407 Methylation(KR)
K.M(-48.00)IIDEQGPAAFAK.A Y 21.94 1341.6929 13 -2.2 448.2372 3 62.62 3 34444 AEV_3_3_RA3_01_1233.d 1.32E5 1 1 561 573 Dethiomethyl
R.LDGGN(+.98)GFAGAIITPHYDSMLVK.C Y 21.94 2276.1147 22 1.7 759.7135 3 82.23 2 42298 AEV_1_3_RA2_01_1232.d 1.59E5 1 1 416 437 Deamidation (NQ)
K.S(+42.01)VNYR(+14.02).N Y 21.76 693.3446 5 11.9 694.3601 1 95.21 2 49411 AEV_1_3_RA2_01_1232.d 0 1 1 310 314 Acetylation (N-term); Methylation(KR)
R.DQESLRDSFER(+14.02).A Y 21.65 1394.6426 11 4.0 465.8900 3 60.69 3 32937 AEV_3_3_RA3_01_1233.d 3.83E4 1 1 218 228 Methylation(KR)
R.FLDKPK(+21.98)(+42.01).H Y 21.56 810.4252 6 -14.6 811.4207 1 87.32 3 53209 AEV_3_3_RA3_01_1233.d 2.02E5 1 1 247 252 Sodium adduct; Acetylation (K)
K.AGLVFVGPTPDTIDALGDK(+14.02)VSAR.R Y 21.17 2312.2375 23 -2.6 771.7511 3 82.28 3 49802 AEV_3_3_RA3_01_1233.d 5.64E4 1 1 143 165 Methylation(KR)
R.QVTVDDNMAAVDDT(+79.97)SRVK(+43.99).V Y 21.00 2086.8877 18 13.7 522.7363 4 45.70 1 17673 AEV 2_3_RA2_01_1224.d 0 1 1 1101 1118 Phosphorylation (STY); Carboxylation (DKW)
K.DLPVEVR(+21.98).D Y 20.76 848.4368 7 -47.1 425.2057 2 76.70 1 39216 AEV 2_3_RA2_01_1224.d 8.7E4 1 1 291 297 Sodium adduct
R.LSMHR.Q Y 20.56 642.3271 5 15.3 643.3442 1 68.32 2 31646 AEV_1_3_RA2_01_1232.d 3.47E4 1 1 80 84
R.Q(+42.01)K(+14.02)ADEAYVIGKR.G Y 20.42 1432.7673 12 -9.3 359.1958 4 17.85 2 5507 AEV_1_3_RA2_01_1232.d 6E4 1 1 85 96 Acetylation (N-term); Methylation(KR)
K.VTPTSK(+42.01).V Y 20.27 673.3646 6 -53.2 674.3361 1 76.41 3 45231 AEV_3_3_RA3_01_1233.d 0 1 1 922 927 Acetylation (K)
K.G(+42.01)DPLAVLSAMK(+43.99).M Y 20.15 1186.5903 11 16.8 1187.6176 1 91.63 3 55611 AEV_3_3_RA3_01_1233.d 2.74E4 1 1 1149 1159 Acetylation (N-term); Carboxylation (DKW)
R.A(-15.01)TSEAKAAFGNGTVFVER.F Y 20.14 1838.9163 18 9.8 460.7408 4 32.00 2 11644 AEV_1_3_RA2_01_1232.d 0 1 1 229 246 ISD (z+2)-series
R.ALIEFR(+14.02).I Y 19.96 761.4435 6 -84.4 381.6969 2 80.71 1 42388 AEV 2_3_RA2_01_1224.d 3.62E4 1 1 455 460 Methylation(KR)
K.SVNYR(-.98).N Y 19.83 636.3344 5 -10.7 319.1711 2 22.69 3 9264 AEV_3_3_RA3_01_1233.d 1.98E5 1 1 310 314 Amidation
K.K(+42.01)YGVDIFRVFDALNDIDQLEVGMK(+43.01).A Y 19.55 2869.4319 24 11.0 718.3732 4 87.54 2 45934 AEV_1_3_RA2_01_1232.d 0 1 1 686 709 Acetylation (N-term); Carbamylation
R.FE(+14.02)EVK.A Y 19.47 664.3431 5 -91.5 665.2896 1 44.09 1 16734 AEV 2_3_RA2_01_1224.d 1.1E4 1 1 186 190 Methylation(others)
K.IEVYRSSGGNGVR.L Y 19.25 1392.7109 13 -5.8 465.2415 3 61.21 2 26670 AEV_1_3_RA2_01_1232.d 7.51E4 1 1 403 415
R.IAVQHGVQLVHPGYGFLSEN(+.98)AEFAR(+14.02).N Y 19.21 2753.3926 25 3.9 689.3581 4 78.76 3 47099 AEV_3_3_RA3_01_1233.d 5.44E4 1 1 114 138 Deamidation (NQ); Methylation(KR)
R.I(+42.01)K(+31.99)GQIGEPK.F Y 19.18 1042.5658 9 13.7 348.5340 3 20.25 3 7951 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 523 531 Acetylation (N-term); Dihydroxy
R.FLD(+43.99)KPK(+42.01).H Y 19.12 832.4330 6 -113.3 833.3460 1 110.35 1 58865 AEV 2_3_RA2_01_1224.d 3.01E5 1 1 247 252 Carboxylation (DKW); Acetylation (K)
R.ATSEAK.A Y 19.12 605.3020 6 -18.5 606.2981 1 32.82 3 15048 AEV_3_3_RA3_01_1233.d 5.7E4 1 1 229 234
R.ITTEDPTK(+42.01).G Y 19.10 945.4655 8 -12.4 316.1585 3 41.85 1 15484 AEV 2_3_RA2_01_1224.d 0 1 1 387 394 Acetylation (K)
R.VRTVDLLNIAK(+31.99).E Y 18.54 1272.7401 11 -16.3 319.1871 4 28.88 3 12735 AEV_3_3_RA3_01_1233.d 0 1 1 600 610 Dihydroxy
K.KYNLDYYLSLVDK.V Y 18.48 1632.8398 13 -1.5 409.2166 4 19.31 2 6118 AEV_1_3_RA2_01_1232.d 0 1 1 734 746
K.CGVPVVPGT(+79.97)PGPVGR.F Y 18.44 1470.7054 15 21.7 491.2531 3 51.48 3 26702 AEV_3_3_RA3_01_1233.d 1.27E5 1 1 171 185 Phosphorylation (STY)
R.QVTVDDNM(+15.99)AAVDDT(+79.97)S(+79.97)R.V Y 18.39 1911.6958 16 35.7 478.9483 4 80.53 1 42255 AEV 2_3_RA2_01_1224.d 0 1 1 1101 1116 Oxidation (M); Phosphorylation (STY)
K.AAFGGGGR(+44.03).G Y 18.33 735.3663 8 21.6 736.3895 1 88.32 2 46365 AEV_1_3_RA2_01_1232.d 3.71E4 2 2 204 211 Ethanolation (KR)
R.I(+43.01)STRGFAIQC(+57.02)R.I Y 18.09 1350.6826 11 27.5 676.3671 2 34.50 2 12857 AEV_1_3_RA2_01_1232.d 2.89E5 1 1 376 386 Carbamylation; Carbamidomethylation
R.GEIPIR.I N 18.02 683.3966 6 -1.3 342.7051 2 70.45 3 40585 AEV_3_3_RA3_01_1233.d 7.89E4 1 1 53 58
R.GFAIQ(+.98)C(+57.02)R.I Y 17.81 851.3959 7 16.5 426.7123 2 55.68 2 23363 AEV_1_3_RA2_01_1232.d 4.27E4 1 1 380 386 Deamidation (NQ); Carbamidomethylation
K.L(+42.01)LAYLGDVAVNGS(-18.01)R.I Y 17.80 1470.7831 14 -14.9 491.2610 3 60.56 3 32842 AEV_3_3_RA3_01_1233.d 1.81E4 1 1 509 522 Acetylation (N-term); Dehydration
R.KFVAK(+28.03).Y Y 17.73 619.4057 5 2.4 620.4145 1 21.13 2 6860 AEV_1_3_RA2_01_1232.d 4.9E4 1 1 1036 1040 Dimethylation(KR)
K.V(+42.01)VGDLAQFMVS(+79.97)NK(+14.02).L Y 17.70 1542.7153 13 -32.3 772.3400 2 79.91 1 41773 AEV 2_3_RA2_01_1224.d 1.2E5 1 1 928 940 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
K.MIIDEQ(+.98)GPAAFAK.A Y 17.57 1390.6802 13 -88.1 696.2861 2 79.68 1 41590 AEV 2_3_RA2_01_1224.d 9.43E4 1 1 561 573 Deamidation (NQ)
K.V(+42.01)VGDLAQFMVSNK.L Y 17.54 1448.7333 13 -11.1 725.3659 2 86.59 2 45359 AEV_1_3_RA2_01_1232.d 5.38E4 1 1 928 940 Acetylation (N-term)
R.LRASSTIMHFTK(+28.03).I Y 17.30 1418.7704 12 7.4 355.7025 4 50.54 2 20716 AEV_1_3_RA2_01_1232.d 6.19E5 1 1 35 46 Dimethylation(KR)
K.GQIGEPKFK(+43.99).G Y 17.11 1046.5396 9 -5.0 524.2744 2 35.26 3 16548 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 525 533 Carboxylation (DKW)
R.DSILADAVK(+43.99).L Y 16.97 974.4920 9 -48.2 325.8223 3 44.94 1 17245 AEV 2_3_RA2_01_1224.d 1E6 1 1 298 306 Carboxylation (DKW)
K.AFTDEYGFPIIIK(+541.06).A Y 16.85 2053.8474 13 9.2 685.6294 3 80.95 1 42574 AEV 2_3_RA2_01_1224.d 5.57E4 1 1 191 203 ADP Ribose addition
K.G(+43.01)QIGEPK(+14.02).F Y 16.79 784.4079 7 6.4 785.4202 1 78.91 2 39697 AEV_1_3_RA2_01_1232.d 4.41E4 1 1 525 531 Carbamylation; Methylation(KR)
R.HQ(+.98)KVVEIAP(+31.99)AKDLPVEVR.D Y 16.78 2060.1265 18 -18.8 413.0248 5 60.72 3 32964 AEV_3_3_RA3_01_1233.d 0 1 1 280 297 Deamidation (NQ); Dihydroxy
R.ITTEDPTKGFQPDT(+79.97)GK(+14.02).I Y 16.67 1827.8291 16 12.5 610.2913 3 73.92 2 35819 AEV_1_3_RA2_01_1232.d 0 1 1 387 402 Phosphorylation (STY); Methylation(KR)
R.QK(+14.02)ADEAYVIGK.R Y 16.67 1234.6558 11 -9.4 618.3293 2 81.25 3 49026 AEV_3_3_RA3_01_1233.d 2.65E5 1 1 85 95 Methylation(KR)
K.DLPVE(+21.98)VR.D Y 16.57 848.4368 7 -25.6 425.2148 2 18.49 3 7020 AEV_3_3_RA3_01_1233.d 0 1 1 291 297 Sodium adduct
K.KGDPLAVLSAMK.M Y 16.46 1228.6849 12 -23.1 615.3356 2 78.36 2 39256 AEV_1_3_RA2_01_1232.d 6.7E4 1 1 1148 1159
R.VRTVDLLNIAK(+43.99).E Y 16.44 1284.7401 11 7.2 322.1946 4 42.07 3 20699 AEV_3_3_RA3_01_1233.d 5.24E4 1 1 600 610 Carboxylation (DKW)
K.MIIDEQGPAAFAK(+42.01).A Y 16.30 1431.7068 13 12.4 716.8696 2 68.72 2 31897 AEV_1_3_RA2_01_1232.d 1.91E4 1 1 561 573 Acetylation (K)
K.AVPNVPFQ(+.98)MLLR.G Y 16.24 1384.7537 12 8.9 693.3903 2 84.69 2 44105 AEV_1_3_RA2_01_1232.d 1.22E5 1 1 651 662 Deamidation (NQ)
R.QKADEAYVIGK(+42.01).R Y 16.19 1262.6506 11 -99.2 1263.5327 1 101.86 1 56328 AEV 2_3_RA2_01_1224.d 0 1 1 85 95 Acetylation (K)
K.LTPDDVVAR(+21.98).A Y 16.13 1006.5059 9 35.0 504.2778 2 57.30 3 30436 AEV_3_3_RA3_01_1233.d 1.78E5 1 1 941 949 Sodium adduct
R.NAGTAEFLVDQQNR(+14.02).Y Y 16.06 1575.7642 14 21.4 526.2733 3 57.50 3 30588 AEV_3_3_RA3_01_1233.d 1.39E5 1 1 315 328 Methylation(KR)
K.MIIDEQGP(+13.98)AAFAK.A Y 15.97 1403.6754 13 -60.8 702.8023 2 80.83 1 42483 AEV 2_3_RA2_01_1224.d 2.26E4 1 1 561 573 Proline oxidation to pyroglutamic acid
K.C(+210.20)GVPVVPGTPGPVGRFEEVK.A Y 15.96 2233.2544 20 -31.7 559.3032 4 82.09 2 42204 AEV_1_3_RA2_01_1232.d 1.77E5 1 1 171 190 Myristoylation
R.VVRDQESLRDSFER(+14.02).A Y 15.93 1748.8805 14 6.0 438.2300 4 59.51 2 25606 AEV_1_3_RA2_01_1232.d 2.55E5 1 1 215 228 Methylation(KR)
K.LLAYLGDVAVN(+.98)GS(+79.97)R.I Y 15.88 1527.7334 14 6.0 510.2548 3 28.81 3 12700 AEV_3_3_RA3_01_1233.d 1.8E4 1 1 509 522 Deamidation (NQ); Phosphorylation (STY)
R.ANNGC(+57.02)LIMDTTWRDAHQSLLATR.V Y 15.82 2643.2646 23 11.5 882.1057 3 77.33 3 45969 AEV_3_3_RA3_01_1233.d 3.75E4 1 1 577 599 Carbamidomethylation
R.Q(+.98)VTVDDNM(+15.99)AAVDDTSR.V Y 15.76 1752.7472 16 37.6 439.2106 4 79.52 1 41464 AEV 2_3_RA2_01_1224.d 0 1 1 1101 1116 Deamidation (NQ); Oxidation (M)
K.GFQPDTGK(+31.99).I Y 15.74 880.3926 8 -46.3 441.1832 2 34.60 1 11481 AEV 2_3_RA2_01_1224.d 7.14E4 1 1 395 402 Dihydroxy
K.ILVANR.G Y 15.71 684.4282 6 -16.5 685.4242 1 105.27 1 57391 AEV 2_3_RA2_01_1224.d 0 1 1 47 52
R.ITTED(+28.03)PTK.G Y 15.69 931.4862 8 -17.4 932.4773 1 87.27 3 53168 AEV_3_3_RA3_01_1233.d 6.83E4 1 1 387 394 Ethylation
R.Q(+27.99)VT(+79.97)VDDNMAAVDDTSR.V Y 15.69 1843.7295 16 -24.5 461.9284 4 31.07 1 9558 AEV 2_3_RA2_01_1224.d 2.37E5 1 1 1101 1116 Formylation; Phosphorylation (STY)
R.LDGGNGFAGAIITPHYDSM(+15.99)LVK.C Y 15.68 2291.1255 22 -84.7 573.7401 4 66.37 1 31157 AEV 2_3_RA2_01_1224.d 0 1 1 416 437 Oxidation (M)
R.D(+43.99)SFERAT(+79.97)SEAK.A Y 15.65 1363.5293 11 -53.5 682.7355 2 46.76 1 18327 AEV 2_3_RA2_01_1224.d 3.8E4 1 1 224 234 Carboxylation (DKW); Phosphorylation (STY)
K.A(+43.01)AFGGGGR.G Y 15.62 734.3459 8 37.0 735.3804 1 77.04 3 45727 AEV_3_3_RA3_01_1233.d 0 1 1 204 211 Carbamylation
K.KYGVDIFRVFDALNDIDQLEVGM(+15.99)K.A Y 15.59 2800.4104 24 71.4 701.1599 4 92.86 3 56247 AEV_3_3_RA3_01_1233.d 0 1 1 686 709 Oxidation (M)
K.Y(+42.01)GVDIFR.V Y 15.56 910.4548 7 71.7 456.2673 2 72.51 2 34741 AEV_1_3_RA2_01_1232.d 0 1 1 687 693 Acetylation (N-term)
R.GSTYEIVRR.K Y 15.55 1079.5723 9 -87.4 540.7462 2 56.00 1 23825 AEV 2_3_RA2_01_1224.d 1.45E5 1 1 442 450
K.VTPTSK(+21.98)(+14.02).V Y 15.53 667.3517 6 -9.7 668.3525 1 76.78 2 38000 AEV_1_3_RA2_01_1232.d 4.89E4 1 1 922 927 Sodium adduct; Methylation(KR)
K.V(+27.99)VGDLAQFMVSNK(+42.01).L Y 15.43 1476.7283 13 11.8 739.3801 2 84.96 2 44287 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 928 940 Formylation; Acetylation (K)
R.Y(+42.01)YFIEIN(+.98)PR.I Y 15.42 1256.6077 9 10.8 629.3179 2 77.28 2 38392 AEV_1_3_RA2_01_1232.d 5.66E4 1 1 329 337 Acetylation (N-term); Deamidation (NQ)
R.A(+42.01)SSTIMHFTK.I Y 15.33 1163.5645 10 56.6 388.8841 3 49.18 2 20034 AEV_1_3_RA2_01_1232.d 6.57E4 1 1 37 46 Acetylation (N-term)
K.DLPVEVRDSILADAVK.L Y 15.32 1738.9464 16 -8.4 870.4731 2 81.22 2 41530 AEV_1_3_RA2_01_1232.d 1.74E4 1 1 291 306
K.IEVYR(+31.99)S(+79.97)SGGNGVR.L Y 15.28 1504.6671 13 72.7 377.2014 4 47.80 3 24325 AEV_3_3_RA3_01_1233.d 0 1 1 403 415 Dihydroxy; Phosphorylation (STY)
K.L(+42.01)TPDDVVAR.A Y 15.17 1026.5345 9 -9.2 514.2698 2 48.63 2 19760 AEV_1_3_RA2_01_1232.d 1.71E5 1 1 941 949 Acetylation (N-term)
K.YGVD(+14.02)IFR.V Y 15.09 882.4599 7 -92.6 442.1964 2 81.16 1 42739 AEV 2_3_RA2_01_1224.d 4.59E4 1 1 687 693 Methylation(others)
R.FLDKPK(+43.99).H Y 15.00 790.4225 6 -100.4 396.1788 2 50.32 1 20402 AEV 2_3_RA2_01_1224.d 7.98E4 1 1 247 252 Carboxylation (DKW)
R.L(+42.01)RASSTIMHFT(-18.01)K.I Y 15.00 1414.7391 12 20.2 472.5965 3 65.21 3 36447 AEV_3_3_RA3_01_1233.d 1.37E5 1 1 35 46 Acetylation (N-term); Dehydration
total 194 peptides
C1G064
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.KLTGIYLDVLESAAR.A Y 140.01 1647.9196 15 3.2 550.3156 3 81.74 2 41918 AEV_1_3_RA2_01_1232.d 7.26E5 3 3 652 666
K.YLFATLDQATFESYK.C Y 124.43 1795.8668 15 0.5 898.9412 2 84.10 2 43682 AEV_1_3_RA2_01_1232.d 5.17E5 4 4 1659 1673
R.GFETRPAQVILPLSPNHGTFGNDGLYSESK.L Y 124.42 3230.5996 30 0.4 1077.8743 3 78.87 3 47186 AEV_3_3_RA3_01_1233.d 5.79E4 1 1 810 839
R.AHGDKVEVFEIPDSSEYTVR.L Y 117.42 2277.0913 20 3.0 760.0400 3 74.22 2 36042 AEV_1_3_RA2_01_1232.d 7.24E5 4 4 1143 1162
R.TIASKYEAYDAATSVQR.Q Y 116.46 1872.9218 17 -1.2 625.3138 3 62.46 3 34316 AEV_3_3_RA3_01_1233.d 3.91E5 2 2 60 76
K.GAAGGFMFNGALQVLNSGLVPGNR.N Y 115.74 2346.1902 24 16.6 783.0837 3 90.14 3 54791 AEV_3_3_RA3_01_1233.d 1.43E5 2 2 1585 1608
K.AMAEGGPISEYSNR.T Y 113.34 1480.6616 14 3.4 741.3406 2 61.63 2 26968 AEV_1_3_RA2_01_1232.d 5.57E5 3 3 539 552
R.NADNIDKVMEKFDYIVYPSR.S Y 106.64 2416.1733 20 -9.8 605.0447 4 82.08 2 42192 AEV_1_3_RA2_01_1232.d 4.87E5 3 3 1609 1628
K.NGLGWDLDYIVPFAAISENGR.E Y 106.50 2306.1331 21 -2.7 769.7162 3 93.41 3 56513 AEV_3_3_RA3_01_1233.d 2.48E5 4 4 755 775
K.DVAIPTGPQTVIDSR.G Y 103.69 1567.8206 15 -0.6 784.9171 2 75.48 2 37006 AEV_1_3_RA2_01_1232.d 6.62E5 3 3 503 517
R.EAIRQEKDAAFSLGNNFWR.Q Y 102.59 2251.1133 19 3.3 563.7875 4 75.72 3 44693 AEV_3_3_RA3_01_1233.d 4.51E5 3 3 1495 1513
K.NVLMTGAGAGSIGAAVLQGMISGGAK.V Y 100.45 2330.2085 26 11.7 777.7526 3 89.72 2 47090 AEV_1_3_RA2_01_1232.d 1.28E5 3 3 675 700
R.FVAGQIPTGWNPK.H Y 99.44 1413.7405 13 0.8 707.8781 2 75.30 2 36839 AEV_1_3_RA2_01_1232.d 2.04E5 4 4 1180 1192
K.TEAEDVQM(+15.99)QQTR.Q Y 98.44 1450.6359 12 4.2 726.3282 2 23.42 3 9660 AEV_3_3_RA3_01_1233.d 4.83E4 1 1 1750 1761 Oxidation (M)
R.SVPAPGKGVLTTAR.E Y 96.89 1352.7776 14 -0.1 451.9331 3 53.18 3 27827 AEV_3_3_RA3_01_1233.d 1.27E6 7 7 1413 1426
K.VVDREIVSQC(+57.02)IR.I Y 96.48 1472.7770 12 5.3 491.9355 3 58.77 2 25097 AEV_1_3_RA2_01_1232.d 6.99E5 5 5 438 449 Carbamidomethylation
R.GSQLVVVPFNQGSKQDVQALVNYIYDPK.N Y 93.71 3105.6135 28 4.8 1036.2168 3 87.56 2 46023 AEV_1_3_RA2_01_1232.d 2.38E5 2 2 727 754
K.LTGIYLDVLESAAR.A Y 93.31 1519.8246 14 1.3 760.9205 2 84.83 3 51580 AEV_3_3_RA3_01_1233.d 1.98E5 2 2 653 666
K.Q(-17.03)KTEAEDVQMQQTR.Q Y 93.07 1673.7679 14 2.3 837.8932 2 47.48 2 19183 AEV_1_3_RA2_01_1232.d 2.16E5 3 3 1748 1761 Pyro-glu from Q
R.AFFKQQLELTAR.Y Y 92.46 1450.7932 12 4.9 484.6074 3 71.02 2 33603 AEV_1_3_RA2_01_1232.d 3.73E5 3 3 348 359
R.YFHNGLINNSLFVAK.D Y 92.32 1735.9045 15 -3.4 579.6401 3 76.92 3 45638 AEV_3_3_RA3_01_1233.d 9.87E5 4 4 1686 1700
R.GAPSPQASFAGR.W Y 92.25 1144.5625 12 3.4 573.2905 2 48.92 2 19952 AEV_1_3_RA2_01_1232.d 1.78E6 7 7 1810 1821
K.ETTLENKVVNGESSEALYK.K Y 89.93 2110.0430 19 3.4 704.3573 3 65.97 3 37041 AEV_3_3_RA3_01_1233.d 1.5E5 2 2 956 974
K.AM(+15.99)AEGGPISEYSNR.T Y 89.71 1496.6565 14 2.7 749.3375 2 52.41 3 27313 AEV_3_3_RA3_01_1233.d 5.2E5 5 5 539 552 Oxidation (M)
R.GSQLVVVPFNQGSK.Q Y 89.63 1458.7831 14 0.8 730.3994 2 73.44 2 35452 AEV_1_3_RA2_01_1232.d 7.85E5 5 5 727 740
K.ALKFDRFVAGQIPTGWNPK.H Y 89.41 2144.1531 19 -2.1 537.0444 4 78.13 3 46604 AEV_3_3_RA3_01_1233.d 1.99E5 2 2 1174 1192
K.AYRYFHNGLINNSLFVAK.D Y 89.02 2126.1062 18 15.4 532.5420 4 76.26 3 45114 AEV_3_3_RA3_01_1233.d 9.41E4 1 1 1683 1700
R.GNINYSEIPR.T Y 88.85 1161.5778 10 1.3 581.7969 2 62.58 2 27617 AEV_1_3_RA2_01_1232.d 2.09E6 5 5 518 527
R.WGLQSGRQDGLLLLALTMEPASR.L Y 88.77 2511.3267 23 1.4 838.1173 3 89.79 3 54604 AEV_3_3_RA3_01_1233.d 3.03E5 3 3 268 290
R.ENAGKFPSPLLDIKYR.R Y 87.69 1846.9940 16 5.3 462.7582 4 74.36 2 36165 AEV_1_3_RA2_01_1232.d 9.04E5 4 4 1427 1442
R.RTIASKYEAYDAATSVQR.Q Y 86.19 2029.0228 18 -3.3 677.3460 3 58.21 3 31099 AEV_3_3_RA3_01_1233.d 2.48E4 2 2 59 76
K.DAAFSLGNNFWR.Q Y 85.79 1396.6523 12 3.7 699.3361 2 83.11 3 50381 AEV_3_3_RA3_01_1233.d 2.33E5 2 2 1502 1513
R.EVTGYYQTMYTR.Y Y 85.58 1510.6763 12 -2.5 756.3435 2 66.43 3 37410 AEV_3_3_RA3_01_1233.d 3.69E5 4 4 711 722
R.WIETQDVILQEK.R Y 84.81 1500.7823 12 -1.3 751.3975 2 76.01 2 37424 AEV_1_3_RA2_01_1232.d 2.13E5 3 3 28 39
R.EIDSIDSKSELAHR.V Y 83.93 1598.7899 14 3.6 533.9391 3 45.88 3 23109 AEV_3_3_RA3_01_1233.d 8.69E5 5 5 776 789
R.Q(-17.03)KGNALLGIFQK.Y Y 83.92 1298.7346 12 -1.1 650.3739 2 79.60 3 47760 AEV_3_3_RA3_01_1233.d 5.25E5 6 6 1566 1577 Pyro-glu from Q
R.IVEIGPADTLGGMAR.R Y 83.88 1498.7814 15 -4.3 750.3948 2 76.51 3 45343 AEV_3_3_RA3_01_1233.d 3.66E5 3 3 44 58
K.LRSEITETSTVR.Q Y 83.61 1390.7416 12 -0.8 464.5874 3 42.50 3 20963 AEV_3_3_RA3_01_1233.d 5.88E5 5 5 939 950
K.GTQAIGIHPK.Y Y 81.02 1020.5716 10 -15.4 511.2852 2 29.56 2 10526 AEV_1_3_RA2_01_1232.d 1.3E6 9 9 1649 1658
K.Q(-17.03)DVQALVNYIYDPK.N Y 80.67 1647.8145 14 3.8 824.9176 2 91.37 2 47882 AEV_1_3_RA2_01_1232.d 7.28E5 3 3 741 754 Pyro-glu from Q
R.VYDSSWNWAR.Q Y 80.44 1282.5731 10 -0.8 642.2933 2 72.00 3 41794 AEV_3_3_RA3_01_1233.d 3.1E5 3 3 412 421
K.TEAEDVQMQQTR.Q Y 80.37 1434.6409 12 2.6 718.3296 2 37.63 2 14334 AEV_1_3_RA2_01_1232.d 3.27E5 3 3 1750 1761
R.EVTGYYQTM(+15.99)YTR.Y Y 80.27 1526.6711 12 -1.6 764.3416 2 60.18 3 32546 AEV_3_3_RA3_01_1233.d 1.56E5 2 2 711 722 Oxidation (M)
R.SEITETSTVR.Q Y 80.20 1121.5564 10 1.7 561.7864 2 34.71 3 16156 AEV_3_3_RA3_01_1233.d 7.05E5 7 7 941 950
K.AFSVTSFGFGQKGTQAIGIHPK.Y Y 80.09 2277.1904 22 2.9 570.3065 4 76.23 3 45095 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 1637 1658
K.LKKPLADVPVTK.A Y 79.94 1307.8176 12 -2.0 436.9456 3 47.54 3 24155 AEV_3_3_RA3_01_1233.d 1.39E6 7 7 173 184
K.QDVQALVNYIYDPK.N Y 79.19 1664.8409 14 3.9 833.4310 2 82.47 2 42474 AEV_1_3_RA2_01_1232.d 3.14E5 3 3 741 754
R.Q(-17.03)KGNALLGIFQKYLTGHPK.G Y 77.96 2095.1577 19 -4.3 524.7944 4 83.82 3 50889 AEV_3_3_RA3_01_1233.d 2.24E5 2 2 1566 1584 Pyro-glu from Q
R.SLQTDGIKAFSVTSFGFGQK.G Y 77.68 2117.0793 20 10.8 530.2828 4 81.68 3 49357 AEV_3_3_RA3_01_1233.d 4.42E4 3 3 1629 1648
R.AHGDKVEVFE(+14.02)IPDSSEYTVR.L Y 77.33 2291.1069 20 3.5 573.7860 4 75.46 2 36964 AEV_1_3_RA2_01_1232.d 5.45E5 3 3 1143 1162 Methylation(others)
R.TPQEMSRPTTTTR.S Y 77.10 1504.7303 13 2.1 502.5851 3 28.50 3 12531 AEV_3_3_RA3_01_1233.d 8.13E5 3 3 1357 1369
R.Q(-17.03)ILC(+57.02)YNKDAK.E Y 76.61 1234.6016 10 -1.8 618.3069 2 61.15 3 33355 AEV_3_3_RA3_01_1233.d 3.75E5 3 3 77 86 Pyro-glu from Q; Carbamidomethylation
K.MPGGFNITAVRK.Y Y 76.58 1289.6914 12 -5.4 430.9021 3 65.58 3 36733 AEV_3_3_RA3_01_1233.d 6.3E5 4 4 251 262
K.TGEPVNDRDVK.A Y 75.80 1228.6047 11 -1.4 615.3088 2 19.63 2 6263 AEV_1_3_RA2_01_1232.d 1.7E6 10 10 1076 1086
R.Q(-17.03)DGLLLLALTMEPASR.L Y 74.46 1709.9022 16 6.1 855.9636 2 97.78 2 50300 AEV_1_3_RA2_01_1232.d 2.88E4 1 1 275 290 Pyro-glu from Q
K.AFSVTSFGFGQK.G Y 74.16 1274.6295 12 -2.7 638.3203 2 78.50 3 46895 AEV_3_3_RA3_01_1233.d 6.28E5 3 3 1637 1648
R.STGLMNSNDILAEGVEK.L Y 73.98 1776.8563 17 -17.9 889.4195 2 76.05 2 37433 AEV_1_3_RA2_01_1232.d 4.41E4 1 1 870 886
K.VFLNPDIR.V Y 69.84 972.5392 8 -3.7 487.2751 2 68.10 3 38728 AEV_3_3_RA3_01_1233.d 4.5E5 2 2 1713 1720
K.YEAYDAATSVQR.Q Y 68.72 1372.6259 12 9.9 687.3270 2 57.48 2 24356 AEV_1_3_RA2_01_1232.d 2.65E4 1 1 65 76
K.DKSPYAEEMESK.V Y 68.47 1412.6129 12 9.1 707.3202 2 39.06 3 18836 AEV_3_3_RA3_01_1233.d 2.94E5 5 5 1701 1712
K.GAAGGFMFN(+.98)GALQVLNSGLVPGNR.N Y 68.29 2347.1743 24 4.3 783.4021 3 89.80 2 47128 AEV_1_3_RA2_01_1232.d 2.84E5 3 3 1585 1608 Deamidation (NQ)
R.AHGDK(+14.02)VEVFEIPDSSEYTVR.L Y 68.04 2291.1069 20 4.8 573.7867 4 74.94 3 44147 AEV_3_3_RA3_01_1233.d 5.69E5 3 3 1143 1162 Methylation(KR)
K.GANLLIPK.A Y 67.13 824.5120 8 -27.0 413.2521 2 61.83 3 33837 AEV_3_3_RA3_01_1233.d 5.88E5 5 5 1166 1173
R.FLDKPLQK.D Y 66.68 987.5753 8 -7.9 494.7910 2 46.32 2 18594 AEV_1_3_RA2_01_1232.d 1.19E6 5 5 1261 1268
R.Q(-17.03)DALSMYYDIIFGRLK.V Y 65.69 1914.9550 16 0.8 958.4855 2 95.64 3 57506 AEV_3_3_RA3_01_1233.d 7.56E4 2 2 422 437 Pyro-glu from Q
R.QKGNALLGIFQK.Y Y 65.28 1315.7612 12 2.1 439.5953 3 73.69 2 35639 AEV_1_3_RA2_01_1232.d 3.83E5 3 3 1566 1577
K.KPLADVPVTK.A Y 64.82 1066.6385 10 -22.2 534.3147 2 41.29 3 20188 AEV_3_3_RA3_01_1233.d 1.59E5 5 5 175 184
R.WIETQDVILQEKRTER.I Y 64.78 2043.0748 16 -1.4 511.7753 4 66.25 3 37262 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 28 43
R.ALSMNETQIMPQDNDNAK.K Y 64.67 2018.9037 18 3.2 673.9773 3 69.47 2 32454 AEV_1_3_RA2_01_1232.d 1.52E5 2 2 590 607
R.QDALSMYYDIIFGRLK.V Y 63.69 1931.9814 16 16.0 645.0114 3 90.95 2 47688 AEV_1_3_RA2_01_1232.d 5.8E4 1 1 422 437
R.TIASKYE(+14.02)AYDAATSVQR.Q Y 63.17 1886.9374 17 4.3 629.9891 3 65.01 3 36281 AEV_3_3_RA3_01_1233.d 5E4 1 1 60 76 Methylation(others)
K.DKSPYAEEM(+15.99)ESK.V Y 62.53 1428.6078 12 0.8 477.2103 3 21.36 3 8575 AEV_3_3_RA3_01_1233.d 1.68E5 2 2 1701 1712 Oxidation (M)
R.VMLTNIYR.L Y 62.30 1008.5426 8 6.0 505.2816 2 68.11 2 31461 AEV_1_3_RA2_01_1232.d 7.37E5 4 4 790 797
R.IVEIGPADTLGGMARR.T Y 61.96 1654.8824 16 7.6 552.6390 3 72.16 2 34468 AEV_1_3_RA2_01_1232.d 7.78E4 1 1 44 59
K.SSQLQFTSLYR.E Y 61.90 1328.6725 11 1.9 665.3448 2 74.08 2 35933 AEV_1_3_RA2_01_1232.d 1.35E6 6 6 575 585
K.YILAHSGIR.L Y 61.55 1028.5767 9 5.1 343.8679 3 53.06 2 22052 AEV_1_3_RA2_01_1232.d 1.8E6 7 7 1092 1100
K.NGLGWDLDYIVPFAAISEN(+.98)GR.E Y 61.23 2307.1172 21 2.7 1154.5690 2 94.81 2 49271 AEV_1_3_RA2_01_1232.d 9.19E4 2 2 755 775 Deamidation (NQ)
K.AMAEGGPISE(+14.02)YSNR.T Y 61.01 1494.6772 14 -2.9 748.3438 2 64.48 3 35861 AEV_3_3_RA3_01_1233.d 3.18E4 1 1 539 552 Methylation(others)
K.N(+.98)VLMTGAGAGSIGAAVLQGMISGGAK.V Y 60.89 2331.1926 26 11.4 778.0803 3 89.80 2 47127 AEV_1_3_RA2_01_1232.d 1.19E5 1 1 675 700 Deamidation (NQ)
R.VC(+57.02)LVGGFDDFQEEGSYEFANMQATSNAEKEFAHGR.T Y 60.59 3939.7104 35 25.0 985.9595 4 83.35 2 43139 AEV_1_3_RA2_01_1232.d 0 1 1 1322 1356 Carbamidomethylation
R.NFTASEQKYC(+57.02)R.G Y 60.57 1402.6299 11 -0.5 468.5504 3 34.61 3 16088 AEV_3_3_RA3_01_1233.d 6.67E5 4 4 1799 1809 Carbamidomethylation
K.ELGQQLIENC(+57.02)KEVLHANPVYK.D Y 60.48 2481.2686 21 3.0 621.3263 4 75.78 3 44738 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 482 502 Carbamidomethylation
R.YFHN(+.98)GLINNSLFVAK.D Y 60.19 1736.8885 15 12.2 579.9772 3 80.19 2 40715 AEV_1_3_RA2_01_1232.d 4.91E5 3 3 1686 1700 Deamidation (NQ)
K.KLTGIYLDVLESAAR(+14.02).A Y 59.98 1661.9352 15 12.4 554.9926 3 83.05 2 42917 AEV_1_3_RA2_01_1232.d 0 1 1 652 666 Methylation(KR)
K.QD(-18.01)VQALVNYIYDPK.N Y 59.68 1646.8303 14 4.2 824.4259 2 91.40 3 55531 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 741 754 Dehydration
K.FPSPLLDIKYR.R Y 58.85 1347.7550 11 2.4 450.2600 3 77.63 2 38675 AEV_1_3_RA2_01_1232.d 6.22E4 1 1 1432 1442
R.GNINYSEIPRTSAR.K Y 57.99 1576.7958 14 -9.8 526.6007 3 57.13 3 30328 AEV_3_3_RA3_01_1233.d 1.98E5 1 1 518 531
K.YLTGHPK.G Y 57.85 814.4337 7 7.3 408.2271 2 15.30 2 4456 AEV_1_3_RA2_01_1232.d 3.55E5 3 3 1578 1584
K.SSQLQFTSLYREVLR.A Y 56.93 1825.9686 15 4.5 609.6662 3 80.60 2 41074 AEV_1_3_RA2_01_1232.d 2.77E5 3 3 575 589
R.TPQEM(+15.99)SRPTTTTR.S Y 56.77 1520.7253 13 9.7 507.9206 3 17.92 2 5538 AEV_1_3_RA2_01_1232.d 3.29E5 3 3 1357 1369 Oxidation (M)
K.GKPYSGWVDAK.T Y 55.35 1206.6033 11 -0.4 403.2082 3 49.62 3 25498 AEV_3_3_RA3_01_1233.d 1.02E6 6 6 1065 1075
R.SE(+14.02)ITETSTVR.Q Y 54.63 1135.5720 10 -0.3 568.7931 2 44.91 3 22498 AEV_3_3_RA3_01_1233.d 1.89E5 1 1 941 950 Methylation(others)
K.FDYIVYPSR.S Y 54.54 1158.5709 9 -90.2 580.2405 2 78.74 1 40892 AEV 2_3_RA2_01_1224.d 4.95E5 2 2 1620 1628
R.ANIKFEFPKLPNWKEEIEPLNANLK.G Y 54.51 2981.6013 25 -0.6 597.3272 5 83.14 2 42978 AEV_1_3_RA2_01_1232.d 4.26E5 2 2 982 1006
K.GAAGGFMFNGALQVLNS(-2.02)GLVPGNR.N Y 54.33 2344.1746 24 -2.5 782.3969 3 90.12 3 54785 AEV_3_3_RA3_01_1233.d 0 1 1 1585 1608 2-amino-3-oxo-butanoic_acid
K.YLFATLDQATFESYKC(+57.02)K.V Y 54.25 2083.9924 17 3.5 695.6738 3 79.91 3 48000 AEV_3_3_RA3_01_1233.d 5.16E4 1 1 1659 1675 Carbamidomethylation
K.EVLHANPVYK(-1.03)DVAIPTGPQTVIDSR.G Y 53.09 2717.4023 25 -30.1 680.3374 4 75.83 3 44801 AEV_3_3_RA3_01_1233.d 0 1 1 493 517 Lysine oxidation to aminoadipic semialdehyde
R.QDGLLLLALTMEPASR.L Y 51.99 1726.9287 16 -14.5 864.4591 2 90.88 3 55204 AEV_3_3_RA3_01_1233.d 0 2 2 275 290
K.VVNGESSEALYKK.V Y 51.35 1422.7354 13 -5.4 712.3711 2 36.26 3 17107 AEV_3_3_RA3_01_1233.d 2.44E4 1 1 963 975
K.NVLM(+15.99)T(-18.01)GAGAGSIGAAVLQGMISGGAK.V Y 49.84 2328.1929 26 -0.8 777.0710 3 89.65 3 54528 AEV_3_3_RA3_01_1233.d 9.99E4 1 1 675 700 Oxidation (M); Dehydration
R.QKGNALLGIFQKYLTGHPK.G Y 48.97 2112.1843 19 -2.6 423.4431 5 80.29 3 48295 AEV_3_3_RA3_01_1233.d 1.16E5 2 2 1566 1584
R.QDALSMYYDIIFGR.L Y 48.92 1690.8025 14 4.6 846.4124 2 92.93 2 48556 AEV_1_3_RA2_01_1232.d 6.06E4 1 1 422 435
K.Q(-17.03)DVQALVN(+.98)YIYDPK.N Y 47.21 1648.7985 14 8.3 825.4133 2 91.30 3 55426 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 741 754 Pyro-glu from Q; Deamidation (NQ)
R.Q(-17.03)DGLLLLALTM(+15.99)EPASR.L Y 46.51 1725.8971 16 4.4 863.9597 2 94.47 2 49169 AEV_1_3_RA2_01_1232.d 9.55E4 1 1 275 290 Pyro-glu from Q; Oxidation (M)
R.TIASKYEAYDAATSVQ(+.98)R.Q Y 46.18 1873.9058 17 4.4 625.6453 3 63.89 3 35421 AEV_3_3_RA3_01_1233.d 5.03E4 1 1 60 76 Deamidation (NQ)
R.GAPSPQASFAGR(+14.02).W Y 46.06 1158.5781 12 0.1 580.2964 2 56.86 2 24081 AEV_1_3_RA2_01_1232.d 1.8E5 2 2 1810 1821 Methylation(KR)
K.LGLETLFNR.W Y 45.15 1061.5869 9 -1.3 531.8000 2 80.42 3 48395 AEV_3_3_RA3_01_1233.d 0 1 1 840 848
R.GNINYSEIPR(+14.02).T Y 44.80 1175.5935 10 3.4 588.8060 2 67.72 2 31190 AEV_1_3_RA2_01_1232.d 7.44E4 2 2 518 527 Methylation(KR)
K.GNALLGIFQK.Y Y 44.74 1059.6077 10 2.6 530.8125 2 79.15 3 47404 AEV_3_3_RA3_01_1233.d 5.47E4 1 1 1568 1577
R.GSQLVVVPFNQGSK(+14.02).Q Y 44.48 1472.7987 14 0.8 737.4072 2 73.85 2 35766 AEV_1_3_RA2_01_1232.d 4.12E4 1 1 727 740 Methylation(KR)
K.DKSPYAEEM(-48.00)ESK.V Y 44.38 1364.6095 12 3.1 455.8785 3 13.13 3 4101 AEV_3_3_RA3_01_1233.d 6.96E5 6 6 1701 1712 Dethiomethyl
R.T(+14.02)IASKYEAYDAATSVQR.Q Y 44.34 1886.9374 17 7.3 629.9910 3 65.78 2 29799 AEV_1_3_RA2_01_1232.d 4.32E4 1 1 60 76 Methylation(others)
K.Q(-17.03)KTEAEDVQM(+15.99)QQTR.Q Y 43.98 1689.7628 14 -1.7 845.8872 2 35.64 3 16716 AEV_3_3_RA3_01_1233.d 5.48E4 1 1 1748 1761 Pyro-glu from Q; Oxidation (M)
R.AHGDK(+14.02)VEVFEIPD(-18.01)SSEYTVR.L Y 43.70 2273.0964 20 41.3 569.3049 4 73.50 3 42978 AEV_3_3_RA3_01_1233.d 1.64E5 2 2 1143 1162 Methylation(KR); Dehydration
R.S(+43.01)VPAPGKGVLTTAR.E Y 43.54 1395.7833 14 -71.9 466.2349 3 53.37 3 27956 AEV_3_3_RA3_01_1233.d 1.2E5 2 2 1413 1426 Carbamylation
R.LGSEADAK.A Y 42.98 789.3868 8 -86.0 395.6667 2 19.50 1 4644 AEV 2_3_RA2_01_1224.d 3.34E4 2 2 291 298
R.SLQTDGIK.A Y 42.48 860.4603 8 -2.3 431.2365 2 31.01 3 14031 AEV_3_3_RA3_01_1233.d 1.62E6 7 7 1629 1636
R.AGLSFYGK.N Y 41.63 841.4333 8 -1.3 421.7234 2 60.61 3 32873 AEV_3_3_RA3_01_1233.d 4.39E5 5 5 667 674
K.AYLDDVANK.Y Y 41.52 1007.4923 9 8.2 504.7576 2 52.33 2 21658 AEV_1_3_RA2_01_1232.d 3.74E5 2 2 299 307
R.WGLQSGRQDGLLLLALTM(+15.99)EPASR.L Y 40.67 2527.3215 23 0.7 843.4484 3 86.88 2 45545 AEV_1_3_RA2_01_1232.d 4.85E4 1 1 268 290 Oxidation (M)
R.EIDSIDSK.S Y 40.37 905.4341 8 -62.2 453.6962 2 38.10 1 13332 AEV 2_3_RA2_01_1224.d 1.13E5 1 1 776 783
R.Q(-17.03)DALSMYYDIIFGR.L Y 39.86 1673.7759 14 4.7 837.8992 2 97.82 3 58348 AEV_3_3_RA3_01_1233.d 0 1 1 422 435 Pyro-glu from Q
K.VVNGESSEALYK.K Y 39.80 1294.6405 12 -12.8 648.3192 2 47.41 3 24121 AEV_3_3_RA3_01_1233.d 1.05E5 2 2 963 974
K.QKTEAEDVQM(+15.99)QQTR.Q Y 39.47 1706.7893 14 1.9 569.9381 3 18.94 3 7266 AEV_3_3_RA3_01_1233.d 4.61E4 1 1 1748 1761 Oxidation (M)
R.ENAGKFPSPLLDIK.Y Y 39.41 1527.8296 14 -13.9 510.2767 3 74.59 3 43809 AEV_3_3_RA3_01_1233.d 8.04E5 4 4 1427 1440
R.LLKGANLLIPK.A Y 39.25 1178.7750 11 -3.2 393.9310 3 71.02 2 33604 AEV_1_3_RA2_01_1232.d 3.35E5 3 3 1163 1173
K.YEKY(+31.99)ILAHSGIR.L Y 39.14 1480.7673 12 60.0 371.2213 4 53.07 2 22014 AEV_1_3_RA2_01_1232.d 4.3E5 1 1 1089 1100 Dihydroxy
R.Q(-17.03)DALSM(+15.99)YYDIIFGR.L Y 38.81 1689.7709 14 -22.7 845.8735 2 96.16 3 57715 AEV_3_3_RA3_01_1233.d 0 1 1 422 435 Pyro-glu from Q; Oxidation (M)
R.SEIT(+14.02)ETSTVR.Q Y 38.77 1135.5720 10 -0.6 568.7930 2 45.34 3 22779 AEV_3_3_RA3_01_1233.d 3.03E5 3 3 941 950 Methylation(others)
R.NADNIDKVMEK(+14.02)FDYIVYPSR.S Y 38.66 2430.1890 20 4.2 608.5571 4 81.69 3 49363 AEV_3_3_RA3_01_1233.d 9.9E4 1 1 1609 1628 Methylation(KR)
R.VLVAQK.L Y 38.49 656.4221 6 -91.3 329.1884 2 31.00 1 9515 AEV 2_3_RA2_01_1224.d 4.48E5 2 2 167 172
K.LR(+14.02)SEITETSTVR.Q Y 37.83 1404.7572 12 -24.4 469.2482 3 50.12 3 25821 AEV_3_3_RA3_01_1233.d 1.21E5 2 2 939 950 Methylation(KR)
R.EN(+.98)AGKFPSPLLDIKYR.R Y 37.70 1847.9780 16 -13.4 616.9917 3 74.48 2 36236 AEV_1_3_RA2_01_1232.d 0 1 1 1427 1442 Deamidation (NQ)
R.TKVQNDLR.S Y 37.62 972.5352 8 -3.4 487.2733 2 15.85 3 5571 AEV_3_3_RA3_01_1233.d 7.6E5 2 2 553 560
K.VITEPR.A Y 37.61 713.4072 6 -0.2 357.7108 2 21.46 3 8635 AEV_3_3_RA3_01_1233.d 6.39E5 4 4 976 981
R.VEHIKR.E Y 37.19 780.4606 6 -3.2 391.2363 2 9.50 2 2316 AEV_1_3_RA2_01_1232.d 2.73E4 3 3 1489 1494
K.AMAE(+14.02)GGPISEYSNR.T Y 37.16 1494.6772 14 -0.8 748.3453 2 65.09 3 36347 AEV_3_3_RA3_01_1233.d 3.75E4 2 2 539 552 Methylation(others)
R.QM(-48.00)VESLAK.A Y 36.34 856.4654 8 -2.2 429.2390 2 15.61 3 5465 AEV_3_3_RA3_01_1233.d 1.15E5 1 1 1762 1769 Dethiomethyl
K.VETVPFLHLR.K Y 36.31 1209.6870 10 0.6 404.2365 3 75.85 2 37269 AEV_1_3_RA2_01_1232.d 2.73E5 2 2 631 640
K.SSQLQFTSLYR(+14.02).E Y 35.66 1342.6881 11 -5.1 672.3479 2 75.72 3 44726 AEV_3_3_RA3_01_1233.d 1.31E5 2 2 575 585 Methylation(KR)
MRPEVEQELAHTLLVELLAY(-2.02)QFASPVR.W Y 35.53 3136.6379 27 -12.5 785.1570 4 94.04 3 56804 AEV_3_3_RA3_01_1233.d 0 1 1 1 27 2-amino-3-oxo-butanoic_acid
R.NADNIDKVM(+15.99)EKFDYIVYPSR.S Y 35.39 2432.1682 20 -12.7 609.0416 4 75.96 3 44886 AEV_3_3_RA3_01_1233.d 0 1 1 1609 1628 Oxidation (M)
R.GNIN(+.98)YSEIPR.T Y 35.36 1162.5618 10 6.0 582.2916 2 64.55 2 28985 AEV_1_3_RA2_01_1232.d 6.57E5 3 3 518 527 Deamidation (NQ)
R.AHGDKVEVFEIPDSSEYTVR(+14.02).L Y 35.10 2291.1069 20 -0.5 764.7092 3 75.13 3 44240 AEV_3_3_RA3_01_1233.d 1.21E5 1 1 1143 1162 Methylation(KR)
R.STGLMNSN(+.98)DILAEGVEK.L Y 34.61 1777.8403 17 -71.6 889.8638 2 80.22 1 42010 AEV 2_3_RA2_01_1224.d 2.69E4 1 1 870 886 Deamidation (NQ)
R.KLEHYVK.A Y 34.25 915.5178 7 0.2 458.7662 2 16.08 3 5715 AEV_3_3_RA3_01_1233.d 0 1 1 532 538
R.S(-2.02)LQTDGIKAFSVTSFGFGQK.G Y 33.97 2115.0637 20 21.6 706.0438 3 81.94 2 42080 AEV_1_3_RA2_01_1232.d 6.67E4 1 1 1629 1648 2-amino-3-oxo-butanoic_acid
K.LRSEITE(+14.02)TSTVR.Q Y 33.71 1404.7572 12 -35.7 469.2430 3 50.94 3 26330 AEV_3_3_RA3_01_1233.d 0 1 1 939 950 Methylation(others)
K.AM(-48.00)AEGGPISEYSNR.T Y 32.83 1432.6582 14 -86.6 478.5187 3 55.93 1 23777 AEV 2_3_RA2_01_1224.d 3.38E5 1 1 539 552 Dethiomethyl
R.VMLTNIYR(+14.02).L Y 32.43 1022.5583 8 -4.4 512.2842 2 71.20 2 33742 AEV_1_3_RA2_01_1232.d 4.36E4 1 1 790 797 Methylation(KR)
K.AM(+15.99)AEGGPISEYS(-18.01)NR.T Y 32.10 1478.6460 14 -41.5 740.2996 2 67.46 1 31999 AEV 2_3_RA2_01_1224.d 4.41E4 1 1 539 552 Oxidation (M); Dehydration
K.RTERIVEIGPADTLGGMAR.R Y 32.00 2041.0739 19 -68.6 409.1940 5 37.82 1 13182 AEV 2_3_RA2_01_1224.d 0 1 1 40 58
R.SEITE(+14.02)TSTVR.Q Y 31.58 1135.5720 10 -2.6 568.7918 2 47.23 2 19047 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 941 950 Methylation(others)
R.TPQEMSRPTTTTR(+14.02).S Y 31.01 1518.7461 13 11.0 507.2615 3 37.78 2 14413 AEV_1_3_RA2_01_1232.d 8.57E4 1 1 1357 1369 Methylation(KR)
K.YVHISEVGNC(+57.02)IGSGIGGSHALR.G Y 30.93 2282.1226 22 -80.6 571.4919 4 78.97 1 41021 AEV 2_3_RA2_01_1224.d 1.97E5 1 1 1233 1254 Carbamidomethylation
K.G(+42.01)AAGGFM(+15.99)FNGALQVLNSGLVPGNR.N Y 30.50 2404.1958 24 0.3 802.4061 3 84.05 3 51056 AEV_3_3_RA3_01_1233.d 2.83E5 3 3 1585 1608 Acetylation (N-term); Oxidation (M)
K.ETAEEFKR.A Y 30.47 1008.4875 8 4.7 505.2534 2 19.00 3 7305 AEV_3_3_RA3_01_1233.d 4.95E4 1 1 1135 1142
R.GAPSPQ(+.98)ASFAGR.W Y 30.10 1145.5465 12 5.7 573.7838 2 54.06 2 22524 AEV_1_3_RA2_01_1232.d 2.4E5 2 2 1810 1821 Deamidation (NQ)
R.TPQEM(+15.99)SRPTTTTR(+14.02).S Y 29.90 1534.7410 13 3.2 512.5892 3 23.81 3 9906 AEV_3_3_RA3_01_1233.d 6.47E4 1 1 1357 1369 Oxidation (M); Methylation(KR)
R.VELNEM(+15.99)T(-18.01)STLGYAGNDR.N Y 29.74 1866.8418 17 38.4 623.3118 3 76.07 2 37462 AEV_1_3_RA2_01_1232.d 0 1 1 1721 1737 Oxidation (M); Dehydration
K.NVLM(+15.99)TGAGAGS(-18.01)IGAAVLQGMISGGAK.V Y 29.73 2328.1929 26 4.4 777.0750 3 89.88 2 47175 AEV_1_3_RA2_01_1232.d 2.23E4 1 1 675 700 Oxidation (M); Dehydration
R.ENAGK.F N 29.26 517.2496 5 -146.0 518.1814 1 56.69 1 24233 AEV 2_3_RA2_01_1224.d 1.13E5 3 3 1427 1431
K.Q(-17.03)DVQALVNYIYDPK(+14.02).N Y 28.77 1661.8301 14 -3.2 831.9196 2 92.00 2 48169 AEV_1_3_RA2_01_1232.d 4.03E4 1 1 741 754 Pyro-glu from Q; Methylation(KR)
R.LLGFVK.T Y 28.73 675.4319 6 -10.3 338.7197 2 67.70 2 31145 AEV_1_3_RA2_01_1232.d 3.75E5 3 3 798 803
R.FVAGQIPTGWN(+.98)PK.H Y 28.57 1414.7245 13 7.4 708.3748 2 74.93 3 44063 AEV_3_3_RA3_01_1233.d 9.05E4 1 1 1180 1192 Deamidation (NQ)
R.WS(+79.97)AKEAVFKSLGVEGK(+42.01).G Y 28.36 1856.9073 16 33.4 619.9971 3 71.71 3 41568 AEV_3_3_RA3_01_1233.d 1.76E4 1 1 1822 1837 Phosphorylation (STY); Acetylation (K)
R.GNINYSEIP(+13.98)R.T Y 28.34 1175.5571 10 -52.0 588.7552 2 74.26 1 37278 AEV 2_3_RA2_01_1224.d 1.32E5 1 1 518 527 Proline oxidation to pyroglutamic acid
R.ENAGKFPS(-2.02)PLLDIKYR.R Y 28.22 1844.9784 16 -55.5 462.2263 4 74.42 2 36187 AEV_1_3_RA2_01_1232.d 0 2 2 1427 1442 2-amino-3-oxo-butanoic_acid
K.NGLGWDLDYIVPFAAISENGR(+14.02).E Y 27.95 2320.1487 21 18.0 774.4041 3 93.23 3 56435 AEV_3_3_RA3_01_1233.d 7.08E4 1 1 755 775 Methylation(KR)
R.Q(+.98)KGNALLGIFQK.Y Y 27.69 1316.7452 12 7.0 439.9254 3 75.23 2 36791 AEV_1_3_RA2_01_1232.d 5.32E4 1 1 1566 1577 Deamidation (NQ)
R.NGN(+.98)GNGR(+14.02).N Y 27.49 702.3045 7 -27.5 352.1499 2 43.38 1 16347 AEV 2_3_RA2_01_1224.d 0 1 1 1738 1744 Deamidation (NQ); Methylation(KR)
K.GAAGGFM(+15.99)FNGALQVLNSGLVPGNR.N Y 27.45 2362.1851 24 10.7 788.4107 3 87.67 2 46009 AEV_1_3_RA2_01_1232.d 1.49E5 1 1 1585 1608 Oxidation (M)
R.SVPAPGK.G N 27.44 654.3701 7 -90.6 328.1627 2 23.07 1 5758 AEV 2_3_RA2_01_1224.d 1.5E5 1 1 1413 1419
R.G(+42.01)APSPQASFAGR.W Y 27.37 1186.5730 12 6.2 396.5341 3 15.42 3 5349 AEV_3_3_RA3_01_1233.d 3.75E4 1 1 1810 1821 Acetylation (N-term)
R.ENAGKFPSPLLDIKYRR.R Y 26.76 2003.0952 17 -23.4 401.6169 5 68.59 3 39122 AEV_3_3_RA3_01_1233.d 0 1 1 1427 1443
R.N(+.98)GNGNGR.N Y 26.75 688.2889 7 -44.0 689.2659 1 71.70 1 35269 AEV 2_3_RA2_01_1224.d 6.67E4 1 1 1738 1744 Deamidation (NQ)
R.S(+14.02)EITETSTVR.Q Y 26.71 1135.5720 10 0.8 568.7938 2 46.60 2 18729 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 941 950 Methylation(others)
R.QILC(+57.02)YNKDAK.E Y 26.59 1251.6282 10 7.6 418.2198 3 35.81 3 16824 AEV_3_3_RA3_01_1233.d 0 1 1 77 86 Carbamidomethylation
K.V(+27.99)IT(+79.97)EPR.A Y 26.44 821.3684 6 35.7 822.4050 1 90.87 3 55192 AEV_3_3_RA3_01_1233.d 0 1 1 976 981 Formylation; Phosphorylation (STY)
K.Q(+.98)SSSLVAR(+14.02).L Y 26.21 861.4556 8 -3.9 431.7334 2 68.95 3 39414 AEV_3_3_RA3_01_1233.d 7.04E4 1 1 238 245 Deamidation (NQ); Methylation(KR)
K.AQAVEPFN(+.98)EDEYMQER.V Y 26.15 1955.8207 16 35.5 652.9706 3 71.98 2 34331 AEV_1_3_RA2_01_1232.d 0 1 1 1473 1488 Deamidation (NQ)
R.WSAK(+42.01)EAVFKSLGVEGK(+14.02).G Y 26.05 1790.9567 16 9.4 359.2020 5 45.95 3 23160 AEV_3_3_RA3_01_1233.d 0 1 1 1822 1837 Acetylation (K); Methylation(KR)
R.EIDS(-2.02)IDSKSELAHR.V Y 25.97 1596.7743 14 -53.7 533.2368 3 47.91 2 19428 AEV_1_3_RA2_01_1232.d 0 1 1 776 789 2-amino-3-oxo-butanoic_acid
R.AHGDK.V Y 25.93 526.2499 5 -101.7 527.2037 1 32.56 1 10390 AEV 2_3_RA2_01_1224.d 7.85E4 3 3 1143 1147
K.DVAIPTGPQTVIDS(+79.97)R.G Y 25.80 1647.7869 15 50.3 824.9421 2 96.07 3 57677 AEV_3_3_RA3_01_1233.d 3.11E3 1 1 503 517 Phosphorylation (STY)
K.KPLADVPVT(+79.96)K.A Y 25.54 1146.5955 10 -9.5 383.2021 3 41.41 3 20275 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 175 184 Sulfation
R.T(+42.01)IASK.Y Y 25.16 560.3170 5 -26.7 561.3093 1 70.18 2 32979 AEV_1_3_RA2_01_1232.d 0 1 1 60 64 Acetylation (N-term)
R.QMVESLAK.A Y 24.72 904.4688 8 -5.6 453.2392 2 43.08 2 16996 AEV_1_3_RA2_01_1232.d 0 1 1 1762 1769
K.GVLTTAR.E Y 24.54 716.4181 7 -90.9 359.1838 2 44.17 1 16781 AEV 2_3_RA2_01_1224.d 8.37E5 4 4 1420 1426
K.YEKYILAHSGIR.L Y 23.96 1448.7776 12 11.8 363.2059 4 58.99 2 25221 AEV_1_3_RA2_01_1232.d 3.67E4 1 1 1089 1100
R.LKVVDREIVSQC(+57.02)IR.I Y 23.81 1713.9559 14 -81.3 429.4614 4 74.43 1 37410 AEV 2_3_RA2_01_1224.d 1.32E5 1 1 436 449 Carbamidomethylation
R.S(+42.01)TGLM(+15.99)NSNDILAEGVEK.L Y 23.46 1834.8618 17 -0.7 612.6274 3 61.51 3 33592 AEV_3_3_RA3_01_1233.d 7.28E4 1 1 870 886 Acetylation (N-term); Oxidation (M)
K.E(+43.01)AVFK(+42.01)SLGVEGK.G Y 23.40 1347.7034 12 -19.4 674.8459 2 68.27 3 38870 AEV_3_3_RA3_01_1233.d 9.51E4 1 1 1826 1837 Carbamylation; Acetylation (K)
R.SEITETSTVR(+14.02).Q Y 23.38 1135.5720 10 -6.7 568.7895 2 50.34 2 20613 AEV_1_3_RA2_01_1232.d 3.41E4 1 1 941 950 Methylation(KR)
K.T(+79.97)EAEDVQMQQT(+79.97)R.Q Y 23.29 1594.5736 12 64.5 532.5661 3 56.18 1 23938 AEV 2_3_RA2_01_1224.d 0 1 1 1750 1761 Phosphorylation (STY)
R.WSAKEAVFK.S Y 23.29 1064.5654 9 -11.0 533.2841 2 57.62 3 30669 AEV_3_3_RA3_01_1233.d 6.43E4 2 2 1822 1830
R.L(+43.01)GSEADAK.A Y 23.18 832.3926 8 -98.5 417.1626 2 19.59 1 4668 AEV 2_3_RA2_01_1224.d 0 1 1 291 298 Carbamylation
K.EANGWEYSK.K Y 23.15 1082.4668 9 4.4 542.2430 2 40.34 3 19602 AEV_3_3_RA3_01_1233.d 1.64E5 2 2 643 651
K.T(+41.03)GEPVNDRDVK.A Y 23.14 1269.6313 11 19.7 424.2261 3 18.96 3 7292 AEV_3_3_RA3_01_1233.d 4.01E5 1 1 1076 1086 Amidination of lysines or N-terminal amines with methyl acetimidate
K.SLGVEGK(+14.02)GAGAP(+31.99)LR.D Y 23.12 1356.7361 14 6.1 340.1934 4 37.75 3 18035 AEV_3_3_RA3_01_1233.d 0 1 1 1831 1844 Methylation(KR); Dihydroxy
K.VIT(+79.96)EPR.A Y 23.03 793.3640 6 25.7 794.3917 1 67.76 2 31197 AEV_1_3_RA2_01_1232.d 2.63E4 1 1 976 981 Sulfation
R.STGLMNSNDILAEGVEK(+14.02).L Y 22.87 1790.8719 17 -1.9 896.4415 2 77.88 3 46406 AEV_3_3_RA3_01_1233.d 4.18E4 1 1 870 886 Methylation(KR)
K.KVITEPR.A Y 22.83 841.5021 7 4.4 421.7602 2 19.85 2 6346 AEV_1_3_RA2_01_1232.d 9.3E4 2 2 975 981
R.ENAGK(+31.99).F N 22.77 549.2394 5 30.6 550.2635 1 17.26 2 5270 AEV_1_3_RA2_01_1232.d 0 1 1 1427 1431 Dihydroxy
K.GSRN(+.98)VSRS(+79.97)R.M Y 22.61 1098.4932 9 46.1 550.2792 2 64.93 3 36214 AEV_3_3_RA3_01_1233.d 9.82E4 1 1 609 617 Deamidation (NQ); Phosphorylation (STY)
R.ENAGK(+43.99).F N 22.37 561.2394 5 -35.9 562.2266 1 57.73 1 24903 AEV 2_3_RA2_01_1224.d 2.15E4 1 1 1427 1431 Carboxylation (DKW)
R.LVSSK.M N 22.35 532.3220 5 -219.6 533.2124 1 17.18 1 4063 AEV 2_3_RA2_01_1224.d 0 1 1 246 250
K.IGRS(+79.97)VPAPGKGVLTTAR.E Y 22.30 1758.9506 17 23.4 587.3378 3 64.36 2 28811 AEV_1_3_RA2_01_1232.d 0 1 1 1410 1426 Phosphorylation (STY)
R.WGLQSGR.Q Y 22.23 802.4086 7 1.3 402.2121 2 46.57 3 23548 AEV_3_3_RA3_01_1233.d 0 1 1 268 274
R.L(+42.01)GSEADAK.A Y 22.14 831.3974 8 37.9 832.4362 1 85.42 3 51980 AEV_3_3_RA3_01_1233.d 0 1 1 291 298 Acetylation (N-term)
K.VEVFEIPDSSEYTVR.L Y 22.00 1768.8519 15 8.4 885.4407 2 80.21 2 40734 AEV_1_3_RA2_01_1232.d 2.87E4 1 1 1148 1162
R.LGSEADAK(+14.02).A Y 21.92 803.4025 8 -81.5 402.6758 2 30.77 1 9374 AEV 2_3_RA2_01_1224.d 1.51E5 1 1 291 298 Methylation(KR)
R.S(+42.01)VPAPGK.G N 21.83 696.3806 7 -117.1 349.1568 2 23.53 1 5936 AEV 2_3_RA2_01_1224.d 0 1 1 1413 1419 Acetylation (N-term)
K.ALKFDR.F Y 21.81 748.4232 6 8.4 375.2220 2 28.38 2 9979 AEV_1_3_RA2_01_1232.d 1.73E5 1 1 1174 1179
R.QAVMKETTLEN(+162.05)K.V Y 21.68 1552.7654 12 -30.8 389.1867 4 10.01 2 2490 AEV_1_3_RA2_01_1232.d 0 1 1 951 962 Hexose (NSY)
R.LVS(+79.97)SK.M N 21.61 612.2884 5 77.0 613.3428 1 46.39 3 23436 AEV_3_3_RA3_01_1233.d 1.92E4 2 2 246 250 Phosphorylation (STY)
K.G(+42.01)KPYSGWVDAK(+31.99).T Y 21.42 1280.6036 11 -18.4 321.1523 4 59.09 1 25829 AEV 2_3_RA2_01_1224.d 0 1 1 1065 1075 Acetylation (N-term); Dihydroxy
K.SELAHR.V Y 21.41 711.3663 6 -31.9 712.3509 1 83.20 3 50454 AEV_3_3_RA3_01_1233.d 7.83E4 1 1 784 789
K.DLVGGK(+114.04).S Y 21.39 701.3708 6 -60.5 702.3356 1 86.01 1 46572 AEV 2_3_RA2_01_1224.d 0 1 1 188 193 Ubiquitin
R.G(+56.06)APSPQASFAGR.W Y 21.33 1200.6251 12 -33.6 601.2997 2 48.01 3 24456 AEV_3_3_RA3_01_1233.d 0 1 1 1810 1821 Diethylation
K.SLGVEGK(+27.99).G Y 21.24 716.3704 7 -22.9 717.3613 1 85.49 3 52030 AEV_3_3_RA3_01_1233.d 0 1 1 1831 1837 Formylation
K.VQNDLR(-.98).S Y 21.21 742.4086 6 -139.9 743.3120 1 89.66 1 49370 AEV 2_3_RA2_01_1224.d 0 1 1 555 560 Amidation
K.STLQNEILGDLGK(+42.01).E Y 21.18 1428.7460 13 -16.0 358.1880 4 54.43 1 22814 AEV 2_3_RA2_01_1224.d 0 1 1 194 206 Acetylation (K)
R.S(+42.01)(-18.01)LQTDGIK.A Y 21.00 884.4603 8 -18.5 443.2292 2 13.95 3 4549 AEV_3_3_RA3_01_1233.d 2.61E4 1 1 1629 1636 Acetylation (N-term); Dehydration
K.KLRSE(+21.98)ITET(+79.97)STVR.Q Y 20.96 1620.7848 13 23.8 325.1719 5 60.96 3 33155 AEV_3_3_RA3_01_1233.d 0 1 1 938 950 Sodium adduct; Phosphorylation (STY)
R.NGNGN(+.98)GR(+28.03).N Y 20.80 716.3201 7 -42.2 717.2972 1 73.01 1 36301 AEV 2_3_RA2_01_1224.d 9.2E4 1 1 1738 1744 Deamidation (NQ); Dimethylation(KR)
R.EIVSQC(+57.02)IR.I Y 20.72 1003.5120 8 4.2 502.7654 2 44.61 3 22371 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 442 449 Carbamidomethylation
R.RTIASKYEAYD(+21.98)AATSVQR.Q Y 20.66 2051.0046 18 10.7 513.7639 4 78.55 2 39412 AEV_1_3_RA2_01_1232.d 0 1 1 59 76 Sodium adduct
R.ENAGK(-.98).F N 20.43 516.2656 5 -25.1 517.2599 1 18.09 2 5605 AEV_1_3_RA2_01_1232.d 0 1 1 1427 1431 Amidation
R.VM(+15.99)LTNIYR.L Y 20.38 1024.5376 8 -7.5 513.2722 2 65.61 2 29672 AEV_1_3_RA2_01_1232.d 1.59E5 2 2 790 797 Oxidation (M)
K.SLGVEGKGAGAPLR.D Y 20.37 1310.7306 14 -25.7 328.6815 4 39.73 2 15336 AEV_1_3_RA2_01_1232.d 4.81E5 2 2 1831 1844
K.SLGVEGK(+42.01).G Y 20.34 730.3861 7 -93.3 366.1663 2 29.91 1 8909 AEV 2_3_RA2_01_1224.d 1.62E5 2 2 1831 1837 Acetylation (K)
K.A(+42.01)MAEGGPISEYSNR.T Y 20.24 1522.6721 14 -9.2 381.6718 4 76.19 1 38811 AEV 2_3_RA2_01_1224.d 0 1 1 539 552 Acetylation (N-term)
R.T(+42.01)PQ(+.98)EMSR(+14.02)PTTTTR.S Y 20.20 1561.7406 13 14.0 391.4479 4 12.11 2 3261 AEV_1_3_RA2_01_1232.d 5.81E4 1 1 1357 1369 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
R.RTIAS(+79.97)K.Y Y 20.17 754.3738 6 23.2 378.2029 2 19.77 2 6305 AEV_1_3_RA2_01_1232.d 4.39E3 1 1 59 64 Phosphorylation (STY)
K.VQ(+.98)NDLR.S Y 20.13 744.3766 6 -20.2 745.3688 1 80.70 2 41117 AEV_1_3_RA2_01_1232.d 0 1 1 555 560 Deamidation (NQ)
R.LGSE(+43.99)ADAK.A Y 20.12 833.3766 8 -27.2 417.6843 2 47.98 1 19072 AEV 2_3_RA2_01_1224.d 0 1 1 291 298 Carboxylation (E)
R.SVPAPGK(+14.02).G N 20.11 668.3857 7 -17.6 669.3812 1 19.06 3 7327 AEV_3_3_RA3_01_1233.d 0 1 1 1413 1419 Methylation(KR)
K.S(-18.01)LGVEGKGAGAPLR.D Y 20.02 1292.7200 14 -1.8 324.1867 4 45.28 3 22743 AEV_3_3_RA3_01_1233.d 9.73E4 2 2 1831 1844 Dehydration
R.N(+43.01)ADNIDK.V Y 19.84 831.3723 7 -20.4 832.3625 1 90.96 1 50318 AEV 2_3_RA2_01_1224.d 2.43E4 1 1 1609 1615 Carbamylation
R.LIEPELFNGYDPNNK.V Y 19.83 1761.8573 15 -0.2 881.9358 2 79.05 3 47323 AEV_3_3_RA3_01_1233.d 5.61E4 1 1 1101 1115
K.DLVGGKSTLQN(+.98)E(+43.99)ILGDLGK.E Y 19.77 2001.0266 19 11.0 501.2694 4 81.77 3 49425 AEV_3_3_RA3_01_1233.d 0 1 1 188 206 Deamidation (NQ); Carboxylation (E)
R.ALSM(+15.99)NETQIMPQDNDNAK.K Y 19.68 2034.8987 18 15.7 679.3175 3 62.12 2 27274 AEV_1_3_RA2_01_1232.d 6.97E4 1 1 590 607 Oxidation (M)
K.ETTLENK(-.98)(+42.01).V Y 19.62 874.4396 7 16.2 875.4611 1 79.80 2 40403 AEV_1_3_RA2_01_1232.d 4.03E3 1 1 956 962 Amidation; Acetylation (K)
K.K(+43.99)EANGWEY(+79.97)SKK.L Y 19.59 1462.6129 11 6.7 732.3186 2 81.99 1 43399 AEV 2_3_RA2_01_1224.d 4.65E4 1 1 642 652 Carboxylation (DKW); Phosphorylation (STY)
K.FDYIVYPSRSLQTDGIK.A Y 19.54 2001.0206 17 25.4 501.2751 4 39.94 2 15435 AEV_1_3_RA2_01_1232.d 0 1 1 1620 1636
R.FVAGQ(+.98)IPTGWNPK.H Y 19.52 1414.7245 13 -0.9 708.3689 2 76.45 2 37751 AEV_1_3_RA2_01_1232.d 2.37E4 1 1 1180 1192 Deamidation (NQ)
K.TGEPVND(-18.01)R.D Y 19.48 868.4039 8 -14.2 435.2031 2 62.97 1 28811 AEV 2_3_RA2_01_1224.d 0 1 1 1076 1083 Dehydration
R.AHGDKVEVFEIPD(-15.99)SSEYTVR.L Y 19.42 2261.0964 20 31.0 566.2989 4 73.42 3 42915 AEV_3_3_RA3_01_1233.d 2.22E5 1 1 1143 1162 Deoxy
R.QDALSMYYDIIFGR(+21.98).L Y 19.10 1712.7844 14 -14.3 429.1973 4 54.85 1 23076 AEV 2_3_RA2_01_1224.d 0 1 1 422 435 Sodium adduct
R.QILCYNKDAK(+42.01).E Y 18.99 1236.6172 10 -0.9 619.3153 2 43.01 2 16963 AEV_1_3_RA2_01_1232.d 0 1 1 77 86 Acetylation (K)
K.ATAAENSK(+42.01).V Y 18.94 832.3926 8 -64.2 833.3465 1 93.78 1 52324 AEV 2_3_RA2_01_1224.d 5.53E4 2 2 1770 1777 Acetylation (K)
R.GETYKLAK(+43.99)ELGQQLIENC(+57.02)K(+42.01).E Y 18.81 2307.1416 19 16.6 577.8022 4 68.03 3 38672 AEV_3_3_RA3_01_1233.d 1.77E5 1 1 474 492 Carboxylation (DKW); Carbamidomethylation; Acetylation (K)
K.ATAAENS(+79.97)K(+14.02).V Y 18.80 884.3641 8 -32.4 885.3427 1 95.63 1 53589 AEV 2_3_RA2_01_1224.d 6.14E4 1 1 1770 1777 Phosphorylation (STY); Methylation(KR)
R.TIASK(+43.99).Y Y 18.76 562.2962 5 -25.2 563.2893 1 22.64 3 9237 AEV_3_3_RA3_01_1233.d 4.25E4 1 1 60 64 Carboxylation (DKW)
K.ATAAENSK(+42.02).V Y 18.74 832.4039 8 16.5 833.4249 1 87.38 3 53245 AEV_3_3_RA3_01_1233.d 0 1 1 1770 1777 Guanidination
R.I(+27.99)VEIGPADTLGGMAR(+14.02)R.T Y 18.74 1696.8929 16 1.5 425.2311 4 46.16 2 18516 AEV_1_3_RA2_01_1232.d 0 1 1 44 59 Formylation; Methylation(KR)
R.ENAGK(+14.02).F N 18.72 531.2653 5 -29.1 532.2571 1 42.32 2 16623 AEV_1_3_RA2_01_1232.d 1.34E4 2 2 1427 1431 Methylation(KR)
K.Y(+27.99)LETR.W N 18.68 708.3442 5 -90.3 709.2875 1 66.42 1 31196 AEV 2_3_RA2_01_1224.d 0 1 1 263 267 Formylation
R.E(+14.02)VTGYYQTMYTR.Y Y 18.62 1524.6919 12 5.2 763.3572 2 68.16 2 31479 AEV_1_3_RA2_01_1232.d 2.33E4 1 1 711 722 Methylation(others)
K.VQNDLR(-43.05).S Y 18.46 700.3392 6 -80.1 351.1488 2 21.88 1 5344 AEV 2_3_RA2_01_1224.d 0 1 1 555 560 Arginine oxidation to glutamic semialdehyde
K.EAVFKS(-18.01)LGVEGK(+42.01).G Y 18.41 1286.6870 12 -27.8 644.3329 2 45.96 2 18411 AEV_1_3_RA2_01_1232.d 0 1 1 1826 1837 Dehydration; Acetylation (K)
K.KGSRNVSR(+28.03).S Y 18.28 930.5359 8 -31.9 311.1760 3 34.24 3 15868 AEV_3_3_RA3_01_1233.d 1.76E4 1 1 608 615 Dimethylation(KR)
K.ELGQQLIENC(+57.02)K.E Y 18.19 1330.6550 11 -89.1 666.2755 2 70.79 1 34564 AEV 2_3_RA2_01_1224.d 6.24E4 1 1 482 492 Carbamidomethylation
K.E(+43.01)VLHANPVYK.D Y 18.19 1211.6299 10 -2.8 606.8205 2 69.57 2 32525 AEV_1_3_RA2_01_1232.d 0 1 1 493 502 Carbamylation
R.MNGNINGNTRPGKVETVPFLHLR.K Y 18.18 2563.3442 23 -42.3 513.6544 5 71.33 2 33842 AEV_1_3_RA2_01_1232.d 0 1 1 618 640
R.TPQEMS(+79.97)RPTTTTR.S Y 18.07 1584.6968 13 -20.9 529.2285 3 77.03 1 39480 AEV 2_3_RA2_01_1224.d 4.49E4 1 1 1357 1369 Phosphorylation (STY)
R.VMLTN(+.98)IYR.L Y 18.04 1009.5267 8 -16.8 1010.5170 1 84.07 3 51068 AEV_3_3_RA3_01_1233.d 6.33E4 1 1 790 797 Deamidation (NQ)
K.LRSEITETSTVR(-.98).Q Y 17.96 1389.7576 12 -71.0 464.2269 3 42.70 3 21096 AEV_3_3_RA3_01_1233.d 0 1 1 939 950 Amidation
K.FEFPK.L Y 17.94 666.3376 5 -92.9 334.1451 2 69.77 1 33770 AEV 2_3_RA2_01_1224.d 1.05E5 2 2 986 990
R.TPQEMSR(+14.02)PTTTTR.S Y 17.88 1518.7461 13 5.7 507.2589 3 35.75 3 16786 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 1357 1369 Methylation(KR)
R.LGSEADAK(+21.98).A Y 17.84 811.3688 8 -56.9 812.3299 1 70.04 1 33995 AEV 2_3_RA2_01_1224.d 7.71E4 1 1 291 298 Sodium adduct
R.LVSSKMPGGFNITAVR.K Y 17.83 1675.9080 16 55.6 336.2075 5 53.72 2 22350 AEV_1_3_RA2_01_1232.d 0 1 1 246 261
K.A(+27.99)MAEGGPISEYSNR.T Y 17.68 1508.6565 14 21.3 378.1794 4 68.77 1 33028 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 539 552 Formylation
R.STGL(+53.97)MNSNDILAEGVEKLGVR.T Y 17.67 2256.1030 21 70.3 565.0727 4 74.93 3 44065 AEV_3_3_RA3_01_1233.d 0 1 1 870 890 Trifluoroleucine
K.DLVGGK(+14.02).S Y 17.62 601.3435 6 -22.5 602.3373 1 86.37 2 45230 AEV_1_3_RA2_01_1232.d 4.25E4 1 1 188 193 Methylation(KR)
K.AYLDDVANK(+14.02).Y Y 17.61 1021.5080 9 -40.1 511.7408 2 39.14 2 15052 AEV_1_3_RA2_01_1232.d 1.49E5 1 1 299 307 Methylation(KR)
R.ENAGK(+42.01).F N 17.59 559.2602 5 7.6 560.2717 1 20.92 3 8316 AEV_3_3_RA3_01_1233.d 1.65E4 1 1 1427 1431 Acetylation (K)
R.NFTAS(-18.01)EQ(+.98)K.Y Y 17.58 906.4083 8 -29.2 454.1982 2 45.68 1 17667 AEV 2_3_RA2_01_1224.d 1.41E5 1 1 1799 1806 Dehydration; Deamidation (NQ)
R.WGLQ(+.98)SGR(+21.98).Q Y 17.55 825.3745 7 -39.1 826.3495 1 93.21 1 51909 AEV 2_3_RA2_01_1224.d 0 1 1 268 274 Deamidation (NQ); Sodium adduct
R.Q(+.98)AVM(+15.99)K.E Y 17.51 592.2891 5 -15.0 593.2875 1 20.94 3 8337 AEV_3_3_RA3_01_1233.d 1.06E4 1 1 951 955 Deamidation (NQ); Oxidation (M)
K.KEANGWEYS(+79.97)K.K Y 17.50 1290.5282 10 -16.7 646.2606 2 71.44 1 35052 AEV 2_3_RA2_01_1224.d 1.1E5 1 1 642 651 Phosphorylation (STY)
K.Q(+.98)HKLSKSSQ(+.98)LQFTSLYR.E Y 17.42 2052.0640 17 -30.9 1027.0076 2 90.47 3 54970 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 569 585 Deamidation (NQ)
K.QSSSLVAR.L Y 17.39 846.4559 8 -22.5 424.2257 2 55.89 3 29458 AEV_3_3_RA3_01_1233.d 2.02E3 2 2 238 245
K.VITEPR(+14.02).A Y 17.32 727.4228 6 4.2 728.4331 1 99.55 3 58924 AEV_3_3_RA3_01_1233.d 9.92E4 2 2 976 981 Methylation(KR)
K.V(+43.01)MEK(+42.01)FDYIVYPSR.S Y 17.26 1730.8337 13 18.5 577.9625 3 73.28 3 42804 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 1616 1628 Carbamylation; Acetylation (K)
R.S(+42.01)VPAPGK(+42.01).G N 17.20 738.3912 7 -34.1 739.3733 1 97.13 2 50042 AEV_1_3_RA2_01_1232.d 0 1 1 1413 1419 Acetylation (N-term); Acetylation (K)
K.GKPYSGWVDAKTGEPVNDR(+31.99).D Y 17.17 2106.9971 19 -3.0 527.7549 4 44.46 3 22212 AEV_3_3_RA3_01_1233.d 5.17E4 1 1 1065 1083 Dihydroxy
R.QDALSM(+15.99)YYDIIFGR.L Y 17.13 1706.7974 14 121.8 854.5099 2 113.79 1 59815 AEV 2_3_RA2_01_1224.d 0 1 1 422 435 Oxidation (M)
K.V(+43.01)ITEPR.A Y 17.11 756.4130 6 -11.2 379.2095 2 22.20 2 7307 AEV_1_3_RA2_01_1232.d 2.42E4 2 2 976 981 Carbamylation
K.MPGGFNITAVR.K Y 17.06 1161.5964 11 -9.9 581.7997 2 73.85 3 43239 AEV_3_3_RA3_01_1233.d 2.32E5 1 1 251 261
K.QSSSLVAR(-.98).L Y 17.04 845.4719 8 30.7 846.5051 1 100.35 3 59184 AEV_3_3_RA3_01_1233.d 0 1 1 238 245 Amidation
K.SLGVEGK(+14.02).G Y 17.02 702.3912 7 -57.5 703.3580 1 32.91 3 15096 AEV_3_3_RA3_01_1233.d 0 1 1 1831 1837 Methylation(KR)
K.GKPYSGWVDAK(+54.01)TGEPVNDR.D Y 16.98 2129.0178 19 -33.3 533.2440 4 82.42 1 43778 AEV 2_3_RA2_01_1224.d 5.8E5 1 1 1065 1083 MDA adduct +54
R.VLVAQK(+42.01).L Y 16.96 698.4327 6 -197.2 699.3022 1 92.44 1 51391 AEV 2_3_RA2_01_1224.d 1.48E5 1 1 167 172 Acetylation (K)
K.QKTEAED(-18.01)VQMQQTR.Q Y 16.93 1672.7838 14 19.5 558.6127 3 46.59 3 23568 AEV_3_3_RA3_01_1233.d 1.72E5 1 1 1748 1761 Dehydration
R.VELN(+.98)EMTSTLGYAGNDR.N Y 16.90 1869.8414 17 29.6 624.3062 3 75.78 3 44747 AEV_3_3_RA3_01_1233.d 1.15E4 1 1 1721 1737 Deamidation (NQ)
K.E(+42.01)ANGWEYSK(+42.01).K Y 16.72 1166.4880 9 -27.0 584.2355 2 60.35 1 26744 AEV 2_3_RA2_01_1224.d 1.66E5 1 1 643 651 Acetylation (N-term); Acetylation (K)
K.LRSEIT(+79.97)ETSTVR.Q Y 16.72 1470.7079 12 10.9 368.6883 4 46.37 3 23420 AEV_3_3_RA3_01_1233.d 0 1 1 939 950 Phosphorylation (STY)
R.LVSSK(+43.99).M N 16.69 576.3119 5 -5.2 577.3162 1 98.63 3 58606 AEV_3_3_RA3_01_1233.d 4.47E4 1 1 246 250 Carboxylation (DKW)
K.KPLADVPVTKAIK(+43.01).D Y 16.67 1421.8606 13 14.0 356.4774 4 62.07 2 27237 AEV_1_3_RA2_01_1232.d 2.39E4 1 1 175 187 Carbamylation
K.SLGVEGK(+43.01).G Y 16.65 731.3813 7 8.1 732.3945 1 68.76 3 39262 AEV_3_3_RA3_01_1233.d 2.64E4 1 1 1831 1837 Carbamylation
R.TPQ(+.98)EMSRPTTTT(-18.01)R.S Y 16.61 1487.7039 13 -9.8 744.8519 2 57.38 3 30501 AEV_3_3_RA3_01_1233.d 8.81E4 1 1 1357 1369 Deamidation (NQ); Dehydration
K.YLETR(+14.02)WGLQSGR.Q Y 16.59 1478.7629 12 -0.4 370.6979 4 10.15 3 2630 AEV_3_3_RA3_01_1233.d 0 1 1 263 274 Methylation(KR)
R.SLQ(+.98)TDGIK(-.98).A Y 16.54 860.4603 8 5.1 431.2396 2 22.71 3 9276 AEV_3_3_RA3_01_1233.d 0 1 1 1629 1636 Deamidation (NQ); Amidation
K.EANGWEY(+31.99)SK.K Y 16.53 1114.4567 9 7.9 558.2400 2 39.45 1 14091 AEV 2_3_RA2_01_1224.d 0 1 1 643 651 Dihydroxy
R.RTIASK(+14.02)YEAYDAATSVQR.Q Y 16.53 2043.0385 18 2.9 511.7684 4 62.18 2 27314 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 59 76 Methylation(KR)
R.F(+42.01)VAGQ(+.98)IPTGWN(+.98)PK.H Y 16.53 1457.7190 13 4.8 365.4388 4 12.66 3 3848 AEV_3_3_RA3_01_1233.d 7.46E4 1 1 1180 1192 Acetylation (N-term); Deamidation (NQ)
K.GMVN(+162.05)LDK.V Y 16.49 937.4426 7 -78.7 469.6917 2 56.18 1 23989 AEV 2_3_RA2_01_1224.d 0 1 1 1007 1013 Hexose (NSY)
K.EFAHGR.T Y 16.43 715.3401 6 21.5 716.3628 1 112.12 3 62567 AEV_3_3_RA3_01_1233.d 4.97E4 1 1 1351 1356
R.AHGD(-18.01)K(+14.02)VEVFEIPDSSEYTVR.L Y 16.41 2273.0964 20 -43.3 569.2568 4 80.69 1 42374 AEV 2_3_RA2_01_1224.d 5.82E4 1 1 1143 1162 Dehydration; Methylation(KR)
R.NAD(+31.97)NIDK.V Y 16.38 820.3385 7 26.8 411.1875 2 65.74 1 30679 AEV 2_3_RA2_01_1224.d 0 1 1 1609 1615 Persulfide
K.DLVGGK(-1.03).S Y 16.37 586.2962 6 -5.5 587.3002 1 71.30 2 33821 AEV_1_3_RA2_01_1232.d 0 1 1 188 193 Lysine oxidation to aminoadipic semialdehyde
K.E(+27.99)AVFK.S Y 16.37 620.3170 5 40.9 621.3496 1 98.27 2 50439 AEV_1_3_RA2_01_1232.d 3.08E4 1 1 1826 1830 Formylation
R.ENAGK(+43.01).F N 16.35 560.2554 5 -74.6 561.2209 1 51.53 1 21057 AEV 2_3_RA2_01_1224.d 3.07E4 1 1 1427 1431 Carbamylation
K.SLGVEGK.G Y 16.26 688.3755 7 -129.8 345.1504 2 26.74 1 7341 AEV 2_3_RA2_01_1224.d 3.1E4 1 1 1831 1837
K.AMAEGGPISE(+43.99)YSNR(+14.02)TK.V Y 16.22 1767.8097 16 -60.2 884.8589 2 92.45 1 51379 AEV 2_3_RA2_01_1224.d 4.85E4 1 1 539 554 Carboxylation (E); Methylation(KR)
R.TKVQ(+.98)NDLRSVYK(+42.01).L Y 16.18 1492.7886 12 38.2 374.2187 4 38.72 2 14860 AEV_1_3_RA2_01_1232.d 2.4E5 1 1 553 564 Deamidation (NQ); Acetylation (K)
K.Y(+71.04)LTGHPK.G Y 16.13 885.4708 7 -65.7 886.4199 1 89.37 3 54363 AEV_3_3_RA3_01_1233.d 5.14E4 1 1 1578 1584 Propionamide (K, X@N-term)
R.TSARK(+42.01)LEHYVK(+14.02).A Y 16.13 1386.7620 11 -5.0 463.2589 3 56.10 3 29601 AEV_3_3_RA3_01_1233.d 0 1 1 528 538 Acetylation (K); Methylation(KR)
R.TK(+42.01)VQ(+.98)NDLR.S Y 16.09 1015.5298 8 -5.7 508.7693 2 42.19 3 20786 AEV_3_3_RA3_01_1233.d 0 1 1 553 560 Acetylation (K); Deamidation (NQ)
K.Q(+42.01)DVQALVNYIYDPK.N Y 16.07 1706.8516 14 4.0 854.4365 2 90.69 2 47561 AEV_1_3_RA2_01_1232.d 4.35E4 1 1 741 754 Acetylation (N-term)
K.TPVGAC(+57.02)ATAVESIDIGYETIVEGK.A Y 16.07 2479.2151 24 6.6 827.4178 3 87.33 2 45816 AEV_1_3_RA2_01_1232.d 1.47E5 1 1 1296 1319 Carbamidomethylation
K.GKPYSGW(+15.99)VDAK(+14.02).T Y 16.01 1236.6139 11 -17.6 619.3033 2 64.39 2 28828 AEV_1_3_RA2_01_1232.d 3.68E4 1 1 1065 1075 Oxidation (HW); Methylation(KR)
R.S(+42.01)LQTDGIK.A Y 15.98 902.4709 8 -0.3 903.4779 1 97.45 3 58167 AEV_3_3_RA3_01_1233.d 1.94E4 1 1 1629 1636 Acetylation (N-term)
R.EN(+.98)AGK.F N 15.67 518.2336 5 -47.7 519.2162 1 64.77 1 30041 AEV 2_3_RA2_01_1224.d 0 1 1 1427 1431 Deamidation (NQ)
R.SVPAPGK(+42.01)GVLTTAR.E Y 15.66 1394.7881 14 -2.1 349.7036 4 70.82 2 33462 AEV_1_3_RA2_01_1232.d 2.15E5 1 1 1413 1426 Acetylation (K)
R.EN(+.98)AGK(+42.01).F N 15.64 560.2442 5 27.1 561.2667 1 21.08 2 6843 AEV_1_3_RA2_01_1232.d 0 1 1 1427 1431 Deamidation (NQ); Acetylation (K)
K.YLET(-18.01)R(+14.02).W N 15.60 676.3544 5 -34.9 677.3381 1 78.71 2 39534 AEV_1_3_RA2_01_1232.d 0 1 1 263 267 Dehydration; Methylation(KR)
K.GT(+87.05)QAIGIHPK.Y Y 15.55 1107.6223 10 -81.4 370.1847 3 47.30 1 18672 AEV 2_3_RA2_01_1224.d 4.9E4 1 1 1649 1658 Phosphorylation to amine thiol
K.SSQ(+.98)LQFTS(+79.97)LYR.E Y 15.53 1409.6228 11 -19.3 353.4062 4 66.71 1 31460 AEV 2_3_RA2_01_1224.d 6.94E5 1 1 575 585 Deamidation (NQ); Phosphorylation (STY)
K.S(+27.99)ELAHR.V Y 15.52 739.3613 6 -64.1 740.3212 1 97.39 1 54612 AEV 2_3_RA2_01_1224.d 5.19E3 1 1 784 789 Formylation
K.YC(+57.02)RGAPSPQAS(+79.97)FAGRWSAK.E Y 15.47 2175.9673 19 11.8 436.2059 5 41.96 2 16443 AEV_1_3_RA2_01_1232.d 0 1 1 1807 1825 Carbamidomethylation; Phosphorylation (STY)
K.LRSEITETS(-18.01)TVR(+14.02).Q Y 15.43 1386.7467 12 -36.7 463.2392 3 42.48 3 20956 AEV_3_3_RA3_01_1233.d 0 1 1 939 950 Dehydration; Methylation(KR)
R.ENAGK(+21.98).F N 15.43 539.2316 5 44.5 540.2628 1 24.14 3 10077 AEV_3_3_RA3_01_1233.d 0 1 1 1427 1431 Sodium adduct
R.EVTGYYQT(-18.01)MYTR.Y Y 15.43 1492.6656 12 -33.7 747.3149 2 66.89 1 31553 AEV 2_3_RA2_01_1224.d 3.75E4 1 1 711 722 Dehydration
R.SVP(+31.99)APGK.G N 15.42 686.3599 7 -12.5 687.3586 1 64.54 2 28930 AEV_1_3_RA2_01_1232.d 0 1 1 1413 1419 Dihydroxy
K.GKPYSGWVD(-18.01)AK.T Y 15.42 1188.5928 11 7.4 595.3080 2 27.13 2 9425 AEV_1_3_RA2_01_1232.d 0 1 1 1065 1075 Dehydration
R.FLDK(+31.99)PLQK.D Y 15.39 1019.5651 8 -0.6 510.7896 2 73.64 2 35622 AEV_1_3_RA2_01_1232.d 1.54E5 1 1 1261 1268 Dihydroxy
R.SVPAPGK(+43.01).G N 15.34 697.3759 7 -4.0 698.3804 1 46.32 3 23394 AEV_3_3_RA3_01_1233.d 0 1 1 1413 1419 Carbamylation
K.AMAEGGPISEY(+162.05)SNR.T Y 15.32 1642.7144 14 -27.2 411.6747 4 27.54 1 7715 AEV 2_3_RA2_01_1224.d 2.63E5 1 1 539 552 Hexose (NSY)
R.V(+42.01)MLTNIY(+79.97)R.L Y 15.28 1130.5195 8 -64.6 566.2305 2 41.37 1 15203 AEV 2_3_RA2_01_1224.d 6.29E4 1 1 790 797 Acetylation (N-term); Phosphorylation (STY)
K.DLVGGK(+21.98)(+14.02).S Y 15.28 623.3254 6 -13.5 624.3243 1 79.98 2 40547 AEV_1_3_RA2_01_1232.d 2.32E5 1 1 188 193 Sodium adduct; Methylation(KR)
K.DVAIPTGP(+31.99)QTVIDS(+79.97)R.G Y 15.27 1679.7767 15 -30.0 560.9161 3 64.58 1 29943 AEV 2_3_RA2_01_1224.d 1.13E5 1 1 503 517 Dihydroxy; Phosphorylation (STY)
R.GSQ(+.98)LVVVPFN(+.98)QGSK.Q Y 15.25 1460.7511 14 -35.1 731.3572 2 82.87 3 50222 AEV_3_3_RA3_01_1233.d 4.63E4 1 1 727 740 Deamidation (NQ)
R.Y(+41.03)GARGSQLVVVPFNQGSK.Q Y 15.24 1947.0326 18 -6.1 487.7625 4 73.16 3 42708 AEV_3_3_RA3_01_1233.d 0 1 1 723 740 Amidination of lysines or N-terminal amines with methyl acetimidate
K.TGEPVNDR(+14.02)D(-18.01)VK.A Y 15.18 1224.6099 11 12.3 307.1635 4 66.57 1 31305 AEV 2_3_RA2_01_1224.d 5.78E4 1 1 1076 1086 Methylation(KR); Dehydration
K.SLGVEGK(+226.08).G Y 15.18 914.4531 7 -17.1 305.8198 3 39.26 1 13976 AEV 2_3_RA2_01_1224.d 6.94E4 1 1 1831 1837 Biotinylation
K.G(+42.01)KPYSGWVDAK.T Y 15.09 1248.6139 11 43.8 417.2301 3 41.37 2 16137 AEV_1_3_RA2_01_1232.d 0 1 1 1065 1075 Acetylation (N-term)
K.NEC(+57.02)DVVC(+57.02)QQM(+15.99)K.H Y 15.06 1425.5687 11 40.8 476.2162 3 59.10 1 25841 AEV 2_3_RA2_01_1224.d 0 1 1 1551 1561 Carbamidomethylation; Oxidation (M)
R.A(+42.01)HGDK(+14.02).V Y 15.05 582.2762 5 -8.1 583.2787 1 17.97 3 6736 AEV_3_3_RA3_01_1233.d 1.26E4 1 1 1143 1147 Acetylation (N-term); Methylation(KR)
R.QM(+15.99)VESLAK.A Y 15.01 920.4637 8 -13.2 461.2331 2 57.62 2 24431 AEV_1_3_RA2_01_1232.d 3.77E4 1 1 1762 1769 Oxidation (M)
total 352 peptides
A0A0A0HUJ5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.GSDEGNASTEFDVSKKQITPMGGFVR.Y Y 144.92 2756.3076 26 3.4 690.0865 4 73.41 2 35429 AEV_1_3_RA2_01_1232.d 3.27E5 2 2 441 466
K.GSDEGNASTEFDVSK.K Y 144.47 1541.6481 15 3.2 771.8338 2 53.13 2 22094 AEV_1_3_RA2_01_1232.d 3.01E6 11 11 441 455
R.IGKGSDEGNASTEFDVSKK.Q Y 141.18 1967.9436 19 4.2 492.9952 4 44.10 2 17546 AEV_1_3_RA2_01_1232.d 7.5E6 15 15 438 456
R.IGKGSDEGNASTEFDVSK.K Y 138.62 1839.8486 18 5.6 614.2936 3 52.86 2 21948 AEV_1_3_RA2_01_1232.d 2.15E6 11 11 438 455
R.IGKGSDEGNASTEFDVSKKQITPMGGFVR.Y Y 136.70 3054.5081 29 4.4 611.9116 5 71.05 2 33628 AEV_1_3_RA2_01_1232.d 3.28E5 3 3 438 466
R.YGEVKNDYVMLK.G Y 134.55 1457.7224 12 4.1 486.9167 3 64.59 2 28982 AEV_1_3_RA2_01_1232.d 2.94E6 7 7 467 478
R.KVAC(+57.02)IGAWHPSHVQWTVAR.A Y 133.34 2202.1270 19 1.2 551.5397 4 67.80 3 38496 AEV_3_3_RA3_01_1233.d 1.62E6 5 5 401 419 Carbamidomethylation
K.GSDEGNASTEFDVSKK.Q Y 131.50 1669.7430 16 1.7 557.5892 3 42.21 2 16571 AEV_1_3_RA2_01_1232.d 6.72E6 10 10 441 456
K.NHSENTGASVSR.E Y 130.85 1257.5698 12 5.9 629.7959 2 10.73 2 2754 AEV_1_3_RA2_01_1232.d 1.27E6 8 8 288 299
K.YAKNHSENTGASVSR.E Y 122.35 1619.7651 15 3.0 540.9306 3 12.84 3 3974 AEV_3_3_RA3_01_1233.d 6.5E5 7 7 285 299
R.YGEVKNDYVMLKGSVPGVK.K Y 119.21 2082.0820 19 3.6 521.5297 4 70.34 2 33101 AEV_1_3_RA2_01_1232.d 1.6E6 6 6 467 485
R.SLTTVWAEHLSDEVK.R Y 118.77 1713.8573 15 1.4 572.2938 3 77.75 2 38769 AEV_1_3_RA2_01_1232.d 1.2E6 5 5 253 267
K.VAC(+57.02)IGAWHPSHVQWTVAR.A Y 112.85 2074.0320 18 1.6 519.5161 4 71.57 3 41541 AEV_3_3_RA3_01_1233.d 1.87E6 5 5 402 419 Carbamidomethylation
K.WIDTSSKFGHGAFQTPAEK.R Y 105.64 2106.0171 19 1.5 527.5123 4 66.88 3 37763 AEV_3_3_RA3_01_1233.d 1.1E6 3 3 511 529
R.SLTTVWAEHLSDEVKR.R Y 105.06 1869.9585 16 -0.7 468.4966 4 74.32 3 43640 AEV_3_3_RA3_01_1233.d 2.12E6 6 6 253 268
K.FGHGAFQTPAEKR.A Y 104.76 1444.7211 13 -0.7 482.5806 3 41.96 3 20666 AEV_3_3_RA3_01_1233.d 6.17E6 16 16 518 530
K.FGHGAFQTPAEK.R Y 99.72 1288.6200 12 2.4 645.3188 2 52.40 2 21718 AEV_1_3_RA2_01_1232.d 3.05E6 10 10 518 529
K.GHGFNGVTSR.W Y 98.99 1030.4944 10 5.2 516.2571 2 25.34 2 8697 AEV_1_3_RA2_01_1232.d 4.17E6 15 15 376 385
K.NHSENTGASVSR(+14.02).E Y 98.27 1271.5854 12 4.6 636.8029 2 14.25 2 4062 AEV_1_3_RA2_01_1232.d 1.13E6 6 6 288 299 Methylation(KR)
R.HGSLAFLPR.K Y 97.93 996.5505 9 3.0 499.2840 2 64.83 2 29151 AEV_1_3_RA2_01_1232.d 6.04E6 15 15 163 171
R.YGEVKNDYVM(+15.99)LK.G Y 93.38 1473.7173 12 2.9 492.2478 3 61.19 2 26653 AEV_1_3_RA2_01_1232.d 1.35E6 8 8 467 478 Oxidation (M)
K.NHSENTGASVSRELER.I Y 93.20 1784.8401 16 3.7 447.2190 4 37.36 2 14200 AEV_1_3_RA2_01_1232.d 9.45E5 6 6 288 303
R.SLTTVWAEHLSDEVKRR.F Y 92.83 2026.0596 17 -1.1 406.2188 5 72.10 3 41898 AEV_3_3_RA3_01_1233.d 1.61E6 5 5 253 269
R.TSC(+57.02)NHKIYR.I Y 92.74 1177.5662 9 1.5 589.7913 2 12.25 3 3637 AEV_3_3_RA3_01_1233.d 1.8E6 6 6 429 437 Carbamidomethylation
R.AGQDGYHHR.T Y 92.60 1039.4584 9 3.4 520.7382 2 8.37 3 1978 AEV_3_3_RA3_01_1233.d 8.96E4 4 4 420 428
K.WIDTSSKFGHGAFQTPAEKR.A Y 90.27 2262.1182 20 -3.2 755.0443 3 63.69 3 35276 AEV_3_3_RA3_01_1233.d 1.29E6 3 3 511 530
K.KPVHLTAAMGYK.A Y 88.85 1314.7118 12 -0.2 439.2444 3 46.19 3 23312 AEV_3_3_RA3_01_1233.d 4.37E5 5 5 191 202
R.IGKGSDEGNASTEFDVSK(+14.02).K Y 85.22 1853.8643 18 -1.6 618.9611 3 57.35 3 30476 AEV_3_3_RA3_01_1233.d 2.04E5 2 2 438 455 Methylation(KR)
K.AGMTTVVRDLERPGAK.M Y 83.66 1699.9039 16 -1.4 425.9827 4 63.82 3 35398 AEV_3_3_RA3_01_1233.d 1.32E6 3 3 203 218
K.Q(-17.03)ITPMGGFVR.Y Y 82.96 1087.5485 10 3.5 544.7834 2 81.33 2 41627 AEV_1_3_RA2_01_1232.d 7.61E5 4 4 457 466 Pyro-glu from Q
R.LLAHTQIR.K Y 82.69 950.5662 8 0.4 476.2905 2 34.47 3 16047 AEV_3_3_RA3_01_1233.d 7.9E6 15 15 313 320
K.NHSE(+14.02)NTGASVSR.E Y 80.36 1271.5854 12 2.1 424.8700 3 14.95 3 5127 AEV_3_3_RA3_01_1233.d 1.15E6 5 5 288 299 Methylation(others)
K.VAC(+57.02)IGAWHPSHVQWTVAR(+14.02).A Y 79.67 2088.0476 18 -11.2 523.0133 4 72.80 3 42425 AEV_3_3_RA3_01_1233.d 2.3E5 2 2 402 419 Carbamidomethylation; Methylation(KR)
R.IGKGSDEGNASTE(+14.02)FDVSKK.Q Y 78.74 1981.9592 19 -1.4 496.4964 4 50.58 3 26084 AEV_3_3_RA3_01_1233.d 7.59E5 5 5 438 456 Methylation(others)
K.GSDEGNASTEFDVSK(+14.02).K Y 77.53 1555.6638 15 1.5 778.8403 2 59.38 3 31948 AEV_3_3_RA3_01_1233.d 4.96E5 4 4 441 455 Methylation(KR)
K.KQITPMGGFVR.Y Y 77.11 1232.6699 11 -0.4 411.8971 3 60.81 3 33037 AEV_3_3_RA3_01_1233.d 9.04E5 5 5 456 466
K.GHGFN(+.98)GVTSR.W Y 75.58 1031.4784 10 2.8 516.7479 2 25.83 3 11072 AEV_3_3_RA3_01_1233.d 4.62E6 22 22 376 385 Deamidation (NQ)
R.IGKGSDEGNASTEFDVSK(+14.02)K.Q Y 74.82 1981.9592 19 0.4 661.6606 3 48.46 3 24738 AEV_3_3_RA3_01_1233.d 8.98E4 1 1 438 456 Methylation(KR)
R.IGK(+14.02)GSDEGNASTEFDVSK.K Y 74.41 1853.8643 18 -0.2 618.9619 3 58.23 3 31108 AEV_3_3_RA3_01_1233.d 1.23E5 1 1 438 455 Methylation(KR)
K.TLYPQVSR.K Y 73.37 962.5185 8 2.8 482.2679 2 54.57 2 22829 AEV_1_3_RA2_01_1232.d 6.02E6 13 13 494 501
R.YGE(+14.02)VKNDYVMLK.G Y 73.00 1471.7380 12 -6.0 491.5837 3 65.68 3 36816 AEV_3_3_RA3_01_1233.d 3.68E5 4 4 467 478 Methylation(others)
K.GSDEGNASTEFDVSKK(+14.02).Q Y 71.70 1683.7587 16 3.6 562.2622 3 50.50 2 20693 AEV_1_3_RA2_01_1232.d 5.69E5 2 2 441 456 Methylation(KR)
R.IGKGSDE(+14.02)GNASTEFDVSK.K Y 71.69 1853.8643 18 3.0 618.9639 3 59.28 2 25412 AEV_1_3_RA2_01_1232.d 6.34E4 1 1 438 455 Methylation(others)
K.GSDEGNASTE(+14.02)FDVSK.K Y 71.44 1555.6638 15 -0.1 778.8391 2 61.09 3 33291 AEV_3_3_RA3_01_1233.d 3.98E5 3 3 441 455 Methylation(others)
R.LLAHTQIRK.T Y 69.97 1078.6611 9 1.7 540.3387 2 29.51 2 10489 AEV_1_3_RA2_01_1232.d 1.25E6 6 6 313 321
K.GSDEGNASTEFDVSK(+14.02)K.Q Y 68.77 1683.7587 16 3.0 562.2618 3 48.69 3 24889 AEV_3_3_RA3_01_1233.d 3.15E5 3 3 441 456 Methylation(KR)
R.IGKGSDEGNASTEFDVSKK(+14.02).Q Y 68.65 1981.9592 19 -1.2 496.4965 4 48.50 3 24762 AEV_3_3_RA3_01_1233.d 2.78E5 2 2 438 456 Methylation(KR)
R.IGKGSDEGNASTE(+14.02)FDVSK.K Y 68.13 1853.8643 18 2.0 618.9633 3 58.97 3 31674 AEV_3_3_RA3_01_1233.d 4.91E5 2 2 438 455 Methylation(others)
R.DLERPGAK.M Y 67.27 884.4716 8 2.6 443.2442 2 18.12 2 5651 AEV_1_3_RA2_01_1232.d 1.66E6 7 7 211 218
K.EIVEAVTIVETPPMIAVGVVGYIETPR.G Y 67.11 2881.5510 27 -3.4 961.5211 3 95.76 2 49599 AEV_1_3_RA2_01_1232.d 2.52E5 2 2 223 249
R.HGSLAFLPR(+14.02).K Y 66.59 1010.5661 9 3.5 506.2921 2 68.51 2 31734 AEV_1_3_RA2_01_1232.d 3.38E5 4 4 163 171 Methylation(KR)
R.IGK(+14.02)GSDEGNASTEFDVSKK.Q Y 64.97 1981.9592 19 8.2 496.5012 4 46.27 3 23357 AEV_3_3_RA3_01_1233.d 1.91E5 2 2 438 456 Methylation(KR)
R.IGKGSDEGN(+.98)ASTEFDVSKK.Q Y 63.06 1968.9276 19 3.6 493.2410 4 45.13 3 22644 AEV_3_3_RA3_01_1233.d 4.78E5 3 3 438 456 Deamidation (NQ)
K.YC(+57.02)TVVR.L Y 62.76 796.3901 6 2.1 399.2032 2 29.74 2 10587 AEV_1_3_RA2_01_1232.d 4.52E6 8 8 307 312 Carbamidomethylation
K.QITPMGGFVR.Y Y 62.27 1104.5750 10 2.1 553.2959 2 70.23 2 33164 AEV_1_3_RA2_01_1232.d 4.12E5 6 6 457 466
R.KTLYPQVSR.K Y 61.90 1090.6135 9 -6.2 364.5429 3 39.61 3 19154 AEV_3_3_RA3_01_1233.d 4.45E6 13 13 493 501
R.TSC(+57.02)N(+.98)HKIYR.I Y 61.78 1178.5503 9 -0.1 590.2823 2 13.52 3 4321 AEV_3_3_RA3_01_1233.d 1.22E5 3 3 429 437 Carbamidomethylation; Deamidation (NQ)
K.FGHGAFQTPAEK(+14.02).R Y 60.11 1302.6356 12 -3.6 652.3228 2 56.18 3 29649 AEV_3_3_RA3_01_1233.d 1.44E5 2 2 518 529 Methylation(KR)
K.V(+127.06)AC(+57.02)IGAWHPSHVQWTVAR.A Y 59.70 2201.0952 18 -13.4 551.2737 4 69.39 2 32391 AEV_1_3_RA2_01_1232.d 2.66E5 1 1 402 419 N-Succinimidyl-2-morpholine acetate; Carbamidomethylation
R.RFYKNWYK.S Y 58.59 1203.6189 8 1.6 402.2142 3 54.37 2 22682 AEV_1_3_RA2_01_1232.d 4.94E5 2 2 269 276
R.I(+43.01)GK(+14.02)GSDEGNASTEFDVSK.K Y 58.12 1896.8701 18 10.0 633.3036 3 54.30 2 22650 AEV_1_3_RA2_01_1232.d 2.17E5 3 3 438 455 Carbamylation; Methylation(KR)
K.TLYPQVSRK.A Y 57.70 1090.6135 9 1.4 546.3148 2 37.24 3 17728 AEV_3_3_RA3_01_1233.d 2.56E6 12 12 494 502
R.KVAC(+57.02)IGAWHPSHVQ(+.98)WTVAR.A Y 57.02 2203.1108 19 -20.8 441.6203 5 68.68 3 39201 AEV_3_3_RA3_01_1233.d 0 2 2 401 419 Carbamidomethylation; Deamidation (NQ)
K.QITPM(+15.99)GGFVR.Y Y 56.36 1120.5699 10 -1.3 561.2915 2 59.59 3 32112 AEV_3_3_RA3_01_1233.d 5.98E5 7 7 457 466 Oxidation (M)
K.AGM(+15.99)TTVVR.D Y 55.08 849.4379 8 2.8 425.7274 2 16.98 3 6241 AEV_3_3_RA3_01_1233.d 6.21E6 16 16 203 210 Oxidation (M)
K.NHSEN(+.98)TGASVSR.E Y 55.01 1258.5538 12 -82.1 420.4908 3 21.10 1 5088 AEV 2_3_RA2_01_1224.d 1.4E5 3 3 288 299 Deamidation (NQ)
R.KALEKVELK.W Y 54.85 1056.6543 9 4.9 529.3370 2 32.73 2 12035 AEV_1_3_RA2_01_1232.d 8.38E5 6 6 502 510
R.S(+42.01)LTTVWAEHLSDEVKR.R Y 54.55 1911.9690 16 -1.7 478.9987 4 75.31 2 36848 AEV_1_3_RA2_01_1232.d 5.4E4 1 1 253 268 Acetylation (N-term)
K.ALEKVELK.W Y 54.49 928.5593 8 0.0 465.2869 2 39.73 2 15335 AEV_1_3_RA2_01_1232.d 1.12E6 7 7 503 510
R.IKKYC(+57.02)TVVR.L Y 54.26 1165.6642 9 4.9 389.5639 3 28.47 2 10019 AEV_1_3_RA2_01_1232.d 2.95E5 3 3 304 312 Carbamidomethylation
R.FYKNWYK.S Y 53.81 1047.5178 7 0.3 524.7664 2 53.09 3 27764 AEV_3_3_RA3_01_1233.d 2.34E6 4 4 270 276
R.IGKGSDE(+14.02)GNASTEFDVSKK.Q Y 53.59 1981.9592 19 -1.2 661.6595 3 49.95 3 25701 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 438 456 Methylation(others)
K.WIDTSSK.F Y 53.46 835.4076 7 0.6 418.7113 2 30.85 3 13904 AEV_3_3_RA3_01_1233.d 3.33E6 10 10 511 517
K.TLYPQ(+.98)VSR.K Y 53.29 963.5025 8 6.6 482.7617 2 56.50 2 23819 AEV_1_3_RA2_01_1232.d 7.1E5 4 4 494 501 Deamidation (NQ)
K.AGMTTVVR.D Y 52.58 833.4429 8 0.2 417.7288 2 34.97 3 16324 AEV_3_3_RA3_01_1233.d 1.36E6 4 4 203 210
K.GSDEGNASTE(+14.02)FDVSKK.Q Y 51.69 1683.7587 16 15.6 562.2689 3 51.18 3 26526 AEV_3_3_RA3_01_1233.d 3.9E5 6 6 441 456 Methylation(others)
R.YGEVKNDYVMLK(+14.02).G Y 51.64 1471.7380 12 1.0 736.8770 2 67.37 3 38153 AEV_3_3_RA3_01_1233.d 1.93E5 2 2 467 478 Methylation(KR)
K.AGM(+15.99)TTVVRDLERPGAK.M Y 51.50 1715.8988 16 -7.3 572.9694 3 48.67 3 24870 AEV_3_3_RA3_01_1233.d 8.94E5 4 4 203 218 Oxidation (M)
K.V(+42.01)AC(+57.02)IGAWHPS(+79.96)HVQWTVAR.A Y 50.87 2195.9993 18 70.6 440.2381 5 67.91 3 38587 AEV_3_3_RA3_01_1233.d 0 1 1 402 419 Acetylation (N-term); Carbamidomethylation; Sulfation
K.Y(+43.01)AK(+14.02)NHSENTGASVSR.E Y 50.82 1676.7866 15 1.3 559.9369 3 12.97 3 4026 AEV_3_3_RA3_01_1233.d 1.28E4 1 1 285 299 Carbamylation; Methylation(KR)
K.GSD(+14.02)EGNASTEFDVSKK.Q Y 49.51 1683.7587 16 4.2 562.2625 3 49.43 3 25373 AEV_3_3_RA3_01_1233.d 3.35E5 1 1 441 456 Methylation(others)
R.SLTTVWAEHLSDEVK(+170.04).R Y 49.50 1883.8942 15 -53.5 471.9556 4 85.21 1 45951 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 253 267 Menadione quinone derivative
K.SFPKDDPKKPVHLTAAMGYK.A Y 48.73 2229.1616 20 7.0 446.8427 5 61.28 2 26716 AEV_1_3_RA2_01_1232.d 1.41E6 6 6 183 202
K.TLYPQVSR(+14.02).K Y 48.25 976.5342 8 0.0 489.2744 2 59.65 2 25650 AEV_1_3_RA2_01_1232.d 4.67E5 3 3 494 501 Methylation(KR)
K.GSDE(+14.02)GNASTEFDVSKK.Q Y 47.83 1683.7587 16 6.1 562.2636 3 51.51 2 21214 AEV_1_3_RA2_01_1232.d 7.68E5 5 5 441 456 Methylation(others)
R.YGEVKN(+.98)DYVMLK.G Y 47.61 1458.7064 12 7.8 487.2465 3 65.86 2 29849 AEV_1_3_RA2_01_1232.d 0 1 1 467 478 Deamidation (NQ)
R.AFMGTLKK.D Y 47.54 894.4997 8 -1.5 448.2564 2 37.95 3 18169 AEV_3_3_RA3_01_1233.d 5.19E5 2 2 531 538
K.FGHGAFQ(+.98)TPAEK.R Y 46.86 1289.6040 12 -1.8 430.8745 3 51.04 3 26403 AEV_3_3_RA3_01_1233.d 1.44E5 2 2 518 529 Deamidation (NQ)
K.FGHGAFQ(+.98)TPAEKR.A Y 46.78 1445.7051 13 -80.1 362.4046 4 63.61 1 29306 AEV 2_3_RA2_01_1224.d 3.74E5 3 3 518 530 Deamidation (NQ)
K.GSDEGNASTEFD(+14.02)VSK.K Y 45.81 1555.6638 15 0.2 778.8394 2 56.28 3 29711 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 441 455 Methylation(others)
R.AGQDGYHHR(+14.02).T Y 43.34 1053.4740 9 4.8 527.7468 2 10.02 2 2491 AEV_1_3_RA2_01_1232.d 1.61E4 1 1 420 428 Methylation(KR)
R.SLTTVWAE(+14.02)HLSDEVKRR.F Y 43.04 2040.0752 17 0.2 409.0224 5 72.35 3 42069 AEV_3_3_RA3_01_1233.d 2.38E5 1 1 253 269 Methylation(others)
R.YGEVKNDYVM(-48.00)LK.G Y 42.36 1409.7190 12 -0.9 470.9132 3 54.29 3 28542 AEV_3_3_RA3_01_1233.d 1.14E6 1 1 467 478 Dethiomethyl
K.SFPKDDPK.K Y 41.80 932.4603 8 1.7 467.2382 2 17.82 3 6662 AEV_3_3_RA3_01_1233.d 8.47E5 9 9 183 190
K.GSDEGNASTEFDVSKKQITPM(+15.99)GGFVR.Y Y 40.45 2772.3025 26 -3.5 694.0804 4 68.18 3 38796 AEV_3_3_RA3_01_1233.d 7.81E4 1 1 441 466 Oxidation (M)
R.TSC(+57.02)NHKIYR(+14.02).I Y 40.41 1191.5819 9 10.9 398.2056 3 15.48 3 5382 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 429 437 Carbamidomethylation; Methylation(KR)
K.KQITPM(+15.99)GGFVR.Y Y 40.38 1248.6648 11 -21.8 625.3260 2 45.25 3 22718 AEV_3_3_RA3_01_1233.d 3.44E5 3 3 456 466 Oxidation (M)
R.KTLYPQVSRK.A Y 40.34 1218.7084 10 -17.6 407.2362 3 27.51 3 11972 AEV_3_3_RA3_01_1233.d 5.3E5 4 4 493 502
R.KFEAPR.H Y 37.76 746.4075 6 2.9 374.2121 2 17.57 3 6533 AEV_3_3_RA3_01_1233.d 2.5E6 7 7 157 162
R.AFM(+15.99)GTLKK.D Y 37.75 910.4946 8 -85.7 456.2156 2 42.13 1 15649 AEV 2_3_RA2_01_1224.d 4.57E5 3 3 531 538 Oxidation (M)
R.DLERPGAK(+14.02).M Y 37.34 898.4872 8 -1.1 450.2504 2 22.85 3 9356 AEV_3_3_RA3_01_1233.d 3.49E5 2 2 211 218 Methylation(KR)
M(+42.01)AT(+79.97)ESTQSNSK(+42.01).K Y 36.17 1346.5061 11 -33.2 674.2380 2 66.97 1 31618 AEV 2_3_RA2_01_1224.d 5.62E4 1 1 1 11 Acetylation (Protein N-term); Phosphorylation (STY); Acetylation (K)
K.GSDE(+14.02)GNASTEFDVSK.K Y 36.09 1555.6638 15 -87.0 778.7715 2 64.70 1 30017 AEV 2_3_RA2_01_1224.d 3.01E5 2 2 441 455 Methylation(others)
K.GSVPGVK.K Y 35.67 642.3701 7 -90.2 322.1633 2 32.24 1 10209 AEV 2_3_RA2_01_1224.d 1.28E6 6 6 479 485
K.FGHGAFQTPAEK(+14.02)R.A Y 35.59 1458.7367 13 -2.3 487.2517 3 50.04 2 20459 AEV_1_3_RA2_01_1232.d 4.72E5 3 3 518 530 Methylation(KR)
K.Q(-17.03)ITPM(+15.99)GGFVR.Y Y 34.37 1103.5433 10 2.6 552.7804 2 74.04 2 35906 AEV_1_3_RA2_01_1232.d 2.15E5 2 2 457 466 Pyro-glu from Q; Oxidation (M)
R.I(+43.01)GK(+14.02)GSDEGNASTEFDVSKK.Q Y 34.29 2024.9650 19 2.7 675.9974 3 43.63 3 21691 AEV_3_3_RA3_01_1233.d 1.7E5 2 2 438 456 Carbamylation; Methylation(KR)
K.KKAFTK.Y Y 33.87 721.4486 6 -8.1 361.7287 2 8.55 2 2023 AEV_1_3_RA2_01_1232.d 5.38E3 1 1 279 284
R.LLAHTQIR(+14.02).K Y 33.57 964.5818 8 -3.5 322.5334 3 47.67 3 24239 AEV_3_3_RA3_01_1233.d 2.01E5 2 2 313 320 Methylation(KR)
K.FGHGAFQTPAEK(+170.04).R Y 33.50 1458.6567 12 -28.4 365.6611 4 66.15 1 30981 AEV 2_3_RA2_01_1224.d 1.39E5 1 1 518 529 Menadione quinone derivative
R.SLTTVWAE(+14.02)HLSDEVKR.R Y 32.98 1883.9741 16 10.7 629.0054 3 74.90 3 44042 AEV_3_3_RA3_01_1233.d 6.78E4 2 2 253 268 Methylation(others)
R.SLTTVWAEHLSDEVKR(+14.02)R.F Y 32.71 2040.0752 17 -10.3 409.0181 5 75.82 3 44771 AEV_3_3_RA3_01_1233.d 7.33E4 1 1 253 269 Methylation(KR)
R.VLTLR.K N 32.46 600.3959 5 0.3 301.2053 2 38.35 3 18400 AEV_3_3_RA3_01_1233.d 2.32E6 8 8 488 492
K.NHSENTGASVSR(+14.02)ELER.I Y 32.18 1798.8557 16 -1.0 600.6252 3 44.43 2 17657 AEV_1_3_RA2_01_1232.d 8.69E4 1 1 288 303 Methylation(KR)
K.KQITPM(-48.00)GGFVR.Y Y 32.14 1184.6665 11 2.3 395.8970 3 35.25 2 13190 AEV_1_3_RA2_01_1232.d 4.69E5 1 1 456 466 Dethiomethyl
K.SFPKDD(+43.99)PK.K Y 32.08 976.4501 8 -34.8 489.2153 2 38.02 1 13282 AEV 2_3_RA2_01_1224.d 6.91E4 1 1 183 190 Carboxylation (DKW)
K.GSDEGN(+.98)ASTEFDVSKK.Q Y 32.03 1670.7271 16 -0.2 836.3706 2 44.41 3 22174 AEV_3_3_RA3_01_1233.d 5.37E4 1 1 441 456 Deamidation (NQ)
K.NHSE(+6.01)NTGASVSR.E Y 31.67 1263.5780 12 25.5 422.2107 3 11.01 3 3014 AEV_3_3_RA3_01_1233.d 0 1 1 288 299 Replacement of proton by lithium
R.KTPLKQK.K Y 31.65 841.5385 7 -4.5 421.7747 2 8.88 3 2129 AEV_3_3_RA3_01_1233.d 2.35E4 2 2 321 327
K.FEAPR.H Y 31.16 618.3125 5 -86.3 310.1368 2 36.52 1 12497 AEV 2_3_RA2_01_1224.d 6.17E5 4 4 158 162
K.GHGFNGVTSR(+14.02).W Y 30.51 1044.5101 10 3.8 523.2643 2 33.72 2 12465 AEV_1_3_RA2_01_1232.d 6.78E4 1 1 376 385 Methylation(KR)
R.V(+42.01)LTLR.K N 30.36 642.4064 5 3.7 322.2117 2 40.18 2 15554 AEV_1_3_RA2_01_1232.d 5.71E4 1 1 488 492 Acetylation (N-term)
K.Q(+.98)ITPMGGFVR.Y Y 30.24 1105.5590 10 0.2 553.7869 2 71.75 2 34156 AEV_1_3_RA2_01_1232.d 2.69E5 3 3 457 466 Deamidation (NQ)
R.T(+127.06)SC(+57.02)NHKIYR.I Y 29.26 1304.6295 9 74.3 327.1889 4 12.48 3 3751 AEV_3_3_RA3_01_1233.d 9.32E4 1 1 429 437 N-Succinimidyl-2-morpholine acetate; Carbamidomethylation
R.AGQD(+14.02)GYHHR.T Y 27.35 1053.4740 9 1.0 527.7448 2 9.83 3 2473 AEV_3_3_RA3_01_1233.d 1.58E4 1 1 420 428 Methylation(others)
K.Q(+43.01)ITPMGGFVR.Y Y 26.82 1147.5808 10 -64.1 383.5097 3 62.41 1 28320 AEV 2_3_RA2_01_1224.d 1.63E5 1 1 457 466 Carbamylation
K.DLVTAA Y 25.94 588.3119 6 -30.3 589.3013 1 36.79 3 17446 AEV_3_3_RA3_01_1233.d 3.22E4 3 3 539 544
K.QITPM(-48.00)GGFVR.Y Y 25.50 1056.5717 10 3.8 353.1992 3 45.20 2 18063 AEV_1_3_RA2_01_1232.d 1.27E6 3 3 457 466 Dethiomethyl
K.IYRIGKGS(+121.04)DEGNASTEFDVSKK.Q Y 24.99 2521.2271 22 9.3 505.2574 5 42.27 3 20824 AEV_3_3_RA3_01_1233.d 0 1 1 435 456 Phosphorylation to pyridyl thiol
R.DLER(+14.02)PGAK(+43.01)MHKK.E Y 24.88 1465.7823 12 17.1 489.6097 3 80.99 2 41343 AEV_1_3_RA2_01_1232.d 2.29E4 1 1 211 222 Methylation(KR); Carbamylation
K.NHSENT(-18.01)GASVSR.E Y 24.67 1239.5592 12 2.4 414.1947 3 11.05 3 3028 AEV_3_3_RA3_01_1233.d 5.57E4 1 1 288 299 Dehydration
R.LLAHTQ(+.98)IR.K Y 24.62 951.5502 8 -16.7 318.1854 3 40.91 2 15899 AEV_1_3_RA2_01_1232.d 0 2 2 313 320 Deamidation (NQ)
R.YGEVK(+14.02)NDYVM(+15.99)LK.G Y 24.60 1487.7330 12 3.8 496.9202 3 63.37 2 28129 AEV_1_3_RA2_01_1232.d 1.96E5 1 1 467 478 Methylation(KR); Oxidation (M)
R.YGEVKNDYVM(-4.99)LKGSVPGVK.K Y 24.31 2077.0957 19 -41.5 520.2596 4 70.49 2 33214 AEV_1_3_RA2_01_1232.d 7.2E4 1 1 467 485 Methionine replacement by azido homoalanine
K.T(+42.01)LYPQ(+.98)VSR.K Y 23.56 1005.5131 8 -15.2 503.7562 2 33.46 2 12337 AEV_1_3_RA2_01_1232.d 5.49E5 2 2 494 501 Acetylation (N-term); Deamidation (NQ)
K.NHSENTGAS(-18.01)VSR.E Y 23.38 1239.5592 12 5.1 414.1958 3 10.81 2 2776 AEV_1_3_RA2_01_1232.d 4.12E4 1 1 288 299 Dehydration
K.GSD(+294.18)EGNASTEFDVSK.K Y 23.37 1835.8312 15 3.5 612.9531 3 53.27 2 22128 AEV_1_3_RA2_01_1232.d 2.59E4 1 1 441 455 CHDH
K.ALEK(+14.02)VELK.W Y 23.34 942.5750 8 -17.1 472.2867 2 49.32 3 25362 AEV_3_3_RA3_01_1233.d 1.11E5 2 2 503 510 Methylation(KR)
K.AHLM(+15.99)EVQVNGGSIADK.V Y 23.34 1683.8250 16 -1.3 562.2816 3 59.03 3 31696 AEV_3_3_RA3_01_1233.d 1.94E4 1 1 329 344 Oxidation (M)
R.YGEVK(+14.02)NDYVMLK(+14.02).G Y 23.23 1485.7537 12 -0.8 496.2581 3 68.91 3 39383 AEV_3_3_RA3_01_1233.d 1.64E5 1 1 467 478 Methylation(KR)
R.YGEVKNDYVMLKGS(+95.94)VPGVK.K Y 22.64 2178.0254 19 1.9 727.0172 3 63.84 3 35382 AEV_3_3_RA3_01_1233.d 4.81E4 1 1 467 485 Thiophosphorylation
R.I(+42.01)GK(+14.02)GSDEGN(+.98)ASTEFDVSKK.Q Y 22.57 2024.9537 19 8.7 507.2501 4 49.99 3 25730 AEV_3_3_RA3_01_1233.d 6.22E5 1 1 438 456 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
R.KTPLKQKK.A Y 22.52 969.6335 8 4.2 485.8260 2 8.69 3 2068 AEV_3_3_RA3_01_1233.d 4.51E3 1 1 321 328
R.YGEVKND(+14.02)YVMLK.G Y 22.43 1471.7380 12 -11.1 491.5812 3 67.38 2 30921 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 467 478 Methylation(others)
R.HGS(+79.96)LAFLPRK(+42.01)R.S Y 22.08 1402.7139 11 -30.1 351.6752 4 80.28 1 42058 AEV 2_3_RA2_01_1224.d 1.15E5 1 1 163 173 Sulfation; Acetylation (K)
R.K(+42.01)(+42.01)ALEKVELK.W Y 21.89 1140.6754 9 -50.9 381.2130 3 32.77 2 12019 AEV_1_3_RA2_01_1232.d 6.48E4 1 1 502 510 Acetylation (N-term); Acetylation (K)
R.DLERPGAKM(+15.99)HK.K Y 21.88 1296.6608 11 5.0 433.2297 3 10.16 3 2620 AEV_3_3_RA3_01_1233.d 1.25E5 2 2 211 221 Oxidation (M)
R.IGKGSDEGNASTEFDVS(+164.06)K.K Y 21.78 2003.9088 18 11.0 668.9843 3 49.76 2 20326 AEV_1_3_RA2_01_1232.d 7.54E4 1 1 438 455 O-Diisopropylphosphorylation
K.AGM(-48.00)TTVVR.D Y 21.64 785.4396 8 0.6 393.7273 2 10.68 3 2859 AEV_3_3_RA3_01_1233.d 9.78E5 3 3 203 210 Dethiomethyl
R.VLTLR(+14.02).K N 21.53 614.4116 5 -9.3 308.2102 2 55.54 2 23284 AEV_1_3_RA2_01_1232.d 2.7E5 3 3 488 492 Methylation(KR)
K.Y(+42.01)C(+57.02)TVVR.L Y 21.52 838.4007 6 31.1 420.2206 2 29.95 2 10683 AEV_1_3_RA2_01_1232.d 0 1 1 307 312 Acetylation (N-term); Carbamidomethylation
MATES(+79.97)TQSNSK(+42.01).K Y 21.48 1304.4956 11 10.5 653.2619 2 81.40 1 42934 AEV 2_3_RA2_01_1224.d 4.51E4 1 1 1 11 Phosphorylation (STY); Acetylation (K)
R.YGEVKNDYVM(+15.99)LKGSVPGVK.K Y 21.47 2098.0769 19 -1.7 700.3651 3 66.65 3 37611 AEV_3_3_RA3_01_1233.d 3.25E4 1 1 467 485 Oxidation (M)
K.NHSENTGASVSRELER(+14.02).I Y 21.32 1798.8557 16 3.9 600.6282 3 47.17 2 19022 AEV_1_3_RA2_01_1232.d 7.15E4 1 1 288 303 Methylation(KR)
K.W(+43.01)IDTSSK.F Y 21.12 878.4134 7 -86.0 440.1762 2 43.56 1 16457 AEV 2_3_RA2_01_1224.d 8.68E4 1 1 511 517 Carbamylation
R.S(+41.03)LTTVWAEHLSDEVKRR.F Y 21.09 2067.0862 17 17.1 517.7877 4 72.27 3 42005 AEV_3_3_RA3_01_1233.d 0 1 1 253 269 Amidination of lysines or N-terminal amines with methyl acetimidate
K.GSVPGVK(+14.02).K Y 20.86 656.3857 7 -97.1 657.3292 1 46.12 1 17941 AEV 2_3_RA2_01_1224.d 1.9E5 3 3 479 485 Methylation(KR)
R.VLTLRK.T Y 20.80 728.4908 6 -4.1 365.2512 2 26.31 2 9074 AEV_1_3_RA2_01_1232.d 1.22E6 3 3 488 493
K.YC(+57.02)TVVRLLAHTQIR.K Y 20.77 1728.9457 14 -31.4 433.2301 4 69.40 3 39771 AEV_3_3_RA3_01_1233.d 9.41E4 1 1 307 320 Carbamidomethylation
K.N(+43.01)HSENTGASVS(+79.97)R.E Y 20.66 1380.5419 12 0.6 461.1882 3 42.29 1 15746 AEV 2_3_RA2_01_1224.d 0 1 1 288 299 Carbamylation; Phosphorylation (STY)
K.G(+42.01)SVPGVK.K Y 20.57 684.3806 7 5.7 343.1995 2 62.82 2 27757 AEV_1_3_RA2_01_1232.d 2.05E5 3 3 479 485 Acetylation (N-term)
R.HGSLAFLPRK(+108.00)R.S Y 20.49 1388.7441 11 -0.1 348.1933 4 63.35 3 35005 AEV_3_3_RA3_01_1233.d 4.1E4 2 2 163 173 O-Ethylphosphorylation
K.WIDTSSK(+14.02).F Y 20.00 849.4232 7 4.6 425.7208 2 43.26 3 21446 AEV_3_3_RA3_01_1233.d 0 1 1 511 517 Methylation(KR)
R.IGKGSDEGNAS(+42.01)TEFDVSK.K Y 19.87 1881.8591 18 32.0 628.3137 3 53.00 2 21980 AEV_1_3_RA2_01_1232.d 9.24E4 1 1 438 455 Acetylation (TSCYH)
K.GSIAVR.V Y 19.74 601.3547 6 -98.8 602.3026 1 34.63 1 11504 AEV 2_3_RA2_01_1224.d 4.66E5 2 2 48 53
MATESTQS(+79.97)NSK(+42.01).K Y 19.67 1304.4956 11 -14.7 653.2455 2 67.82 1 32317 AEV 2_3_RA2_01_1224.d 0 1 1 1 11 Phosphorylation (STY); Acetylation (K)
K.GSVPGVK(+114.04).K Y 19.66 756.4130 7 -118.1 757.3309 1 106.96 1 57883 AEV 2_3_RA2_01_1224.d 4.02E5 1 1 479 485 Ubiquitin
K.AGMTTVVRDLERPGAK(+14.02).M Y 19.60 1713.9196 16 1.2 572.3145 3 69.02 3 39471 AEV_3_3_RA3_01_1233.d 6.59E4 1 1 203 218 Methylation(KR)
K.LISPASLEELSVYTFGR(+28.03).K Y 19.59 1909.0197 17 1.5 637.3481 3 76.94 2 38203 AEV_1_3_RA2_01_1232.d 1.1E5 2 2 62 78 Dimethylation(KR)
R.KTLYPQVSR(+14.02).K Y 19.44 1104.6292 9 -2.4 369.2161 3 47.95 2 19431 AEV_1_3_RA2_01_1232.d 0 1 1 493 501 Methylation(KR)
K.AGMTTVVR(+14.02).D Y 19.40 847.4586 8 6.7 424.7394 2 48.07 3 24496 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 203 210 Methylation(KR)
R.L(+42.01)LAHTQ(+.98)IR.K Y 19.34 993.5607 8 2.6 332.1950 3 41.19 2 16043 AEV_1_3_RA2_01_1232.d 0 1 1 313 320 Acetylation (N-term); Deamidation (NQ)
K.D(+45.99)LVTAA Y 19.09 634.2996 6 -27.3 635.2896 1 80.64 1 42341 AEV 2_3_RA2_01_1224.d 3.37E4 1 1 539 544 Beta-methylthiolation (ND)
K.A(+42.01)GMTTVVRDLERPGAK(+14.02).M Y 18.91 1755.9302 16 -37.6 439.9733 4 68.94 3 39404 AEV_3_3_RA3_01_1233.d 0 1 1 203 218 Acetylation (N-term); Methylation(KR)
K.TLYPQVS(+79.97)R(+14.02).K Y 18.75 1056.5005 8 1.9 529.2585 2 62.88 2 27803 AEV_1_3_RA2_01_1232.d 0 1 1 494 501 Phosphorylation (STY); Methylation(KR)
K.NDYVMLKGSVPGVK.K Y 18.64 1505.7911 14 34.9 502.9552 3 68.63 2 31826 AEV_1_3_RA2_01_1232.d 0 1 1 472 485
K.GSVPGVK(+42.02).K Y 18.50 684.3918 7 3.7 343.2045 2 63.90 2 28493 AEV_1_3_RA2_01_1232.d 8.34E4 1 1 479 485 Guanidination
K.K(+43.99)PVHLTAAMGYK.A Y 18.33 1358.7017 12 5.3 453.9102 3 61.55 2 26890 AEV_1_3_RA2_01_1232.d 9.27E4 1 1 191 202 Carboxylation (DKW)
M(+42.01)ATE(+21.98)STQSNSK.K Y 18.31 1246.5112 11 -69.6 624.2195 2 25.12 1 6593 AEV 2_3_RA2_01_1224.d 2.39E4 1 1 1 11 Acetylation (Protein N-term); Sodium adduct
R.AFMGTLK.K Y 18.02 766.4047 7 5.8 384.2119 2 57.70 2 24472 AEV_1_3_RA2_01_1232.d 7.65E4 1 1 531 537
R.K(+43.99)TLYPQVSR.K Y 18.00 1134.6033 9 -99.9 379.1706 3 59.03 1 25785 AEV 2_3_RA2_01_1224.d 0 1 1 493 501 Carboxylation (DKW)
K.YC(+57.02)TVVR(+14.02).L Y 18.00 810.4058 6 3.5 406.2116 2 42.47 2 16697 AEV_1_3_RA2_01_1232.d 2.39E5 1 1 307 312 Carbamidomethylation; Methylation(KR)
R.V(+43.01)LTLR.K N 17.89 643.4017 5 -47.5 322.6928 2 57.61 1 24847 AEV 2_3_RA2_01_1224.d 6.46E5 1 1 488 492 Carbamylation
K.GSIAVR(+55.92).V Y 17.88 657.2744 6 70.6 658.3281 1 52.24 1 21534 AEV 2_3_RA2_01_1224.d 8.17E4 1 1 48 53 Replacement of 2 protons by nickel
K.G(+42.01)HGFNGVTSR(+14.02).W Y 17.78 1086.5206 10 -44.7 363.1646 3 55.61 1 23573 AEV 2_3_RA2_01_1224.d 8.73E4 1 1 376 385 Acetylation (N-term); Methylation(KR)
K.D(+43.01)DPKKPVHLTAAMGYK.A Y 17.77 1812.9192 16 -8.4 907.4593 2 87.88 3 53522 AEV_3_3_RA3_01_1233.d 1.7E5 1 1 187 202 Carbamylation
M(+15.99)ATESTQSNSKKLYTGSC(+57.02)HC(+57.02)GFVK.Y Y 17.71 2736.2305 24 -35.3 685.0408 4 85.96 1 46536 AEV 2_3_RA2_01_1224.d 9.15E4 1 1 1 24 Oxidation (M); Carbamidomethylation
K.DLVTAA(+123.01) Y 17.53 711.3204 6 -14.3 712.3175 1 73.99 1 37079 AEV 2_3_RA2_01_1224.d 2.33E4 1 1 539 544 glycosylphosphatidylinositol
K.GSVPGVKKR.V Y 17.41 926.5661 9 -5.7 309.8609 3 12.04 2 3237 AEV_1_3_RA2_01_1232.d 4.46E4 1 1 479 487
K.N(+.98)DYVMLKGSVPGVK.K Y 17.35 1506.7751 14 -1.7 503.2648 3 67.79 3 38486 AEV_3_3_RA3_01_1233.d 2.25E5 1 1 472 485 Deamidation (NQ)
R.YGEVK(+21.98)(+42.01).N Y 17.31 658.2938 5 -0.5 659.3008 1 89.61 1 49332 AEV 2_3_RA2_01_1224.d 2.08E4 1 1 467 471 Sodium adduct; Acetylation (K)
K.W(+42.01)IDTS(-18.01)SK.F Y 17.28 859.4076 7 129.0 860.5258 1 111.87 1 59319 AEV 2_3_RA2_01_1224.d 2.93E5 1 1 511 517 Acetylation (N-term); Dehydration
K.KAHLMEVQVNGGSIAD(-18.01)K(+14.02).V Y 17.26 1791.9302 17 2.4 448.9909 4 64.81 3 36123 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 328 344 Dehydration; Methylation(KR)
R.IGKGS(+13.03)DEGNASTEFDVSK.K Y 17.24 1852.8802 18 21.6 618.6473 3 55.39 3 29175 AEV_3_3_RA3_01_1233.d 7.76E4 1 1 438 455 Michael addition with methylamine
K.QITPMGGFVR(+31.99)YGEVK.N Y 17.15 1712.8556 15 -27.6 429.2094 4 76.73 1 39240 AEV 2_3_RA2_01_1224.d 1.16E5 1 1 457 471 Dihydroxy
K.RAFMGTLK(+31.99).K Y 16.96 954.4957 8 -69.3 319.1505 3 56.85 1 24323 AEV 2_3_RA2_01_1224.d 0 1 1 530 537 Dihydroxy
K.FE(+43.99)APR.H Y 16.95 662.3024 5 -73.0 332.1343 2 52.89 1 21900 AEV 2_3_RA2_01_1224.d 0 1 1 158 162 Carboxylation (E)
MATESTQSNS(+162.05)K.K Y 16.94 1344.5714 11 -81.5 449.1612 3 18.26 1 4330 AEV 2_3_RA2_01_1224.d 4.47E3 1 1 1 11 Hexose (NSY)
R.YGEVK.N Y 16.89 594.3013 5 7.5 595.3130 1 66.46 2 30273 AEV_1_3_RA2_01_1232.d 1.58E4 2 2 467 471
K.F(+42.01)GHGAFQT(-18.01)PAEKR.A Y 16.83 1468.7211 13 3.8 735.3706 2 71.87 3 41702 AEV_3_3_RA3_01_1233.d 1.35E5 1 1 518 530 Acetylation (N-term); Dehydration
K.W(+71.04)IDTSSK.F Y 16.52 906.4447 7 -0.3 907.4517 1 80.76 3 48656 AEV_3_3_RA3_01_1233.d 1.79E4 1 1 511 517 Propionamide (K, X@N-term)
K.V(+42.01)KS(+79.97)FPKDDPK.K Y 16.40 1281.6006 10 10.3 428.2119 3 30.15 3 13480 AEV_3_3_RA3_01_1233.d 0 1 1 181 190 Acetylation (N-term); Phosphorylation (STY)
R.VLTLR(+14.02)K.T Y 16.35 742.5065 6 -34.7 372.2476 2 34.91 2 13028 AEV_1_3_RA2_01_1232.d 0 1 1 488 493 Methylation(KR)
K.S(+42.01)EPYPDGSWVK(+27.99)MSHR.K Y 16.33 1844.8152 15 -0.8 615.9452 3 71.68 1 35252 AEV 2_3_RA2_01_1224.d 3.34E5 1 1 142 156 Acetylation (N-term); Formylation
K.GSVPGVK(+42.01).K Y 16.26 684.3806 7 -70.8 343.1733 2 57.40 1 24684 AEV 2_3_RA2_01_1224.d 0 1 1 479 485 Acetylation (K)
R.K(+42.01)TLYPQVSR.K Y 16.21 1132.6240 9 -10.9 378.5445 3 39.71 3 19226 AEV_3_3_RA3_01_1233.d 5.69E4 1 1 493 501 Acetylation (N-term)
K.GSVP(+31.99)GVK(+42.01).K Y 16.18 716.3704 7 -22.4 717.3616 1 83.71 2 43398 AEV_1_3_RA2_01_1232.d 1.71E5 1 1 479 485 Dihydroxy; Acetylation (K)
K.F(+42.01)EAPR.H Y 16.16 660.3231 5 74.6 331.1935 2 37.78 3 18059 AEV_3_3_RA3_01_1233.d 4.82E4 1 1 158 162 Acetylation (N-term)
K.G(+27.99)SVPGVK.K Y 16.09 670.3650 7 11.7 336.1937 2 14.18 3 4672 AEV_3_3_RA3_01_1233.d 0 1 1 479 485 Formylation
K.KPVHLT(+114.04)AAMGYK.A Y 16.03 1428.7548 12 7.7 358.1987 4 49.65 3 25548 AEV_3_3_RA3_01_1233.d 0 1 1 191 202 Ubiquitin
K.KTYHR.F Y 15.93 703.3765 5 -7.6 704.3785 1 82.46 3 49925 AEV_3_3_RA3_01_1233.d 0 1 1 80 84
K.IHLQYWDGR.T Y 15.92 1186.5884 9 -3.6 594.2993 2 31.16 3 14065 AEV_3_3_RA3_01_1233.d 0 1 1 124 132
R.AFMGTLKK(+14.02).D Y 15.88 908.5153 8 -32.5 455.2502 2 46.36 3 23427 AEV_3_3_RA3_01_1233.d 0 1 1 531 538 Methylation(KR)
K.KAFTK.Y Y 15.73 593.3536 5 -203.9 594.2399 1 74.51 1 37480 AEV 2_3_RA2_01_1224.d 3.13E3 1 1 280 284
K.SFPK(+14.02)DDPK.K Y 15.62 946.4760 8 -92.8 474.2013 2 47.28 1 18659 AEV 2_3_RA2_01_1224.d 1.27E5 1 1 183 190 Methylation(KR)
K.T(+79.97)LYPQ(+.98)VS(+79.97)RK.A Y 15.58 1251.5302 9 21.7 313.8966 4 54.14 1 22652 AEV 2_3_RA2_01_1224.d 0 1 1 494 502 Phosphorylation (STY); Deamidation (NQ)
K.YAKNHSENT(+79.97)GASVSRELER(+14.02).I Y 15.50 2241.0176 19 47.9 561.2885 4 74.03 2 35897 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 285 303 Phosphorylation (STY); Methylation(KR)
R.IGK(+14.02)GS(-18.01)DEGNASTEFDVSK.K Y 15.48 1835.8536 18 24.0 612.9732 3 51.64 3 26815 AEV_3_3_RA3_01_1233.d 7.11E4 1 1 438 455 Methylation(KR); Dehydration
K.DDPKKPVHLTAAMGYK.A Y 15.47 1769.9133 16 0.1 354.9900 5 53.12 3 27788 AEV_3_3_RA3_01_1233.d 1.45E5 1 1 187 202
M(+42.01)ATES(+79.97)TQSNSK(+42.01).K Y 15.46 1346.5061 11 12.0 674.2684 2 62.60 1 28475 AEV 2_3_RA2_01_1224.d 0 1 1 1 11 Acetylation (Protein N-term); Phosphorylation (STY); Acetylation (K)
K.KPVH(+77.91)LTAAMGYK.A Y 15.43 1392.6223 12 -57.0 697.2787 2 84.70 1 45561 AEV 2_3_RA2_01_1224.d 7.03E4 1 1 191 202 Bromination
K.G(+43.01)SVPGVK.K Y 15.28 685.3759 7 21.6 343.7026 2 20.85 2 6764 AEV_1_3_RA2_01_1232.d 4.35E5 1 1 479 485 Carbamylation
K.GSDEGNASTEFDVS(+79.97)K.K Y 15.23 1621.6145 15 74.9 406.4413 4 39.46 1 14098 AEV 2_3_RA2_01_1224.d 4.84E5 1 1 441 455 Phosphorylation (STY)
R.YGEVK(+14.96)NDYVMLK.G Y 15.14 1472.6857 12 -46.9 491.8795 3 74.81 1 37724 AEV 2_3_RA2_01_1224.d 2.11E5 1 1 467 478 Alpha-amino adipic acid
K.GSVPGVKK.R Y 15.06 770.4650 8 -40.4 386.2242 2 13.31 3 4248 AEV_3_3_RA3_01_1233.d 0 1 1 479 486
R.VAENEE(+21.98)FK.L Y 15.04 986.4321 8 -13.9 494.2164 2 33.31 1 10807 AEV 2_3_RA2_01_1224.d 6.35E4 1 1 54 61 Sodium adduct
total 226 peptides
C1G810
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.HDGGFNIVHIKDAIDNSFATR.E Y 162.72 2326.1455 21 5.3 582.5468 4 79.04 2 39799 AEV_1_3_RA2_01_1232.d 3.14E6 12 12 201 221
K.ITSFIKFDTGVIAMATGGR.N Y 147.11 1984.0452 19 3.5 662.3580 3 84.82 2 44187 AEV_1_3_RA2_01_1232.d 7.94E5 5 5 169 187
R.VQLGKGGIPFLVTHDAR.T Y 143.05 1807.0104 17 -28.7 603.3268 3 73.44 2 35518 AEV_1_3_RA2_01_1232.d 1.96E6 7 7 129 145
R.ESNVFIIGQEKPWISLPK.G Y 135.87 2084.1306 18 1.5 695.7185 3 82.82 2 42759 AEV_1_3_RA2_01_1232.d 3.73E6 9 9 222 239
K.RVQLGKGGIPFLVTHDAR.T Y 127.24 1963.1115 18 2.5 393.6306 5 70.61 2 33308 AEV_1_3_RA2_01_1232.d 1.12E6 6 6 128 145
K.VRTDSTYPAGFMDVISIEK.T Y 125.90 2128.0510 19 3.2 710.3599 3 81.03 2 41372 AEV_1_3_RA2_01_1232.d 1.01E6 5 5 76 94
K.LRDC(+57.02)LPLVVFIR.N Y 124.41 1499.8646 12 1.5 500.9629 3 82.87 2 42800 AEV_1_3_RA2_01_1232.d 3.9E6 7 7 38 49 Carbamidomethylation
R.ERHDGGFNIVHIKDAIDNSFATR.E Y 122.29 2611.2891 23 5.8 523.2681 5 77.67 2 38706 AEV_1_3_RA2_01_1232.d 8.09E5 5 5 199 221
R.LSAPSHWLLDKLSGSYAPRPSPGPHK.L Y 121.34 2797.4663 26 -0.7 560.5001 5 74.75 3 43936 AEV_3_3_RA3_01_1233.d 1.47E6 5 5 12 37
R.IQAEEAEYKLC(+57.02)K.V Y 116.17 1480.7231 12 4.1 494.5837 3 54.14 2 22673 AEV_1_3_RA2_01_1232.d 5.02E6 11 11 114 125 Carbamidomethylation
R.TDSTYPAGFMDVISIEK.T Y 113.44 1872.8815 17 27.9 625.3185 3 84.39 2 43935 AEV_1_3_RA2_01_1232.d 1.77E6 7 7 78 94
K.TGENFRLVYDTK.G Y 110.83 1441.7201 12 2.8 481.5820 3 64.54 2 28962 AEV_1_3_RA2_01_1232.d 1.78E6 7 7 95 106
R.TIRYPDPAIKVNDTVK.V Y 108.31 1829.0046 16 3.0 458.2598 4 64.60 2 29021 AEV_1_3_RA2_01_1232.d 2.42E6 6 6 146 161
R.DC(+57.02)LPLVVFIR.N Y 107.49 1230.6794 10 1.7 616.3480 2 87.14 2 45720 AEV_1_3_RA2_01_1232.d 1.63E6 8 8 40 49 Carbamidomethylation
K.GGIPFLVTHDAR.T Y 105.21 1281.6830 12 2.2 641.8502 2 70.77 2 33456 AEV_1_3_RA2_01_1232.d 7.84E6 12 12 134 145
R.ESNVFIIGQEKPWISLPKGK.G Y 104.30 2269.2471 20 -0.6 568.3187 4 78.80 3 47128 AEV_3_3_RA3_01_1233.d 9.46E4 1 1 222 241
K.VDLATGKITSFIKFDTGVIAMATGGR.N Y 102.94 2668.4258 26 10.2 668.1205 4 88.49 2 46455 AEV_1_3_RA2_01_1232.d 4.65E4 2 2 162 187
R.TDSTYPAGFMDVISIEKTGENFR.L Y 99.87 2577.2056 23 7.0 860.0818 3 83.99 2 43600 AEV_1_3_RA2_01_1232.d 4.81E5 3 3 78 100
K.VNDTVKVDLATGK.I Y 99.18 1358.7405 13 -11.0 680.3701 2 53.34 3 27957 AEV_3_3_RA3_01_1233.d 1.79E6 7 7 156 168
K.FDTGVIAMATGGR.N Y 92.68 1294.6339 13 1.3 648.3251 2 76.61 3 45387 AEV_3_3_RA3_01_1233.d 5.9E5 4 4 175 187
R.HDGGFN(+.98)IVHIKDAIDNSFATR.E Y 90.51 2327.1294 21 9.5 582.7952 4 79.19 2 39917 AEV_1_3_RA2_01_1232.d 4.92E5 3 3 201 221 Deamidation (NQ)
K.LRDC(+57.02)LPLVVFIR(+14.02).N Y 88.81 1513.8802 12 1.6 505.6348 3 84.58 2 44022 AEV_1_3_RA2_01_1232.d 1.8E5 2 2 38 49 Carbamidomethylation; Methylation(KR)
K.LSGSYAPRPSPGPHK.L Y 88.65 1549.8000 15 1.9 388.4580 4 32.05 3 14599 AEV_3_3_RA3_01_1233.d 2.65E6 9 9 23 37
R.ETNAILMQR.L Y 87.69 1074.5492 9 2.2 538.2831 2 56.00 2 23565 AEV_1_3_RA2_01_1232.d 9.98E5 7 7 60 68
R.IQAEEAEYK.L Y 84.27 1079.5134 9 4.2 540.7662 2 34.07 2 12623 AEV_1_3_RA2_01_1232.d 1.79E6 7 7 114 122
R.TDSTYPAGFMDVISIEK(+14.02).T Y 84.13 1886.8971 17 7.5 629.9777 3 87.21 2 45746 AEV_1_3_RA2_01_1232.d 1.27E6 9 9 78 94 Methylation(KR)
K.VRTDSTYPAGFMDVISIEK(+14.02).T Y 79.27 2142.0667 19 2.9 715.0316 3 83.59 2 43311 AEV_1_3_RA2_01_1232.d 1.94E5 2 2 76 94 Methylation(KR)
R.TIRYPDPAIK.V Y 79.01 1172.6553 10 -2.5 391.8914 3 57.38 3 30494 AEV_3_3_RA3_01_1233.d 4.78E6 11 11 146 155
R.ETNAILM(+15.99)QR.L Y 77.99 1090.5441 9 1.8 546.2803 2 41.16 3 20163 AEV_3_3_RA3_01_1233.d 4.35E6 40 40 60 68 Oxidation (M)
R.ESNVFIIGQEK(+14.02)PWISLPK.G Y 77.87 2098.1462 18 1.1 700.3901 3 84.74 2 44194 AEV_1_3_RA2_01_1232.d 1.29E6 6 6 222 239 Methylation(KR)
R.ER(+14.02)HDGGFNIVHIKDAIDNSFATR.E Y 77.77 2625.3047 23 0.6 526.0685 5 76.53 3 45322 AEV_3_3_RA3_01_1233.d 9.56E4 1 1 199 221 Methylation(KR)
R.VQLGKGGIPFLVTHDAR(+14.02).T Y 77.59 1821.0260 17 -2.2 456.2628 4 73.15 3 42696 AEV_3_3_RA3_01_1233.d 2.98E5 3 3 129 145 Methylation(KR)
K.VRTDSTYPAGFMDVISIEKTGENFR.L Y 76.60 2832.3752 25 7.7 709.1065 4 81.50 2 41741 AEV_1_3_RA2_01_1232.d 2.53E5 2 2 76 100
R.ESNVFIIGQEKPWISLPK(+14.02).G Y 76.33 2098.1462 18 -1.0 700.3887 3 83.72 3 50822 AEV_3_3_RA3_01_1233.d 7E5 4 4 222 239 Methylation(KR)
R.RAVALAGH Y 75.21 793.4558 8 10.4 397.7393 2 20.40 2 6576 AEV_1_3_RA2_01_1232.d 5.22E5 4 4 255 262
R.TDSTYPAGFM(+15.99)DVISIEK.T Y 74.74 1888.8765 17 -1.5 945.4441 2 79.63 3 47789 AEV_3_3_RA3_01_1233.d 3.01E5 2 2 78 94 Oxidation (M)
K.LR(+14.02)DC(+57.02)LPLVVFIR.N Y 74.15 1513.8802 12 0.4 505.6342 3 84.41 3 51308 AEV_3_3_RA3_01_1233.d 2.88E5 2 2 38 49 Methylation(KR); Carbamidomethylation
R.ESNVFIIGQ(+.98)EKPWISLPK.G Y 73.97 2085.1145 18 8.6 696.0515 3 82.62 3 50043 AEV_3_3_RA3_01_1233.d 3.47E5 2 2 222 239 Deamidation (NQ)
R.E(+14.02)SNVFIIGQEKPWISLPK.G Y 72.00 2098.1462 18 -2.6 700.3875 3 82.92 3 50257 AEV_3_3_RA3_01_1233.d 2.14E5 3 3 222 239 Methylation(others)
K.LR(+.98)DC(+57.02)LPLVVFIR.N Y 71.26 1500.8486 12 2.6 501.2914 3 84.65 3 51459 AEV_3_3_RA3_01_1233.d 3.79E5 3 3 38 49 Deamidation (R); Carbamidomethylation
K.LRDC(+57.02)LPLVVFIRNR.L Y 70.28 1770.0087 14 5.1 443.5117 4 79.35 2 40046 AEV_1_3_RA2_01_1232.d 3.95E4 1 1 38 51 Carbamidomethylation
R.ERHDGGFNIVHIK(-1.03)DAIDNSFATR.E Y 68.58 2610.2573 23 19.8 523.0691 5 76.79 3 45539 AEV_3_3_RA3_01_1233.d 0 1 1 199 221 Lysine oxidation to aminoadipic semialdehyde
R.ESNVFIIGQEKPW(+15.99)ISLPK.G Y 68.07 2100.1255 18 11.8 701.0574 3 81.63 2 41841 AEV_1_3_RA2_01_1232.d 2.08E5 3 3 222 239 Oxidation (HW)
R.IQAEE(+14.02)AEYKLC(+57.02)K.V Y 67.14 1494.7388 12 0.1 499.2536 3 58.59 3 31356 AEV_3_3_RA3_01_1233.d 6.97E5 3 3 114 125 Methylation(others); Carbamidomethylation
R.VGVITHRER.H Y 66.11 1065.6042 9 -1.2 533.8088 2 17.38 3 6470 AEV_3_3_RA3_01_1233.d 1.09E6 5 5 192 200
R.IQAE(+14.02)EAEYKLC(+57.02)K.V Y 64.73 1494.7388 12 3.9 499.2555 3 59.39 2 25479 AEV_1_3_RA2_01_1232.d 7.07E5 4 4 114 125 Methylation(others); Carbamidomethylation
R.ESN(+.98)VFIIGQEKPWISLPK.G Y 63.79 2085.1145 18 7.3 696.0505 3 83.36 3 50570 AEV_3_3_RA3_01_1233.d 3.04E4 1 1 222 239 Deamidation (NQ)
R.TIRYPDPAIK(-1.03)VNDTVKVDLATGK.I Y 63.05 2512.3535 23 29.8 503.4930 5 72.64 2 34842 AEV_1_3_RA2_01_1232.d 0 2 2 146 168 Lysine oxidation to aminoadipic semialdehyde
R.VGVITHR.E Y 62.10 780.4606 7 2.6 391.2386 2 21.10 2 6848 AEV_1_3_RA2_01_1232.d 1.82E6 9 9 192 198
K.FDTGVIAMATGGR(+14.02).N Y 61.46 1308.6497 13 -2.3 655.3306 2 78.35 3 46784 AEV_3_3_RA3_01_1233.d 1.65E5 2 2 175 187 Methylation(KR)
R.HDGGFNIVHIKDAIDNSFATR(+14.02).E Y 60.61 2340.1611 21 10.5 469.0444 5 80.00 2 40561 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 201 221 Methylation(KR)
K.GVKLSIAEERDR.R Y 60.49 1371.7469 12 5.0 458.2585 3 41.98 3 20634 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 242 253
R.IQAEEAEYKLC(+57.02)K(+14.02).V Y 59.06 1494.7388 12 1.7 499.2544 3 56.56 3 29950 AEV_3_3_RA3_01_1233.d 1.21E6 5 5 114 125 Carbamidomethylation; Methylation(KR)
R.YPDPAIK.V Y 58.93 802.4225 7 -0.8 402.2182 2 44.34 3 22137 AEV_3_3_RA3_01_1233.d 2.08E6 6 6 149 155
R.LSAPSHWLLDK.L Y 58.81 1265.6768 11 -3.6 422.8980 3 70.81 3 40912 AEV_3_3_RA3_01_1233.d 3.54E5 1 1 12 22
R.YPDPAIKVNDTVKVDLATGK.I Y 58.72 2143.1523 20 3.3 536.7971 4 71.44 3 41357 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 149 168
K.LSIAEERDR.R Y 58.38 1087.5621 9 -1.4 544.7876 2 32.00 3 14598 AEV_3_3_RA3_01_1233.d 5.45E6 10 10 245 253
K.GGIPFLVTHDAR(+14.02).T Y 58.30 1295.6986 12 -3.6 432.9053 3 71.17 3 41143 AEV_3_3_RA3_01_1233.d 1.2E6 5 5 134 145 Methylation(KR)
R.LKYALNAR.E Y 57.59 947.5552 8 -0.2 316.8589 3 38.59 3 18545 AEV_3_3_RA3_01_1233.d 2.76E6 7 7 52 59
K.DAIDNSFATR.E Y 56.99 1108.5149 10 -84.9 555.2177 2 63.66 1 29319 AEV 2_3_RA2_01_1224.d 1.27E6 6 6 212 221
R.IQ(+.98)AEEAEYKLC(+57.02)K.V Y 56.33 1481.7072 12 23.2 494.9211 3 56.74 2 23960 AEV_1_3_RA2_01_1232.d 3.58E5 4 4 114 125 Deamidation (NQ); Carbamidomethylation
R.AVALAGH Y 56.10 637.3547 7 4.0 319.6859 2 23.11 2 7688 AEV_1_3_RA2_01_1232.d 1.58E6 9 9 256 262
R.IQAEEAE(+14.02)YKLC(+57.02)K.V Y 55.02 1494.7388 12 27.0 499.2670 3 59.35 3 31922 AEV_3_3_RA3_01_1233.d 9.9E4 3 3 114 125 Methylation(others); Carbamidomethylation
K.VNDTVKVDLATGKITSFIKFDTGVIAMATGGR.N Y 54.62 3324.7751 32 -2.3 665.9608 5 87.10 3 53058 AEV_3_3_RA3_01_1233.d 1.41E5 2 2 156 187
K.FDTGVIAM(+15.99)ATGGR.N Y 51.42 1310.6289 13 -5.0 656.3184 2 69.72 3 40016 AEV_3_3_RA3_01_1233.d 2.51E5 2 2 175 187 Oxidation (M)
K.GRFTVHR.I Y 51.34 871.4777 7 3.1 436.7475 2 19.77 2 6303 AEV_1_3_RA2_01_1232.d 8.23E5 4 4 107 113
R.TIRYPDPAIKVNDTVKVDLATGK.I Y 50.58 2513.3853 23 -5.2 503.6817 5 112.32 3 62624 AEV_3_3_RA3_01_1233.d 1.05E5 2 2 146 168
R.IQAEEAEYK(+14.02).L Y 49.41 1093.5291 9 3.2 547.7736 2 41.77 3 20515 AEV_3_3_RA3_01_1233.d 6.26E5 4 4 114 122 Methylation(KR)
R.ESNVFIIGQ(+.98)EKPWISLPK(+14.02).G Y 48.42 2099.1301 18 10.6 700.7247 3 84.10 2 43680 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 222 239 Deamidation (NQ); Methylation(KR)
K.GVKLSIAEER.D Y 47.68 1100.6189 10 2.5 367.8812 3 49.38 3 25330 AEV_3_3_RA3_01_1233.d 2.26E5 3 3 242 251
K.G(+41.03)GIPFLVTHDAR.T Y 47.37 1322.7095 12 11.8 441.9156 3 71.24 2 33771 AEV_1_3_RA2_01_1232.d 8.05E4 1 1 134 145 Amidination of lysines or N-terminal amines with methyl acetimidate
K.YALNAR.E Y 46.84 706.3762 6 -88.0 354.1643 2 41.12 1 15101 AEV 2_3_RA2_01_1224.d 1.8E6 5 5 54 59
R.ETN(+.98)AILMQR.L Y 46.21 1075.5332 9 14.8 538.7819 2 54.07 3 28400 AEV_3_3_RA3_01_1233.d 5.07E5 3 3 60 68 Deamidation (NQ)
K.RLSAPSHWLLDK.L Y 46.11 1421.7778 12 -90.0 356.4197 4 79.84 1 41716 AEV 2_3_RA2_01_1224.d 3.38E5 2 2 11 22
R.VGVITHR(+14.02)ER.H Y 45.83 1079.6200 9 -11.6 540.8110 2 24.56 3 10326 AEV_3_3_RA3_01_1233.d 5.81E4 1 1 192 200 Methylation(KR)
K.LSIAEER.D Y 45.46 816.4341 7 -0.6 409.2241 2 38.64 3 18587 AEV_3_3_RA3_01_1233.d 2.44E6 7 7 245 251
K.ITSFIKFDTGVIAMATGGR(+14.02).N Y 45.18 1998.0608 19 -11.6 667.0198 3 85.80 2 44841 AEV_1_3_RA2_01_1232.d 8.78E4 1 1 169 187 Methylation(KR)
R.LVKVDGKVR.T Y 45.10 1012.6393 9 -11.5 507.3211 2 23.15 3 9522 AEV_3_3_RA3_01_1233.d 2.66E5 3 3 69 77
R.IQAE(+14.02)EAEYK.L Y 44.86 1093.5291 9 1.1 547.7724 2 42.78 3 21224 AEV_3_3_RA3_01_1233.d 3.77E5 3 3 114 122 Methylation(others)
R.LVKVDGK.V Y 43.86 757.4697 7 4.1 379.7437 2 16.62 2 5022 AEV_1_3_RA2_01_1232.d 5.27E5 4 4 69 75
R.TIRYPDPAIKVN(+.98)DTVKVDLATGK.I Y 43.72 2514.3694 23 -1.3 503.8805 5 75.24 2 36801 AEV_1_3_RA2_01_1232.d 6.51E4 1 1 146 168 Deamidation (NQ)
R.FTVHR.I Y 43.71 658.3551 5 -89.9 330.1552 2 34.59 1 11469 AEV 2_3_RA2_01_1224.d 1.32E6 3 3 109 113
K.TGENFRLVYDTK(+14.02).G Y 43.32 1455.7357 12 2.9 486.2539 3 67.10 2 30728 AEV_1_3_RA2_01_1232.d 1.77E5 3 3 95 106 Methylation(KR)
R.LVYDTK.G Y 43.22 737.3959 6 -89.8 369.6721 2 38.83 1 13716 AEV 2_3_RA2_01_1224.d 1.51E6 5 5 101 106
R.TIRYPDPAIKVNDTVK(+14.02).V Y 42.33 1843.0203 16 2.8 461.7636 4 66.55 3 37523 AEV_3_3_RA3_01_1233.d 0 1 1 146 161 Methylation(KR)
R.IQAEEAE(+14.02)YK.L Y 41.67 1093.5291 9 5.1 547.7746 2 41.36 3 20238 AEV_3_3_RA3_01_1233.d 1.71E5 2 2 114 122 Methylation(others)
K.VDLATGKITSFIK(-1.03)FDTGVIAMATGGR.N Y 41.60 2667.3940 26 -1.6 667.8547 4 87.99 3 53599 AEV_3_3_RA3_01_1233.d 3.57E4 1 1 162 187 Lysine oxidation to aminoadipic semialdehyde
K.TGENFR.L Y 40.98 722.3347 6 8.0 362.1775 2 16.84 2 5088 AEV_1_3_RA2_01_1232.d 6.31E5 4 4 95 100
K.L(+43.01)R(+14.02)DC(+57.02)LPLVVFIR.N Y 40.89 1556.8861 12 39.8 519.9900 3 83.29 3 50519 AEV_3_3_RA3_01_1233.d 0 1 1 38 49 Carbamylation; Methylation(KR); Carbamidomethylation
K.VN(+.98)D(+43.99)TVKVDLATGK.I Y 39.68 1403.7144 13 -14.4 468.9053 3 53.50 3 28048 AEV_3_3_RA3_01_1233.d 0 1 1 156 168 Deamidation (NQ); Carboxylation (DKW)
K.LSIAEER(+14.02).D Y 39.64 830.4498 7 -1.0 416.2318 2 53.05 3 27743 AEV_3_3_RA3_01_1233.d 8E5 5 5 245 251 Methylation(KR)
R.HDGGFNIVHIK.D Y 39.32 1235.6411 11 2.7 309.9184 4 58.87 3 31574 AEV_3_3_RA3_01_1233.d 2.49E5 3 3 201 211
K.G(+87.03)GIPFLVTHDAR.T Y 38.79 1368.7150 12 8.4 457.2495 3 70.83 2 33468 AEV_1_3_RA2_01_1232.d 0 1 1 134 145 Glycidamide adduct
R.ETNAILMQ(+.98)R.L Y 37.99 1075.5332 9 -13.0 538.7669 2 58.78 2 25101 AEV_1_3_RA2_01_1232.d 3.61E5 3 3 60 68 Deamidation (NQ)
R.Y(+183.98)PDPAIKVNDTVKVDLATGK.I Y 37.98 2327.1355 20 46.2 466.4559 5 55.74 2 23394 AEV_1_3_RA2_01_1232.d 4.5E5 1 1 149 168 3-Sulfobenzoic succinimidyl ester
R.ESN(+.98)VFIIGQEK(+14.02)PWISLPK(+14.02).G Y 37.04 2113.1460 18 10.6 705.3967 3 85.43 3 51991 AEV_3_3_RA3_01_1233.d 1.11E4 1 1 222 239 Deamidation (NQ); Methylation(KR)
R.IQAEE(+14.02)AEYK.L Y 35.89 1093.5291 9 8.9 547.7767 2 43.70 3 21720 AEV_3_3_RA3_01_1233.d 5.31E5 3 3 114 122 Methylation(others)
R.L(+43.01)KYALNAR.E Y 35.70 990.5610 8 -97.0 331.1623 3 60.90 1 27144 AEV 2_3_RA2_01_1224.d 0 1 1 52 59 Carbamylation
K.ITSFIK.F Y 35.07 707.4218 6 -11.0 708.4213 1 52.02 3 27068 AEV_3_3_RA3_01_1233.d 9.42E5 7 7 169 174
R.VQLGK(+14.02)GGIPFLVTHDAR.T Y 34.99 1821.0260 17 -22.3 456.2536 4 70.14 3 40330 AEV_3_3_RA3_01_1233.d 0 1 1 129 145 Methylation(KR)
R.HDGGFNIVHIK(+14.02)DAIDNSFATR.E Y 34.69 2340.1611 21 5.4 469.0420 5 79.99 3 48058 AEV_3_3_RA3_01_1233.d 4.57E4 1 1 201 221 Methylation(KR)
K.VKRVQLGKGGIPFLVTHDAR.T Y 34.21 2190.2749 20 17.1 439.0698 5 69.97 3 40201 AEV_3_3_RA3_01_1233.d 0 1 1 126 145
R.HDGGFNIVHIK(-1.03)DAIDNSFATR.E Y 33.07 2325.1138 21 -69.4 465.9978 5 78.92 3 47223 AEV_3_3_RA3_01_1233.d 0 2 2 201 221 Lysine oxidation to aminoadipic semialdehyde
K.VKRVQLGK(+15.99)GGIPFLVTHDAR.T Y 32.84 2206.2698 20 -43.6 442.2420 5 70.77 2 33432 AEV_1_3_RA2_01_1232.d 0 1 1 126 145 Oxidation or Hydroxylation
K.RVQLGKGGIPFLVT(-2.02)HDAR.T Y 32.37 1961.0958 18 -16.0 393.2202 5 68.87 3 39351 AEV_3_3_RA3_01_1233.d 0 2 2 128 145 2-amino-3-oxo-butanoic_acid
R.ETNAILM(+15.99)Q(+.98)R.L Y 31.73 1091.5281 9 4.2 546.7736 2 45.34 3 22773 AEV_3_3_RA3_01_1233.d 5.08E5 2 2 60 68 Oxidation (M); Deamidation (NQ)
K.G(+42.01)GIPFLVTHDAR(+14.02).T Y 31.64 1337.7091 12 5.4 446.9127 3 72.44 2 34687 AEV_1_3_RA2_01_1232.d 2.6E5 2 2 134 145 Acetylation (N-term); Methylation(KR)
K.LSIAEERDR(+14.02).R Y 30.50 1101.5778 9 2.4 368.2007 3 45.26 3 22725 AEV_3_3_RA3_01_1233.d 6.3E5 3 3 245 253 Methylation(KR)
R.ETNAILM(+15.99)QR(+14.02).L Y 29.93 1104.5597 9 -1.6 553.2863 2 52.09 3 27117 AEV_3_3_RA3_01_1233.d 1.73E5 1 1 60 68 Oxidation (M); Methylation(KR)
K.VDLATGKITSFIK.F Y 29.58 1391.8024 13 -1.2 464.9409 3 74.98 3 44104 AEV_3_3_RA3_01_1233.d 3.71E4 1 1 162 174
K.GGIPFLVTHD(-18.01)AR.T Y 29.50 1263.6724 12 -2.3 422.2304 3 71.79 3 41640 AEV_3_3_RA3_01_1233.d 0 1 1 134 145 Dehydration
R.IQ(+.98)AEEAEYK.L Y 28.71 1080.4974 9 -84.0 541.2106 2 45.92 1 17820 AEV 2_3_RA2_01_1224.d 1.68E5 2 2 114 122 Deamidation (NQ)
K.VRTDSTYPAGFMDVISIEK(+14.02)TGENFR(-.98).L Y 28.22 2845.4067 25 13.5 712.3686 4 81.03 3 48867 AEV_3_3_RA3_01_1233.d 0 1 1 76 100 Methylation(KR); Amidation
K.IT(+14.02)SFIKFDTGVIAMATGGR.N Y 28.12 1998.0608 19 5.2 667.0310 3 90.39 2 47418 AEV_1_3_RA2_01_1232.d 9.08E4 1 1 169 187 Methylation(others)
R.L(+43.01)SAPSHWLLDK.L Y 28.01 1308.6826 11 48.4 437.2559 3 71.73 2 34143 AEV_1_3_RA2_01_1232.d 0 1 1 12 22 Carbamylation
R.LVYDTKGR.F Y 27.21 950.5185 8 1.1 476.2670 2 23.98 2 8051 AEV_1_3_RA2_01_1232.d 2.23E5 3 3 101 108
R.HDGGFNIVHIKDAIDN(+.98)SFATR.E Y 26.66 2327.1294 21 -85.0 466.3936 5 87.92 1 48045 AEV 2_3_RA2_01_1224.d 2.05E5 1 1 201 221 Deamidation (NQ)
K.G(+104.03)GIPFLVTHDAR.T Y 26.54 1385.7091 12 50.3 462.9335 3 73.46 2 35464 AEV_1_3_RA2_01_1232.d 0 1 1 134 145 Benzoyl
R.TDSTYPAGFMDVISIEK(+28.03).T Y 26.50 1900.9128 17 7.1 951.4705 2 88.67 3 54000 AEV_3_3_RA3_01_1233.d 3.98E4 2 2 78 94 Dimethylation(KR)
K.LSIAEER(+14.02)DR.R Y 26.43 1101.5778 9 1.2 551.7968 2 41.33 3 20219 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 245 253 Methylation(KR)
R.AVALAGH(+14.02) Y 25.98 651.3704 7 0.5 326.6926 2 26.41 3 11366 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 256 262 Methylation(others)
K.TGENFR(+14.02).L Y 25.88 736.3504 6 1.5 369.1830 2 27.36 3 11870 AEV_3_3_RA3_01_1233.d 2.11E5 2 2 95 100 Methylation(KR)
R.LKYALNAR(+14.02).E Y 23.69 961.5709 8 0.2 321.5309 3 47.31 3 24008 AEV_3_3_RA3_01_1233.d 2.37E5 2 2 52 59 Methylation(KR)
R.TIR(+14.02)YPD(-18.01)PAIKVNDTVK.V Y 23.47 1825.0098 16 -27.3 457.2473 4 63.72 3 35293 AEV_3_3_RA3_01_1233.d 5.77E4 2 2 146 161 Methylation(KR); Dehydration
R.E(+42.01)TNAILMQR.L Y 23.36 1116.5597 9 10.1 373.1976 3 54.03 3 28376 AEV_3_3_RA3_01_1233.d 1.54E5 2 2 60 68 Acetylation (N-term)
K.Y(+42.01)ALNAR.E Y 23.10 748.3868 6 -52.5 375.1810 2 56.02 1 23842 AEV 2_3_RA2_01_1224.d 1.55E5 3 3 54 59 Acetylation (N-term)
K.LRDC(+57.02)LP(+13.98)LVVFIR.N Y 23.02 1513.8439 12 -67.8 505.5877 3 93.85 1 52397 AEV 2_3_RA2_01_1224.d 2.13E5 1 1 38 49 Carbamidomethylation; Proline oxidation to pyroglutamic acid
R.IQAEEAEYK(+62.02).L Y 22.74 1141.5291 9 -59.4 571.7379 2 76.04 1 38693 AEV 2_3_RA2_01_1224.d 1.45E5 1 1 114 122 MDA adduct +62
R.TDSTYPAGFMDVISIE(+14.02)KTGENFR.L Y 22.69 2591.2214 23 6.3 864.7532 3 86.90 3 52952 AEV_3_3_RA3_01_1233.d 7.6E4 1 1 78 100 Methylation(others)
K.FDTGVIAMATGGR(+28.03).N Y 22.62 1322.6653 13 15.8 441.9026 3 36.57 2 13809 AEV_1_3_RA2_01_1232.d 2.62E5 1 1 175 187 Dimethylation(KR)
R.ES(-18.01)NVFIIGQEKPWISLPK.G Y 22.17 2066.1201 18 -19.8 689.7003 3 86.93 3 52966 AEV_3_3_RA3_01_1233.d 3.27E4 1 1 222 239 Dehydration
R.ESNVFIIGQ(+.98)EK(+14.02)PWISLPK.G Y 21.34 2099.1301 18 4.6 700.7205 3 85.25 3 51867 AEV_3_3_RA3_01_1233.d 5.97E4 1 1 222 239 Deamidation (NQ); Methylation(KR)
R.V(+43.01)GVITHR.E Y 20.71 823.4664 7 -157.5 412.6756 2 39.10 1 13887 AEV 2_3_RA2_01_1224.d 3.07E4 1 1 192 198 Carbamylation
K.VDLATGK(+14.02).I Y 20.68 716.4069 7 19.0 359.2175 2 32.51 3 14871 AEV_3_3_RA3_01_1233.d 6.02E5 2 2 162 168 Methylation(KR)
R.NMGRVGVITHR.E Y 20.39 1238.6666 11 -16.0 413.8895 3 53.23 2 22105 AEV_1_3_RA2_01_1232.d 2.7E5 1 1 188 198
R.RAVALAGH(-.98) Y 20.23 792.4718 8 -66.7 397.2167 2 18.84 3 7213 AEV_3_3_RA3_01_1233.d 9.31E4 1 1 255 262 Amidation
K.L(+43.01)SIAEERDR.R Y 20.05 1130.5680 9 4.3 566.2937 2 43.77 3 21767 AEV_3_3_RA3_01_1233.d 2.43E4 1 1 245 253 Carbamylation
K.VDLATGK(+21.98)(+42.01).I Y 19.14 766.3837 7 -50.1 767.3525 1 97.63 1 54759 AEV 2_3_RA2_01_1224.d 0 1 1 162 168 Sodium adduct; Acetylation (K)
R.TIR(+14.02)YPDPAIK(+42.01).V Y 18.94 1228.6815 10 -68.7 308.1566 4 62.04 1 28034 AEV 2_3_RA2_01_1224.d 3.09E4 1 1 146 155 Methylation(KR); Acetylation (K)
R.AVALAGH(-.98) Y 18.92 636.3707 7 -186.5 637.2593 1 32.64 1 10434 AEV 2_3_RA2_01_1224.d 0 1 1 256 262 Amidation
R.A(+27.99)VALAGH Y 18.72 665.3497 7 -99.5 666.2908 1 90.84 1 50289 AEV 2_3_RA2_01_1224.d 0 1 1 256 262 Formylation
R.V(+41.03)GVITHR.E Y 18.66 821.4872 7 -189.6 411.6730 2 39.29 1 13996 AEV 2_3_RA2_01_1224.d 1.31E5 1 1 192 198 Amidination of lysines or N-terminal amines with methyl acetimidate
K.LSIAEERDRR.R Y 18.44 1243.6632 10 -2.9 415.5605 3 26.97 3 11685 AEV_3_3_RA3_01_1233.d 2.9E4 2 2 245 254
R.LVKVDGK(+14.02).V Y 17.99 771.4854 7 -7.7 386.7470 2 22.03 3 8913 AEV_3_3_RA3_01_1233.d 4.89E4 1 1 69 75 Methylation(KR)
R.TDSTYPAGFM(+15.99)DVIS(+79.97)IEK.T Y 17.90 1968.8428 17 21.6 493.2286 4 66.31 1 31110 AEV 2_3_RA2_01_1224.d 0 1 1 78 94 Oxidation (M); Phosphorylation (STY)
K.TGE(+14.02)NFRLVYDTK.G Y 17.89 1455.7357 12 -7.1 728.8699 2 67.61 3 38341 AEV_3_3_RA3_01_1233.d 4.1E4 1 1 95 106 Methylation(others)
K.GGIPFLVTHDARTIR.Y Y 17.81 1651.9158 15 -6.5 413.9835 4 34.89 3 16309 AEV_3_3_RA3_01_1233.d 1.02E6 1 1 134 148
R.IQAEEAEYK(+28.03).L Y 17.78 1107.5448 9 -9.9 554.7742 2 50.20 3 25862 AEV_3_3_RA3_01_1233.d 1.49E5 1 1 114 122 Dimethylation(KR)
R.VQ(+.98)LGK(+21.98).G Y 17.68 566.3040 5 -73.1 567.2699 1 97.86 1 54901 AEV 2_3_RA2_01_1224.d 7.13E3 1 1 129 133 Deamidation (NQ); Sodium adduct
K.FD(+43.99)TGVIAMATGGR.N Y 17.52 1338.6238 13 -29.6 670.2994 2 96.76 1 54243 AEV 2_3_RA2_01_1224.d 5.17E4 1 1 175 187 Carboxylation (DKW)
K.VNDTVKVDLATGK(+21.98).I Y 17.50 1380.7224 13 5.0 346.1896 4 39.43 2 15194 AEV_1_3_RA2_01_1232.d 0 1 1 156 168 Sodium adduct
R.AVALAGH(+28.03) Y 17.37 665.3860 7 -36.8 666.3688 1 71.02 3 41030 AEV_3_3_RA3_01_1233.d 0 1 1 256 262 Ethylation
K.VD(+43.99)LATGKITSFIK.F Y 17.14 1435.7922 13 -16.2 479.5970 3 75.01 3 44126 AEV_3_3_RA3_01_1233.d 8.51E4 1 1 162 174 Carboxylation (DKW)
R.ETN(+.98)AILMQ(+.98)R.L Y 17.07 1076.5172 9 -87.0 359.8151 3 33.82 1 11094 AEV 2_3_RA2_01_1224.d 1.79E5 1 1 60 68 Deamidation (NQ)
R.V(+27.99)QLGK(+42.01)GGIPFLVTHDAR.T Y 16.93 1877.0159 17 14.8 470.2682 4 69.89 3 40188 AEV_3_3_RA3_01_1233.d 0 1 1 129 145 Formylation; Acetylation (K)
R.Y(+42.01)PDPAIK.V Y 16.19 844.4330 7 27.4 423.2354 2 44.25 3 22081 AEV_3_3_RA3_01_1233.d 0 1 1 149 155 Acetylation (N-term)
R.VQLGK(+21.98).G Y 16.00 565.3199 5 -13.3 566.3197 1 99.45 3 58894 AEV_3_3_RA3_01_1233.d 1.09E4 1 1 129 133 Sodium adduct
R.VGVIT(+79.97)HR.E Y 15.95 860.4269 7 -103.2 431.1763 2 44.22 1 16820 AEV 2_3_RA2_01_1224.d 0 1 1 192 198 Phosphorylation (STY)
K.Y(+79.96)ALNARETNAILMQR.L Y 15.84 1842.8716 15 -37.4 461.7079 4 81.49 1 43001 AEV 2_3_RA2_01_1224.d 3.68E4 1 1 54 68 Sulfation
R.T(+14.02)DSTYPAGFMDVISIEK.T Y 15.81 1886.8971 17 3.4 944.4590 2 84.26 2 43802 AEV_1_3_RA2_01_1232.d 3.25E4 1 1 78 94 Methylation(others)
MGRGPK(+43.99).K Y 15.68 688.3326 6 33.8 689.3632 1 82.96 3 50287 AEV_3_3_RA3_01_1233.d 6.74E4 1 1 1 6 Carboxylation (DKW)
R.Y(+134.05)PDPAIK.V Y 15.53 936.4705 7 -11.5 937.4669 1 95.09 2 49368 AEV_1_3_RA2_01_1232.d 0 1 1 149 155 3-methyl-2-pyridyl isocyanate
R.N(+.98)MGRVGVITHR.E Y 15.42 1239.6506 11 5.4 414.2264 3 28.66 2 10110 AEV_1_3_RA2_01_1232.d 0 1 1 188 198 Deamidation (NQ)
R.T(+43.01)IRYPDPAIK.V Y 15.28 1215.6611 10 -46.5 406.2088 3 59.07 2 25281 AEV_1_3_RA2_01_1232.d 0 1 1 146 155 Carbamylation
R.LVYDTK(+28.03).G Y 15.28 765.4272 6 -45.2 766.3999 1 99.79 1 55624 AEV 2_3_RA2_01_1224.d 3.83E6 1 1 101 106 Dimethylation(KR)
K.RLSAPS(+79.97)HWLLDK(+14.02).L Y 15.01 1515.7599 12 9.4 304.1621 5 28.88 3 12733 AEV_3_3_RA3_01_1233.d 0 1 1 11 22 Phosphorylation (STY); Methylation(KR)
total 166 peptides
C1G1F2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VETGVIKPGMVVTFAPANVTTEVK.S Y 156.02 2486.3455 24 -1.8 1244.1777 2 79.99 2 40574 AEV_1_3_RA2_01_1232.d 9.4E5 6 6 266 289
K.TLLEAIDAIEPPTRPTDKPLRLPLQDVYK.I Y 154.09 3301.8284 29 2.2 661.3744 5 84.06 2 43703 AEV_1_3_RA2_01_1232.d 6.19E6 9 9 226 254
K.SVEMHHQQLTAGNPGDNVGFNVK.N Y 142.36 2478.1709 23 4.5 620.5528 4 65.13 2 29360 AEV_1_3_RA2_01_1232.d 4.2E6 7 7 290 312
K.SVEM(+15.99)HHQQLTAGNPGDNVGFNVK.N Y 141.82 2494.1660 23 2.9 624.5506 4 62.35 2 27428 AEV_1_3_RA2_01_1232.d 1.36E6 8 8 290 312 Oxidation (M)
R.VETGVIKPGM(+15.99)VVTFAPANVTTEVK.S Y 139.77 2502.3403 24 1.0 835.1215 3 77.65 2 38687 AEV_1_3_RA2_01_1232.d 5.26E5 2 2 266 289 Oxidation (M)
K.FETPKYNVTVIDAPGHRDFIK.N Y 139.43 2446.2644 21 3.6 612.5756 4 72.80 2 34969 AEV_1_3_RA2_01_1232.d 2.34E6 5 5 81 101
R.EHALLAFTLGVK.Q Y 134.23 1297.7394 12 1.9 433.5879 3 78.86 2 39652 AEV_1_3_RA2_01_1232.d 1.08E6 6 6 136 147
K.FETPKYNVTVIDAPGHR.D Y 123.69 1942.9901 17 3.0 648.6726 3 68.34 2 31611 AEV_1_3_RA2_01_1232.d 1.68E6 5 5 81 97
K.YNVTVIDAPGHRDFIK.N Y 116.25 1843.9580 16 2.8 615.6617 3 68.85 2 32066 AEV_1_3_RA2_01_1232.d 3.69E6 7 7 86 101
K.YNVTVIDAPGHR.D Y 115.72 1340.6837 12 2.3 447.9029 3 60.84 2 26441 AEV_1_3_RA2_01_1232.d 2.52E6 7 7 86 97
K.TLLEAIDAIEPPTRPTDKPLR(+14.02)LPLQDVYK.I Y 110.49 3315.8442 29 0.8 664.1766 5 84.53 2 44018 AEV_1_3_RA2_01_1232.d 3.28E5 1 1 226 254 Methylation(KR)
K.MIPSKPMC(+57.02)VEAFTEYPPLGR.F Y 107.85 2322.1211 20 4.1 775.0508 3 80.02 2 40658 AEV_1_3_RA2_01_1232.d 1.83E6 4 4 403 422 Carbamidomethylation
K.M(+15.99)IPSKPMC(+57.02)VEAFTEYPPLGR.F Y 107.46 2338.1160 20 1.5 780.3804 3 79.02 2 39777 AEV_1_3_RA2_01_1232.d 7.3E5 3 3 403 422 Oxidation (M); Carbamidomethylation
K.THINLVVIGHVDSGK.S Y 106.94 1587.8733 15 -10.0 530.2931 3 65.15 3 36397 AEV_3_3_RA3_01_1233.d 2.39E6 11 11 7 21
K.ISGIGTVPVGRVETGVIKPGMVVTFAPANVTTEVK.S Y 105.97 3522.9482 35 2.0 881.7461 4 82.19 3 49730 AEV_3_3_RA3_01_1233.d 3.84E5 3 3 255 289
K.TLLEAIDAIE(+14.02)PPTRPTDKPLRLPLQDVYK.I Y 104.84 3315.8442 29 0.3 664.1763 5 85.70 2 44845 AEV_1_3_RA2_01_1232.d 2.22E6 5 5 226 254 Methylation(others)
R.VE(+14.02)TGVIKPGMVVTFAPANVTTEVK.S Y 103.41 2500.3611 24 -13.8 834.4495 3 80.55 2 40996 AEV_1_3_RA2_01_1232.d 2.17E5 2 2 266 289 Methylation(others)
K.MIPSKPM(+15.99)C(+57.02)VEAFTEYPPLGR.F Y 102.98 2338.1160 20 4.9 780.3831 3 77.36 2 38541 AEV_1_3_RA2_01_1232.d 7E5 4 4 403 422 Oxidation (M); Carbamidomethylation
R.RGNVAGDSKNDPPK.G Y 102.61 1453.7273 14 6.4 485.5861 3 11.49 2 3032 AEV_1_3_RA2_01_1232.d 6.59E5 6 6 321 334
K.THINLVVIGHVDSGKSTTTGHLIYK.C Y 97.70 2689.4551 25 -4.3 538.8960 5 68.49 3 39042 AEV_3_3_RA3_01_1233.d 2.07E5 1 1 7 31
K.VGYNPK(+42.02)TVPFVPISGFEGDNMIEPSANC(+57.02)PWYK.G Y 96.82 3654.7275 32 7.0 1219.2583 3 85.96 3 52346 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 180 211 Guanidination; Carbamidomethylation
K.STTTGHLIYK.C Y 96.03 1119.5924 10 0.0 560.8035 2 37.09 2 14072 AEV_1_3_RA2_01_1232.d 7.87E6 14 14 22 31
K.M(+15.99)IPSKPM(+15.99)C(+57.02)VEAFTEYPPLGR.F Y 92.53 2354.1108 20 -5.7 785.7064 3 76.14 3 45032 AEV_3_3_RA3_01_1233.d 2.4E5 2 2 403 422 Oxidation (M); Carbamidomethylation
K.TLLEAIDAIEPPTR(+14.02)PTDKPLRLPLQDVYK.I Y 91.31 3315.8442 29 -9.7 829.9603 4 85.82 2 44858 AEV_1_3_RA2_01_1232.d 1.63E5 2 2 226 254 Methylation(KR)
K.SVEMHHQQLTAGN(+.98)PGDNVGFNVK.N Y 90.79 2479.1550 23 6.4 620.8000 4 64.34 3 35761 AEV_3_3_RA3_01_1233.d 1.29E5 1 1 290 312 Deamidation (NQ)
R.VETGVIKPGMVVTFAPANVTTEVK(+14.02).S Y 90.55 2500.3611 24 -13.7 834.4495 3 80.84 3 48723 AEV_3_3_RA3_01_1233.d 2.64E5 3 3 266 289 Methylation(KR)
K.YSGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYK.I Y 89.79 3737.0403 33 0.4 748.4156 5 83.94 3 50971 AEV_3_3_RA3_01_1233.d 3.67E5 2 2 222 254
K.DGQTREHALLAFTLGVK.Q Y 88.35 1854.9951 17 -9.6 464.7516 4 77.01 3 45704 AEV_3_3_RA3_01_1233.d 5.34E5 3 3 131 147
K.SVEMH(+14.02)HQQLTAGNPGDNVGFNVK.N Y 88.32 2492.1865 23 1.1 624.0546 4 66.03 2 29969 AEV_1_3_RA2_01_1232.d 2.16E5 2 2 290 312 Methylation(others)
R.GITIDIALWK.F Y 85.47 1128.6543 10 -3.4 1129.6577 1 84.14 3 51121 AEV_3_3_RA3_01_1233.d 1.12E6 5 5 71 80
R.GNVAGDSKNDPPK.G Y 85.26 1297.6262 13 6.3 649.8245 2 12.42 2 3377 AEV_1_3_RA2_01_1232.d 5.59E5 8 8 322 334
K.GWSKETAQGKYSGK.T Y 84.44 1525.7524 14 0.8 509.5918 3 24.44 3 10257 AEV_3_3_RA3_01_1233.d 3.28E5 3 3 212 225
K.SFK(+28.03)YAWVLDKLKAER.E Y 84.05 1881.0511 15 -1.1 377.2171 5 76.58 3 45383 AEV_3_3_RA3_01_1233.d 1.2E6 5 5 54 68 Dimethylation(KR)
K.SVEMHHQQ(+.98)LTAGNPGDNVGFNVK.N Y 83.90 2479.1550 23 -0.5 827.3919 3 65.42 3 36606 AEV_3_3_RA3_01_1233.d 1.62E5 2 2 290 312 Deamidation (NQ)
R.VET(+14.02)GVIKPGMVVTFAPANVTTEVK.S Y 82.06 2500.3611 24 1.7 1251.1899 2 80.24 3 48255 AEV_3_3_RA3_01_1233.d 2.22E4 1 1 266 289 Methylation(others)
R.FNEIIKEVTNFIKK.V Y 80.93 1721.9716 14 -1.2 431.4996 4 80.58 3 48515 AEV_3_3_RA3_01_1233.d 9.44E4 1 1 166 179
K.NMITGTSQADC(+57.02)AILIIAAGTGEFEAGISK.D Y 79.24 2938.4417 29 0.8 980.4886 3 92.62 3 56116 AEV_3_3_RA3_01_1233.d 2.1E5 4 4 102 130 Carbamidomethylation
K.TLLEAIDAIE(+14.02)PPTRPTDKPLR.L Y 79.16 2359.3110 21 -1.7 590.8340 4 81.15 3 48955 AEV_3_3_RA3_01_1233.d 8.78E4 1 1 226 246 Methylation(others)
K.ISGIGTVPVGR.V Y 78.84 1054.6135 11 3.6 528.3159 2 64.20 2 28730 AEV_1_3_RA2_01_1232.d 1.04E7 6 6 255 265
K.SFK(+28.03)YAWVLDKLK.A Y 77.49 1524.8704 12 -0.6 382.2246 4 77.63 3 46223 AEV_3_3_RA3_01_1233.d 9.87E5 4 4 54 65 Dimethylation(KR)
K.S(+14.02)VEMHHQQLTAGNPGDNVGFNVK.N Y 77.17 2492.1865 23 -51.5 624.0219 4 65.03 3 36294 AEV_3_3_RA3_01_1233.d 0 1 1 290 312 Methylation(others)
R.LPLQDVYK.I Y 75.93 974.5436 8 2.5 488.2803 2 66.29 2 30158 AEV_1_3_RA2_01_1232.d 1.25E6 3 3 247 254
K.WSETRFNEIIKEVTNFIK.K Y 74.04 2253.1792 18 -0.3 564.3019 4 89.45 3 54435 AEV_3_3_RA3_01_1233.d 2E5 2 2 161 178
K.FAELLEKIDR.R Y 73.20 1232.6764 10 -6.5 617.3415 2 72.38 2 34637 AEV_1_3_RA2_01_1232.d 8.79E5 5 5 371 380
K.MIPSKPMC(+57.02)VEAFT(+14.02)EYPPLGR.F Y 70.75 2336.1367 20 -6.2 779.7147 3 80.72 3 48663 AEV_3_3_RA3_01_1233.d 3.48E5 1 1 403 422 Carbamidomethylation; Methylation(others)
R.TGKSVENNPK(+42.02)FIK.S Y 70.44 1502.8204 13 12.3 752.4268 2 29.35 3 13014 AEV_3_3_RA3_01_1233.d 1.71E6 4 4 382 394 Guanidination
K.SVVKSDKAGGKVTK.A Y 70.33 1402.8143 14 0.3 702.4147 2 12.12 3 3566 AEV_3_3_RA3_01_1233.d 5.25E5 5 5 439 452
K.FAELLEKIDRR.T Y 70.23 1388.7776 11 -2.5 348.2008 4 67.85 3 38558 AEV_3_3_RA3_01_1233.d 1.68E6 5 5 371 381
K.MIPSKPMC(+57.02)VEAFTE(+14.02)YPPLGR.F Y 69.68 2336.1367 20 3.4 779.7222 3 81.06 2 41435 AEV_1_3_RA2_01_1232.d 3.48E5 2 2 403 422 Carbamidomethylation; Methylation(others)
K.Q(-17.03)LIVAINK.M Y 68.65 880.5382 8 1.6 441.2771 2 78.75 2 39591 AEV_1_3_RA2_01_1232.d 4.62E5 6 6 148 155 Pyro-glu from Q
K.TLLEAIDAIEPPTRPTDKPLRLPLQDVYKISGIGTVPVGR.V Y 68.63 4338.4312 40 5.0 868.6978 5 86.51 3 52713 AEV_3_3_RA3_01_1233.d 4.79E5 2 2 226 265
K.SGDAAIVK.M Y 67.50 759.4127 8 2.9 380.7147 2 19.25 2 6113 AEV_1_3_RA2_01_1232.d 2.77E6 7 7 395 402
K.ISGIGTVPVGRVETGVIKPGM(+15.99)VVTFAPANVTTEVK.S Y 67.13 3538.9431 35 4.3 885.7468 4 80.66 3 48581 AEV_3_3_RA3_01_1233.d 8.27E4 2 2 255 289 Oxidation (M)
K.FETPK(+14.02)YNVTVIDAPGHR.D Y 65.95 1957.0057 17 -4.8 490.2563 4 68.10 3 38735 AEV_3_3_RA3_01_1233.d 1.7E5 2 2 81 97 Methylation(KR)
R.ERGITIDIALWK.F Y 65.90 1413.7980 12 -2.8 472.2719 3 79.96 3 48040 AEV_3_3_RA3_01_1233.d 2.84E4 2 2 69 80
K.SVEM(+15.99)HHQQLTAGNPGDNVGFNVK(+14.02).N Y 65.37 2508.1816 23 4.9 628.0558 4 65.24 2 29416 AEV_1_3_RA2_01_1232.d 1.24E5 1 1 290 312 Oxidation (M); Methylation(KR)
K.SVENNPK(+42.02)FIK.S Y 63.12 1216.6564 10 24.6 609.3504 2 40.01 2 15459 AEV_1_3_RA2_01_1232.d 1.66E7 13 13 385 394 Guanidination
K.GWSKETAQGK.Y Y 62.82 1090.5406 10 1.8 546.2786 2 16.40 2 4906 AEV_1_3_RA2_01_1232.d 5.15E5 4 4 212 221
R.GITIDIALWKFETPK.Y Y 61.79 1730.9607 15 3.9 577.9964 3 84.65 3 51462 AEV_3_3_RA3_01_1233.d 1.57E5 2 2 71 85
K.FE(+14.02)TPKYNVTVIDAPGHRDFIK.N Y 60.68 2460.2800 21 2.9 493.0647 5 73.33 2 35366 AEV_1_3_RA2_01_1232.d 2.73E5 1 1 81 101 Methylation(others)
K.TLLEAIDAIEPPTRPTDKPLR.L Y 57.70 2345.2954 21 -11.7 782.7632 3 78.73 3 47080 AEV_3_3_RA3_01_1233.d 1.44E5 3 3 226 246
K.FAELLEK.I Y 57.06 848.4644 7 3.5 425.2409 2 64.26 2 28731 AEV_1_3_RA2_01_1232.d 2.62E6 9 9 371 377
K.SVENNPK(+28.03)FIK.S Y 56.95 1202.6659 10 0.2 602.3403 2 37.65 3 18001 AEV_3_3_RA3_01_1233.d 1.57E6 4 4 385 394 Dimethylation(KR)
K.FET(-2.02)PKYNVTVIDAPGHRDFIK.N Y 56.80 2444.2488 21 -38.2 612.0461 4 72.90 2 35043 AEV_1_3_RA2_01_1232.d 5.33E4 1 1 81 101 2-amino-3-oxo-butanoic_acid
K.C(+58.01)GGIDSR.T Y 56.34 764.3123 7 -86.5 383.1303 2 22.83 1 5672 AEV 2_3_RA2_01_1224.d 1.56E5 3 3 32 38 Carboxymethyl
K.ISGIGTVPVGR(+14.02).V Y 55.02 1068.6292 11 -1.9 535.3209 2 65.34 3 36542 AEV_3_3_RA3_01_1233.d 3.87E5 3 3 255 265 Methylation(KR)
R.V(+43.01)ETGVIK(+14.02)PGMVVTFAPANVTTEVK.S Y 54.23 2543.3669 24 3.0 636.8509 4 73.52 2 35514 AEV_1_3_RA2_01_1232.d 6.74E5 2 2 266 289 Carbamylation; Methylation(KR)
K.SVEMHHQQLTAGNPGDNVGFNVK(-.98).N Y 53.75 2477.1870 23 31.2 620.3234 4 65.09 2 29314 AEV_1_3_RA2_01_1232.d 0 1 1 290 312 Amidation
R.VETGVIK(+14.02)PGMVVTFAPANVTTEVK.S Y 53.45 2500.3611 24 -29.2 834.4366 3 77.71 2 38736 AEV_1_3_RA2_01_1232.d 1.12E4 1 1 266 289 Methylation(KR)
K.FETPKYNVT(-2.02)VIDAPGHR.D Y 53.21 1940.9744 17 7.1 486.2543 4 68.46 2 31698 AEV_1_3_RA2_01_1232.d 3.33E5 2 2 81 97 2-amino-3-oxo-butanoic_acid
K.MIPSKPMC(+57.02)VEAFTEYPPLGR(+14.02).F Y 53.15 2336.1367 20 -11.5 779.7106 3 79.98 3 48059 AEV_3_3_RA3_01_1233.d 1.26E5 2 2 403 422 Carbamidomethylation; Methylation(KR)
K.SVENNPK(+42.01)FIK.S Y 52.69 1216.6451 10 -58.1 609.2945 2 58.22 1 25244 AEV 2_3_RA2_01_1224.d 9.76E6 5 5 385 394 Acetylation (K)
K.S(+42.01)TTTGHLIYK.C Y 52.15 1161.6030 10 17.3 388.2150 3 34.18 3 15825 AEV_3_3_RA3_01_1233.d 3.85E5 2 2 22 31 Acetylation (N-term)
K.FETPKYN(+.98)VTVIDAPGHRDFIK.N Y 52.14 2447.2485 21 8.9 612.8248 4 71.89 3 41721 AEV_3_3_RA3_01_1233.d 3.11E5 2 2 81 101 Deamidation (NQ)
K.THINLVVIGHVDSGK(+14.02).S Y 51.91 1601.8889 15 -86.4 401.4449 4 78.40 1 40568 AEV 2_3_RA2_01_1224.d 9.16E4 1 1 7 21 Methylation(KR)
R.TVAVGVIK.S Y 51.59 785.5011 8 2.4 393.7588 2 52.12 2 21527 AEV_1_3_RA2_01_1232.d 9.46E6 9 9 431 438
K.SFK(+28.03)YAWVLDKLKAER(+14.02).E Y 51.48 1895.0668 15 6.0 380.0229 5 77.83 3 46366 AEV_3_3_RA3_01_1233.d 1.52E5 3 3 54 68 Dimethylation(KR); Methylation(KR)
K.ISGIGTVPVGR(+.98)VETGVIKPGMVVTFAPANVTTEVK.S Y 50.97 3523.9324 35 5.5 881.9952 4 82.72 2 42670 AEV_1_3_RA2_01_1232.d 1.92E5 1 1 255 289 Deamidation (R)
K.SVENNPK(+14.02)FIK.S Y 50.97 1188.6503 10 -9.5 595.3268 2 37.57 3 17939 AEV_3_3_RA3_01_1233.d 1.14E5 2 2 385 394 Methylation(KR)
R.E(+14.02)HALLAFTLGVK.Q Y 50.85 1311.7550 12 4.5 438.2609 3 79.75 2 40361 AEV_1_3_RA2_01_1232.d 7.43E4 2 2 136 147 Methylation(others)
K.SVENNPK(+27.99)FIK.S Y 50.78 1202.6295 10 -56.2 602.2883 2 58.80 1 25711 AEV 2_3_RA2_01_1224.d 1.21E6 2 2 385 394 Formylation
K.FAELLEK(+14.02).I Y 49.35 862.4800 7 2.1 432.2482 2 68.57 2 31846 AEV_1_3_RA2_01_1232.d 1.47E6 3 3 371 377 Methylation(KR)
K.SFK(+28.03)YAWVLDK.L Y 49.15 1283.6914 10 -0.5 428.9042 3 75.02 2 36647 AEV_1_3_RA2_01_1232.d 8.96E5 4 4 54 63 Dimethylation(KR)
K.ETAQGKYSGK(+14.02).T Y 48.31 1081.5404 10 2.6 541.7789 2 12.49 3 3756 AEV_3_3_RA3_01_1233.d 3.1E4 2 2 216 225 Methylation(KR)
K.SVEM(+15.99)HHQ(+.98)QLTAGNPGDNVGFNVK.N Y 48.25 2495.1499 23 8.3 624.7999 4 63.57 2 28273 AEV_1_3_RA2_01_1232.d 2.4E5 1 1 290 312 Oxidation (M); Deamidation (NQ)
R.TIEKFEK.E Y 48.06 893.4858 7 0.0 447.7502 2 22.01 3 8927 AEV_3_3_RA3_01_1233.d 2.83E6 9 9 39 45
K.FETPK(+14.02)Y(-18.01)NVTVIDAPGHR.D Y 47.55 1938.9951 17 40.8 485.7758 4 68.35 2 31621 AEV_1_3_RA2_01_1232.d 0 1 1 81 97 Methylation(KR); Dehydration
K.SFK(+27.99)YAWVLDK.L Y 47.18 1283.6550 10 -60.7 428.8663 3 82.51 1 43788 AEV 2_3_RA2_01_1224.d 3.08E5 1 1 54 63 Formylation
K.SFK(+27.99)YAWVLDKLK.A Y 46.48 1524.8340 12 -0.9 763.4236 2 77.69 3 46252 AEV_3_3_RA3_01_1233.d 0 1 1 54 65 Formylation
K.WSETRFNEIIKEVTNFIKK.V Y 46.36 2381.2742 19 0.0 596.3258 4 86.85 3 52908 AEV_3_3_RA3_01_1233.d 5.42E5 4 4 161 179
R.LPLQDVYKISGIGTVPVGR.V Y 45.88 2011.1466 19 12.7 671.3980 3 81.25 3 49029 AEV_3_3_RA3_01_1233.d 3.94E4 1 1 247 265
K.FETPK.Y Y 45.71 620.3170 5 -86.2 621.2708 1 33.68 1 11023 AEV 2_3_RA2_01_1224.d 3.03E6 10 10 81 85
K.SGDAAIVK(+14.02).M Y 45.60 773.4283 8 -2.9 387.7203 2 30.36 3 13595 AEV_3_3_RA3_01_1233.d 2.48E6 5 5 395 402 Methylation(KR)
K.YNVTVIDAPGHRDFIK(+14.02).N Y 43.86 1857.9736 16 5.4 465.5032 4 71.26 2 33797 AEV_1_3_RA2_01_1232.d 1.6E5 1 1 86 101 Methylation(KR)
K.QLIVAINK.M Y 43.35 897.5647 8 0.4 449.7898 2 63.11 2 27954 AEV_1_3_RA2_01_1232.d 1.42E5 1 1 148 155
K.S(+43.01)FK(+42.01)YAWVLDKLKAER.E Y 43.18 1938.0363 15 19.6 388.6221 5 76.51 3 45304 AEV_3_3_RA3_01_1233.d 1.33E5 1 1 54 68 Carbamylation; Acetylation (K)
K.SFK(+28.03)YAWVLDKLK(+14.02).A Y 42.78 1538.8860 12 -0.5 385.7286 4 79.58 3 47741 AEV_3_3_RA3_01_1233.d 4.7E4 1 1 54 65 Dimethylation(KR); Methylation(KR)
K.FETPKYNVTVIDAPGHRDFIK(+14.02).N Y 42.67 2460.2800 21 2.6 493.0646 5 73.70 3 43119 AEV_3_3_RA3_01_1233.d 1.26E5 1 1 81 101 Methylation(KR)
K.FAELLEK(+14.02)IDR.R Y 42.67 1246.6921 10 -4.2 416.5696 3 73.46 3 42951 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 371 380 Methylation(KR)
K.M(+43.01)IPSK(+14.02)PMC(+57.02)VEAFTEYPPLGR.F Y 42.40 2379.1426 20 -0.1 595.7928 4 72.19 3 41939 AEV_3_3_RA3_01_1233.d 1.76E6 5 5 403 422 Carbamylation; Methylation(KR); Carbamidomethylation
K.SVEMHHQQLTAGN(+15.00)PGDNVGFNVK.N Y 42.25 2493.1707 23 8.7 624.3054 4 61.35 3 33466 AEV_3_3_RA3_01_1233.d 2.52E5 2 2 290 312 Deamidation followed by a methylation
K.M(+15.99)IPSKPMC(+57.02)VEAFTEYPPLGR(+14.02).F Y 42.25 2352.1316 20 9.4 785.0585 3 79.87 3 47968 AEV_3_3_RA3_01_1233.d 3.97E5 2 2 403 422 Oxidation (M); Carbamidomethylation; Methylation(KR)
K.NVSVK(+42.01)EVR.R Y 42.18 971.5400 8 -51.6 324.8372 3 40.19 1 14513 AEV 2_3_RA2_01_1224.d 6.71E6 6 6 313 320 Acetylation (K)
K.STTTGHLIYK(+14.02).C Y 42.17 1133.6080 10 -0.5 567.8110 2 42.16 3 20763 AEV_3_3_RA3_01_1233.d 3.32E5 2 2 22 31 Methylation(KR)
K.T(+79.96)HINLVVIGHVDSGK.S Y 42.00 1667.8301 15 -21.6 417.9558 4 76.92 1 39386 AEV 2_3_RA2_01_1224.d 6.91E5 1 1 7 21 Sulfation
K.SVEMHHQQLTAGNPGD(+14.02)NVGFNVK.N Y 41.04 2492.1865 23 -16.6 624.0436 4 65.87 3 36968 AEV_3_3_RA3_01_1233.d 0 1 1 290 312 Methylation(others)
R.VETGVIK(+14.02)PGMVVTFAPANVTTEVK(+14.02).S Y 40.73 2514.3767 24 -8.9 839.1254 3 81.78 2 42011 AEV_1_3_RA2_01_1232.d 8.16E4 1 1 266 289 Methylation(KR)
K.M(+42.01)IPSK(+14.02)PMC(+57.02)VEAFTEYPPLGR.F Y 40.68 2378.1472 20 -29.4 793.6997 3 75.52 3 44538 AEV_3_3_RA3_01_1233.d 0 1 1 403 422 Acetylation (N-term); Methylation(KR); Carbamidomethylation
K.SVENNPK(+42.02)FIK(+14.02).S Y 40.00 1230.6720 10 22.5 616.3571 2 50.57 2 20731 AEV_1_3_RA2_01_1232.d 2.15E5 1 1 385 394 Guanidination; Methylation(KR)
K.SVEMHHQ(+.98)QLTAGN(+.98)PGDNVGFNVK.N Y 39.56 2480.1389 23 16.8 621.0524 4 66.04 2 29977 AEV_1_3_RA2_01_1232.d 8.29E4 1 1 290 312 Deamidation (NQ)
K.Q(-17.03)LIVAINKM(+15.99)DTTK.W Y 39.40 1472.7909 13 -6.6 737.3978 2 71.49 3 41399 AEV_3_3_RA3_01_1233.d 3.69E4 2 2 148 160 Pyro-glu from Q; Oxidation (M)
K.S(+27.99)FKYAWVLDKLK.A Y 39.20 1524.8340 12 -64.9 382.1910 4 86.94 1 47315 AEV 2_3_RA2_01_1224.d 5.33E5 1 1 54 65 Formylation
K.MIPSKPMC(+57.02)VE(+17.03)AFTEYPPLGR.F Y 38.96 2339.1475 20 -11.7 780.7140 3 77.46 2 38539 AEV_1_3_RA2_01_1232.d 2.33E5 1 1 403 422 Carbamidomethylation; Replacement of proton with ammonium ion
K.FAE(+14.02)LLEK.I Y 38.94 862.4800 7 0.0 432.2473 2 68.08 2 31418 AEV_1_3_RA2_01_1232.d 4.34E5 2 2 371 377 Methylation(others)
M.GK(+14.02)EEK(+28.03)THINLVVIGHVDSGK.S Y 38.01 2201.2168 20 -0.1 441.2506 5 61.02 2 26539 AEV_1_3_RA2_01_1232.d 1.25E5 1 1 2 21 Methylation(KR); Dimethylation(KR)
R.VETGVIKPGMVVTFAPANVTTEVK(+15.99).S Y 37.80 2502.3403 24 10.0 835.1291 3 80.91 3 48771 AEV_3_3_RA3_01_1233.d 2.66E4 1 1 266 289 Oxidation or Hydroxylation
K.NDPPK(+61.92).G Y 37.68 631.2027 5 4.7 632.2130 1 25.58 1 6797 AEV 2_3_RA2_01_1224.d 2.51E5 2 2 330 334 Replacement of proton by copper
R.VETGVIKPGM(+15.99)VVTFAPANVTTEVK(+14.02).S Y 36.73 2516.3560 24 0.9 839.7933 3 79.13 2 39871 AEV_1_3_RA2_01_1232.d 1.3E5 1 1 266 289 Oxidation (M); Methylation(KR)
K.Y(+79.97)AWVLDKLKAER.E Y 36.20 1570.7908 12 -30.2 393.6931 4 76.78 3 45528 AEV_3_3_RA3_01_1233.d 3.43E4 1 1 57 68 Phosphorylation (STY)
K.NVSVK(+42.02)EVR.R Y 36.08 971.5512 8 31.1 324.8677 3 22.70 2 7520 AEV_1_3_RA2_01_1232.d 2.34E6 4 4 313 320 Guanidination
R.VETGVIK(+71.04)PGMVVTFAPANVTTEVK.S Y 35.87 2557.3826 24 -0.4 640.3527 4 74.74 2 36425 AEV_1_3_RA2_01_1232.d 9.46E4 1 1 266 289 Propionamide (K, X@N-term)
R.V(+71.04)ETGVIKPGMVVTFAPANVTTEVK.S Y 35.39 2557.3826 24 -7.5 640.3481 4 73.67 3 43096 AEV_3_3_RA3_01_1233.d 0 1 1 266 289 Propionamide (K, X@N-term)
K.EVTN(+.98)FIK(+42.01).K Y 35.32 892.4542 7 10.2 893.4705 1 79.57 2 40222 AEV_1_3_RA2_01_1232.d 4.85E4 1 1 172 178 Deamidation (NQ); Acetylation (K)
K.C(+57.02)GGIDSR.T Y 35.24 763.3282 7 -87.3 382.6381 2 19.97 1 4769 AEV 2_3_RA2_01_1224.d 1.06E4 1 1 32 38 Carbamidomethylation
K.SVENNPK(+42.01)FIK(+14.02).S Y 34.05 1230.6608 10 -109.7 616.2701 2 64.42 1 29849 AEV 2_3_RA2_01_1224.d 6.28E4 3 3 385 394 Acetylation (K); Methylation(KR)
R.VETGVIKPGMVVT(+13.03)FAPANVTTEVK.S Y 33.67 2499.3770 24 -31.1 834.1071 3 77.41 3 46029 AEV_3_3_RA3_01_1233.d 1.94E4 1 1 266 289 Michael addition with methylamine
K.STTTGHLIYKC(+57.02)GGIDSR.T Y 33.37 1864.9102 17 9.9 467.2394 4 50.96 3 26345 AEV_3_3_RA3_01_1233.d 2.37E5 1 1 22 38 Carbamidomethylation
K.YSGKTLLEAIDAIEPPTRPTDKPLR.L Y 33.16 2780.5071 25 1.9 557.1097 5 80.24 2 40751 AEV_1_3_RA2_01_1232.d 0 1 1 222 246
K.SVEN(+.98)NPK(+42.02)FIK.S Y 33.08 1217.6404 10 16.3 609.8374 2 45.77 2 18317 AEV_1_3_RA2_01_1232.d 5.84E4 1 1 385 394 Deamidation (NQ); Guanidination
K.SGD(+21.98)AAIVKMIPSKPMC(+57.02)VEAFTEYPPLGR.F Y 32.77 3085.5051 28 24.8 772.4027 4 79.75 3 47878 AEV_3_3_RA3_01_1233.d 0 1 1 395 422 Sodium adduct; Carbamidomethylation
K.FAE(+14.02)LLEKIDR.R Y 32.70 1246.6921 10 8.6 416.5749 3 71.93 3 41747 AEV_3_3_RA3_01_1233.d 3.35E5 2 2 371 380 Methylation(others)
K.THINLVVIGH(+42.01)VDSGK.S Y 32.67 1629.8838 15 -78.7 408.4461 4 76.97 1 39424 AEV 2_3_RA2_01_1224.d 3.17E5 1 1 7 21 Acetylation (TSCYH)
R.TVAVGVIK(+14.02).S Y 32.37 799.5167 8 -2.0 400.7648 2 60.44 3 32741 AEV_3_3_RA3_01_1233.d 3.5E5 2 2 431 438 Methylation(KR)
K.NDPPK.G Y 31.60 569.2809 5 -35.1 570.2682 1 75.03 1 37897 AEV 2_3_RA2_01_1224.d 2.18E4 5 5 330 334
K.SFK(+27.99)YAWVLDKLKAER.E Y 31.31 1881.0148 15 -66.4 377.1852 5 86.78 1 47192 AEV 2_3_RA2_01_1224.d 3.79E5 2 2 54 68 Formylation
K.GWSKETAQGK(+14.02).Y Y 30.92 1104.5564 10 21.7 553.2975 2 22.28 3 9042 AEV_3_3_RA3_01_1233.d 0 1 1 212 221 Methylation(KR)
K.C(+42.01)GGIDSR.T Y 30.61 748.3174 7 -18.3 375.1591 2 21.07 1 5076 AEV 2_3_RA2_01_1224.d 0 1 1 32 38 Acetylation (N-term)
K.EVTNFIKK.V Y 30.42 977.5546 8 -14.9 489.7773 2 41.66 2 16286 AEV_1_3_RA2_01_1232.d 3.75E4 1 1 172 179
K.FAELLEKIDR(+14.02).R Y 30.04 1246.6921 10 19.5 416.5794 3 74.29 2 36099 AEV_1_3_RA2_01_1232.d 0 1 1 371 380 Methylation(KR)
K.FETPK(+43.99).Y Y 29.96 664.3068 5 -40.2 665.2874 1 91.08 1 50409 AEV 2_3_RA2_01_1224.d 0 1 1 81 85 Carboxylation (DKW)
K.ISGIGT(-18.01)VPVGR.V Y 29.72 1036.6029 11 4.0 346.5430 3 49.78 2 20335 AEV_1_3_RA2_01_1232.d 1.69E5 1 1 255 265 Dehydration
K.MIPSKPMC(+57.02)VE(+6.01)AFTEYPPLGR.F Y 29.66 2328.1292 20 30.3 777.0739 3 79.80 3 47916 AEV_3_3_RA3_01_1233.d 0 1 1 403 422 Carbamidomethylation; Replacement of proton by lithium
K.S(+42.01)FK(+43.01)YAWVLDKLK.A Y 29.04 1581.8555 12 24.5 396.4808 4 77.48 3 46085 AEV_3_3_RA3_01_1233.d 1.81E5 2 2 54 65 Acetylation (N-term); Carbamylation
R.RTVAVGVIK.S Y 28.96 941.6022 9 -2.1 471.8074 2 42.21 2 16577 AEV_1_3_RA2_01_1232.d 1.05E5 2 2 430 438
R.FNEIIKEVTNFIK.K Y 28.67 1593.8766 13 -91.6 532.2508 3 92.17 1 51182 AEV 2_3_RA2_01_1224.d 1.87E5 1 1 166 178
K.S(+42.01)VVKSDKAGGKVT(+79.97)K.A Y 28.46 1524.7913 14 -8.5 382.2018 4 56.69 2 23932 AEV_1_3_RA2_01_1232.d 0 1 1 439 452 Acetylation (N-term); Phosphorylation (STY)
K.FETPK(+14.02).Y Y 28.23 634.3326 5 4.4 635.3427 1 39.06 2 15014 AEV_1_3_RA2_01_1232.d 5.87E4 1 1 81 85 Methylation(KR)
K.EVTNFIK.K Y 27.98 849.4596 7 -3.3 425.7357 2 54.87 3 28906 AEV_3_3_RA3_01_1233.d 6.54E5 3 3 172 178
R.RGNVAGDSKNDPPK(-.98).G Y 27.89 1452.7433 14 -21.9 485.2444 3 11.35 2 2978 AEV_1_3_RA2_01_1232.d 0 1 1 321 334 Amidation
K.ISGIGTVP(+13.98)VGR.V Y 27.47 1068.5928 11 -56.3 535.2736 2 73.38 1 36605 AEV 2_3_RA2_01_1224.d 4.33E5 2 2 255 265 Proline oxidation to pyroglutamic acid
K.LKAERERGITIDIALWK.F Y 27.39 2011.1577 17 -15.4 503.7889 4 73.94 2 35835 AEV_1_3_RA2_01_1232.d 0 1 1 64 80
K.SFK(+27.99)YAWVLDK(+14.02).L Y 26.72 1297.6707 10 -55.3 433.5402 3 85.06 1 45831 AEV 2_3_RA2_01_1224.d 9.61E4 1 1 54 63 Formylation; Methylation(KR)
K.FAELLEKIDRR(+14.02).T Y 26.60 1402.7932 11 -4.9 351.7039 4 68.92 3 39392 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 371 381 Methylation(KR)
K.NVSVK(+42.01)EVR(+14.02).R Y 26.19 985.5556 8 35.2 329.5374 3 32.16 3 14666 AEV_3_3_RA3_01_1233.d 2.37E5 1 1 313 320 Acetylation (K); Methylation(KR)
K.YN(+45.99)VTVIDAPGHR.D Y 25.90 1386.6714 12 -14.4 463.2244 3 59.98 3 32412 AEV_3_3_RA3_01_1233.d 0 1 1 86 97 Beta-methylthiolation (ND)
K.ETAQGK.Y Y 25.76 632.3129 6 -101.1 633.2563 1 41.17 1 15140 AEV 2_3_RA2_01_1224.d 4.33E4 1 1 216 221
K.FETPKYNVTVID(+43.99)APGHR.D Y 25.70 1986.9799 17 36.5 497.7704 4 72.99 2 35112 AEV_1_3_RA2_01_1232.d 0 1 1 81 97 Carboxylation (DKW)
R.EHALLAFTLGVK(-.98)(+42.01).Q Y 25.67 1338.7659 12 -93.7 447.2207 3 87.03 1 47369 AEV 2_3_RA2_01_1224.d 6E4 1 1 136 147 Amidation; Acetylation (K)
K.FE(+14.02)TPK.Y Y 25.58 634.3326 5 0.0 635.3398 1 26.08 3 11190 AEV_3_3_RA3_01_1233.d 4.68E4 1 1 81 85 Methylation(others)
K.NVSVK(+31.99).E Y 25.29 577.3071 5 -80.8 578.2678 1 74.44 1 37421 AEV 2_3_RA2_01_1224.d 1.25E4 1 1 313 317 Dihydroxy
R.TIEK(+14.02)FEK.E Y 25.12 907.5015 7 3.3 454.7595 2 32.49 3 14857 AEV_3_3_RA3_01_1233.d 1.39E5 1 1 39 45 Methylation(KR)
K.SVEM(+15.99)HHQQLTAGNPGDNVGFNVK(-.98).N Y 24.75 2493.1819 23 9.5 624.3087 4 62.30 2 27399 AEV_1_3_RA2_01_1232.d 3.07E5 2 2 290 312 Oxidation (M); Amidation
R.GN(+.98)VAGDSK(+42.01).N Y 24.66 789.3505 8 -37.9 790.3278 1 87.61 1 47811 AEV 2_3_RA2_01_1224.d 5.57E4 1 1 322 329 Deamidation (NQ); Acetylation (K)
K.S(+42.01)GDAAIVK.M Y 24.59 801.4232 8 6.9 802.4360 1 68.56 2 31771 AEV_1_3_RA2_01_1232.d 8.57E4 2 2 395 402 Acetylation (N-term)
K.T(-2.02)LLEAIDAIEPPTRPTDKPLRLPLQDVYK.I Y 24.42 3299.8127 29 -3.2 1100.9413 3 83.62 3 50755 AEV_3_3_RA3_01_1233.d 1.75E3 1 1 226 254 2-amino-3-oxo-butanoic_acid
K.FAELLE(+28.03)K.I Y 24.40 876.4956 7 -1.6 439.2544 2 71.78 3 41626 AEV_3_3_RA3_01_1233.d 4E4 1 1 371 377 Ethylation
K.SVEN(+.98)NPK(+42.01)FIK.S Y 24.37 1217.6292 10 30.9 406.8962 3 43.37 3 21508 AEV_3_3_RA3_01_1233.d 3.86E5 1 1 385 394 Deamidation (NQ); Acetylation (K)
K.SVVKSDKAGGK.V Y 24.02 1074.6033 11 4.5 359.2100 3 8.76 2 2082 AEV_1_3_RA2_01_1232.d 7.86E3 1 1 439 449
K.MIPSK(+14.02)PMC(+57.02)VEAFTEYPPLGR(+14.02).F Y 23.70 2350.1523 20 13.0 784.4016 3 79.47 2 40145 AEV_1_3_RA2_01_1232.d 1.29E5 2 2 403 422 Methylation(KR); Carbamidomethylation
K.SVENNPK(+14.02)FIK(+28.03).S Y 23.52 1216.6815 10 -6.0 609.3444 2 38.18 3 18300 AEV_3_3_RA3_01_1233.d 2.3E6 1 1 385 394 Methylation(KR); Dimethylation(KR)
K.GWSKETAQGK(+27.99).Y Y 23.41 1118.5356 10 -43.9 373.8361 3 69.07 1 33234 AEV 2_3_RA2_01_1224.d 1.2E5 1 1 212 221 Formylation
K.SVEM(-48.00)HHQQLTAGNPGDNVGFNVK.N Y 23.29 2430.1677 23 2.6 608.5508 4 57.67 3 30707 AEV_3_3_RA3_01_1233.d 1.43E5 1 1 290 312 Dethiomethyl
K.STTTGHLIY(+162.05)KC(+57.02)GGIDS(+79.97)R.T Y 23.24 2106.9292 17 5.4 422.3954 5 75.69 1 38418 AEV 2_3_RA2_01_1224.d 2.42E5 1 1 22 38 Hexose (NSY); Carbamidomethylation; Phosphorylation (STY)
K.S(+27.99)FKYAWVLDK.L Y 23.17 1283.6550 10 -59.3 642.7968 2 82.64 1 43894 AEV 2_3_RA2_01_1224.d 7.33E4 1 1 54 63 Formylation
K.TLLEAIDAIEPPTRPTDKPLRLPLQ(+.98)DVYK.I Y 22.80 3302.8125 29 -7.0 826.7046 4 84.47 3 51353 AEV_3_3_RA3_01_1233.d 0 1 1 226 254 Deamidation (NQ)
K.NMITGTSQADC(+57.02)AILIIAAGTGEFEAGISKDGQTR.E Y 22.78 3495.6973 34 13.7 874.9435 4 90.07 2 47262 AEV_1_3_RA2_01_1232.d 6.6E4 1 1 102 135 Carbamidomethylation
K.SVENNPK(+42.01)FIKSGDAAIVK.M Y 22.75 1958.0472 18 22.4 490.5301 4 58.54 3 31316 AEV_3_3_RA3_01_1233.d 2.15E5 1 1 385 402 Acetylation (K)
R.FNEIIK.E Y 22.61 762.4276 6 -5.5 382.2190 2 50.58 3 26085 AEV_3_3_RA3_01_1233.d 3.5E4 2 2 166 171
K.FETPK(+42.01).Y Y 22.28 662.3275 5 -81.3 663.2809 1 86.29 1 46797 AEV 2_3_RA2_01_1224.d 1.57E5 1 1 81 85 Acetylation (K)
R.T(+42.01)GKSVENNPK(+14.02).F Y 22.13 1128.5775 10 2.1 565.2972 2 62.14 3 34074 AEV_3_3_RA3_01_1233.d 5.24E4 1 1 382 391 Acetylation (N-term); Methylation(KR)
K.MIPSKPMC(+57.02)VE(+28.03)AFTEYPPLGR.F Y 21.82 2350.1523 20 3.7 784.3943 3 82.36 2 42397 AEV_1_3_RA2_01_1232.d 1.19E5 1 1 403 422 Carbamidomethylation; Ethylation
K.FE(+14.02)TPKYNVTVIDAPGHR.D Y 21.31 1957.0057 17 -26.0 653.3256 3 68.10 3 38732 AEV_3_3_RA3_01_1233.d 0 1 1 81 97 Methylation(others)
K.GWSKETAQ(+.98)GK.Y Y 21.28 1091.5247 10 -0.1 546.7695 2 17.97 3 6737 AEV_3_3_RA3_01_1233.d 2.93E3 1 1 212 221 Deamidation (NQ)
R.VETGVIKPGMVVTFAPANVTTEVK(-.98)(+14.02).S Y 21.26 2499.3770 24 -33.0 834.1055 3 81.43 2 41726 AEV_1_3_RA2_01_1232.d 0 1 1 266 289 Amidation; Methylation(KR)
K.M(+42.01)(+15.99)IPSK(+14.02)PMC(+57.02)VEAFTEYPPLGR.F Y 21.25 2394.1421 20 -7.0 799.0491 3 70.54 3 40654 AEV_3_3_RA3_01_1233.d 8.36E4 1 1 403 422 Acetylation (N-term); Oxidation (M); Methylation(KR); Carbamidomethylation
K.SVEN(+.98)NPK.F Y 20.62 787.3712 7 -49.6 788.3394 1 97.41 1 54620 AEV 2_3_RA2_01_1224.d 0 1 1 385 391 Deamidation (NQ)
R.VETGVIKPGM(-4.99)VVTFAPANVTTEVK.S Y 20.37 2481.3591 24 -37.3 828.0961 3 80.05 3 48109 AEV_3_3_RA3_01_1233.d 8.24E4 1 1 266 289 Methionine replacement by azido homoalanine
K.SVEN(+.98)N(+.98)PK.F Y 20.34 788.3552 7 -46.7 395.1664 2 25.99 1 6980 AEV 2_3_RA2_01_1224.d 9.87E4 2 2 385 391 Deamidation (NQ)
R.GNVAGDSK(+42.01).N Y 20.31 788.3665 8 -3.1 395.1893 2 10.31 3 2684 AEV_3_3_RA3_01_1233.d 0 1 1 322 329 Acetylation (K)
K.IS(+79.97)GIGTVPVGR(-.98).V Y 19.79 1133.5958 11 0.8 567.8057 2 31.65 2 11483 AEV_1_3_RA2_01_1232.d 3.24E4 2 2 255 265 Phosphorylation (STY); Amidation
K.S(+43.01)FK(+42.01)YAWVLDKLK.A Y 19.76 1581.8555 12 -67.6 396.4444 4 86.79 1 47211 AEV 2_3_RA2_01_1224.d 1.59E5 1 1 54 65 Carbamylation; Acetylation (K)
K.QLIVAINKMDTT(+79.97)K(+14.02).W Y 19.64 1567.8044 13 47.9 314.5832 5 38.06 3 18236 AEV_3_3_RA3_01_1233.d 6.06E4 1 1 148 160 Phosphorylation (STY); Methylation(KR)
K.IDRRTGKSVENNPK.F Y 19.47 1612.8645 14 -11.2 404.2189 4 53.13 3 27792 AEV_3_3_RA3_01_1233.d 2.4E5 1 1 378 391
K.MIPSK(+42.01)PM(+15.99)C(+57.02)VEAFTEYPPLGR.F Y 19.35 2380.1265 20 43.5 794.4173 3 81.61 2 41827 AEV_1_3_RA2_01_1232.d 0 1 1 403 422 Acetylation (K); Oxidation (M); Carbamidomethylation
K.FAELLEK(+28.03).I Y 19.22 876.4956 7 -2.0 439.2542 2 72.53 2 34759 AEV_1_3_RA2_01_1232.d 1.25E5 1 1 371 377 Dimethylation(KR)
R.GN(+.98)VAGDS(+79.97)K(+14.02).N Y 19.20 841.3218 8 16.0 842.3426 1 87.78 1 47935 AEV 2_3_RA2_01_1224.d 6.67E4 1 1 322 329 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
K.S(+27.99)FKYAWVLDKLKAER(+14.02).E Y 19.16 1895.0304 15 -80.2 379.9829 5 89.57 1 49305 AEV 2_3_RA2_01_1224.d 8.26E4 1 1 54 68 Formylation; Methylation(KR)
K.NDPPK(+43.01).G Y 18.75 612.2867 5 -101.0 613.2322 1 53.73 1 22382 AEV 2_3_RA2_01_1224.d 0 1 1 330 334 Carbamylation
R.L(+43.01)PLQDVYK.I Y 18.61 1017.5494 8 -22.7 340.1827 3 9.88 2 2445 AEV_1_3_RA2_01_1232.d 0 1 1 247 254 Carbamylation
K.NMITGTSQADC(+57.02)AILIIAAGTGEFEAGISK(+14.02).D Y 18.55 2952.4573 29 -7.8 985.1520 3 93.38 2 48736 AEV_1_3_RA2_01_1232.d 7.46E4 1 1 102 130 Carbamidomethylation; Methylation(KR)
R.TVAVGVIK(+226.08).S Y 18.53 1011.5787 8 4.4 338.2017 3 63.20 3 34891 AEV_3_3_RA3_01_1233.d 2.41E5 1 1 431 438 Biotinylation
K.FETPKYNVTVIDAPGHR(+14.02)DFIK.N Y 18.53 2460.2800 21 -3.3 493.0616 5 73.81 2 35742 AEV_1_3_RA2_01_1232.d 6.27E4 1 1 81 101 Methylation(KR)
R.T(+43.01)IEKFEK.E Y 18.32 936.4916 7 43.6 313.1848 3 24.45 2 8250 AEV_1_3_RA2_01_1232.d 3.12E4 1 1 39 45 Carbamylation
R.T(+42.01)(+79.97)IEKFEKEAEELGKK.S Y 18.23 1899.9230 15 32.3 381.0042 5 61.27 3 33405 AEV_3_3_RA3_01_1233.d 0 1 1 39 53 Acetylation (N-term); Phosphorylation (STY)
K.FAE(+14.02)LLEKIDRR.T Y 18.14 1402.7932 11 -2.3 351.7048 4 67.69 3 38403 AEV_3_3_RA3_01_1233.d 2.73E5 2 2 371 381 Methylation(others)
K.EVRR(+14.02)GNVAGDSKNDPPK(+14.02).G Y 18.10 1865.9707 17 16.5 623.0078 3 73.45 3 42945 AEV_3_3_RA3_01_1233.d 0 1 1 318 334 Methylation(KR)
K.ETAQGK(+43.99)YSGK.T Y 18.08 1111.5145 10 19.0 556.7751 2 59.03 2 25255 AEV_1_3_RA2_01_1232.d 5.46E4 1 1 216 225 Carboxylation (DKW)
K.SVENNPKFIK(+42.01).S Y 18.06 1216.6451 10 -8.7 609.3245 2 41.05 3 20033 AEV_3_3_RA3_01_1233.d 8.72E4 1 1 385 394 Acetylation (K)
R.GN(+.98)VAGDSKNDPPK.G Y 18.04 1298.6102 13 24.0 433.8878 3 12.84 3 3958 AEV_3_3_RA3_01_1233.d 1.03E5 2 2 322 334 Deamidation (NQ)
R.RTVAVGVIK(+42.01)S(+79.97)VVKS(+79.97)DK.A Y 18.00 1886.9631 16 1.8 472.7489 4 38.95 3 18777 AEV_3_3_RA3_01_1233.d 3.59E5 1 1 430 445 Acetylation (K); Phosphorylation (STY)
K.VTKAAQKATK(+42.01).K Y 17.80 1086.6396 10 3.1 363.2216 3 37.11 3 17656 AEV_3_3_RA3_01_1233.d 0 1 1 450 459 Acetylation (K)
K.YN(+.98)VTVIDAPGHR(+14.02).D Y 17.75 1355.6833 12 21.4 452.9114 3 60.97 2 26512 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 86 97 Deamidation (NQ); Methylation(KR)
K.NVSVK(+42.02)EVRR.G Y 17.72 1127.6523 9 23.5 376.9002 3 17.72 3 6617 AEV_3_3_RA3_01_1233.d 1.17E6 1 1 313 321 Guanidination
R.RGNVAGDSK(+27.99).N Y 17.65 930.4519 9 -60.6 466.2050 2 54.99 1 23166 AEV 2_3_RA2_01_1224.d 1.93E5 1 1 321 329 Formylation
R.TGKSVENNPK(+28.03)FIK.S Y 17.43 1488.8300 13 13.1 373.2196 4 30.14 3 13469 AEV_3_3_RA3_01_1233.d 3.02E5 1 1 382 394 Dimethylation(KR)
R.T(+42.01)GKSVENNPK.F Y 17.31 1114.5618 10 3.2 1115.5726 1 91.56 3 55566 AEV_3_3_RA3_01_1233.d 8.9E4 1 1 382 391 Acetylation (N-term)
R.G(+226.08)NVAGDSKN(+.98)DPPK.G Y 17.23 1524.6877 13 11.2 382.1835 4 74.56 1 37523 AEV 2_3_RA2_01_1224.d 2.05E4 1 1 322 334 Biotinylation; Deamidation (NQ)
K.F(+87.03)AELLEKIDRR.T Y 17.18 1475.8096 11 35.5 369.9727 4 68.21 3 38824 AEV_3_3_RA3_01_1233.d 0 1 1 371 381 Glycidamide adduct
R.RTGKSVENNPK(+28.03).F Y 17.09 1256.6837 11 3.1 315.1792 4 23.76 2 7964 AEV_1_3_RA2_01_1232.d 0 1 1 381 391 Dimethylation(KR)
K.SGD(+14.02)AAIVK.M Y 17.05 773.4283 8 -89.6 387.6868 2 44.03 1 16739 AEV 2_3_RA2_01_1224.d 4.48E5 1 1 395 402 Methylation(others)
R.RTGKSVE(+28.03)NNPK.F Y 17.04 1256.6837 11 -30.0 629.3303 2 72.61 3 42273 AEV_3_3_RA3_01_1233.d 6.37E4 1 1 381 391 Ethylation
K.SGDAAIVK(+43.01).M Y 16.96 802.4185 8 7.0 402.2193 2 45.18 3 22663 AEV_3_3_RA3_01_1233.d 6.58E5 1 1 395 402 Carbamylation
K.VGYNPK.T Y 16.72 676.3544 6 -76.8 677.3097 1 78.46 1 40614 AEV 2_3_RA2_01_1224.d 0 1 1 180 185
R.TVAVGVIKS(+79.97)VVK.S Y 16.63 1278.7312 12 27.8 427.2628 3 73.97 2 35853 AEV_1_3_RA2_01_1232.d 1.57E5 1 1 431 442 Phosphorylation (STY)
K.FAE(+43.99)LLEK(+42.01).I Y 16.59 934.4647 7 -9.6 468.2352 2 44.53 2 17712 AEV_1_3_RA2_01_1232.d 3.88E4 1 1 371 377 Carboxylation (E); Acetylation (K)
K.SFK(+27.99)YAWVLDKLKAER(+14.02).E Y 16.58 1895.0304 15 -74.5 379.9851 5 89.09 1 48946 AEV 2_3_RA2_01_1224.d 4.65E4 1 1 54 68 Formylation; Methylation(KR)
K.ND(-18.01)PPK(+14.02).G Y 16.53 565.2860 5 -4.1 566.2910 1 42.81 2 16860 AEV_1_3_RA2_01_1232.d 7.7E4 1 1 330 334 Dehydration; Methylation(KR)
R.GN(+.98)VAGDS(+79.97)KNDPPK.G Y 16.47 1378.5765 13 -8.3 460.5290 3 63.12 1 28874 AEV 2_3_RA2_01_1224.d 0 1 1 322 334 Deamidation (NQ); Phosphorylation (STY)
K.MDT(-18.01)TK.W Y 16.19 576.2578 5 15.4 577.2739 1 48.19 2 19533 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 156 160 Dehydration
K.S(+43.01)VENNPK(+42.01)FIK.S Y 16.18 1259.6510 10 54.0 420.9136 3 37.44 3 17856 AEV_3_3_RA3_01_1233.d 0 1 1 385 394 Carbamylation; Acetylation (K)
K.VGY(-18.01)NPK.T Y 16.09 658.3438 6 -107.6 659.2803 1 87.53 1 47752 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 180 185 Dehydration
R.RGNVAGDSKND(-18.01)PPK(+14.02).G Y 15.98 1449.7324 14 2.8 484.2527 3 11.33 3 3167 AEV_3_3_RA3_01_1233.d 0 1 1 321 334 Dehydration; Methylation(KR)
K.E(+27.99)AEELGKK.S Y 15.92 930.4658 8 -2.2 931.4710 1 93.05 3 56336 AEV_3_3_RA3_01_1233.d 0 1 1 46 53 Formylation
R.RTGKSVE(+21.98)NNPK.F Y 15.88 1250.6343 11 -4.8 626.3214 2 70.17 3 40362 AEV_3_3_RA3_01_1233.d 2.41E4 1 1 381 391 Sodium adduct
K.SFKY(+33.96)AWVLDKLKAER.E Y 15.86 1886.9810 15 22.7 472.7632 4 77.37 2 38470 AEV_1_3_RA2_01_1232.d 1.15E5 1 1 54 68 Chlorination of tyrosine residues
R.TGKSVENNPKFIK(+42.02).S Y 15.62 1502.8204 13 18.6 376.7194 4 29.73 3 13232 AEV_3_3_RA3_01_1233.d 1.08E6 1 1 382 394 Guanidination
K.GWSK(-1.03)ETAQGKYSGK.T Y 15.61 1524.7208 14 57.1 382.2092 4 24.50 3 10287 AEV_3_3_RA3_01_1233.d 0 1 1 212 225 Lysine oxidation to aminoadipic semialdehyde
K.EAEELGKK.S Y 15.57 902.4709 8 0.2 452.2428 2 69.27 3 39669 AEV_3_3_RA3_01_1233.d 0 1 1 46 53
K.SVVKSDK(+14.02)AGGK.V Y 15.56 1088.6189 11 -32.5 545.2990 2 68.78 3 39273 AEV_3_3_RA3_01_1233.d 1.9E5 1 1 439 449 Methylation(KR)
R.RTGK(+14.02)S(+79.97)VENNPK.F Y 15.55 1322.6344 11 73.1 441.9176 3 36.72 3 17405 AEV_3_3_RA3_01_1233.d 0 1 1 381 391 Methylation(KR); Phosphorylation (STY)
K.S(+42.01)VENNPK.F Y 15.53 828.3977 7 16.9 829.4189 1 83.79 2 43465 AEV_1_3_RA2_01_1232.d 4.91E4 1 1 385 391 Acetylation (N-term)
K.N(+42.01)M(+15.99)ITGTSQADC(+57.02)AILIIAAGTGEFEAGISK.D Y 15.38 2996.4470 29 -23.0 750.1018 4 87.11 2 45689 AEV_1_3_RA2_01_1232.d 0 1 1 102 130 Acetylation (N-term); Oxidation (M); Carbamidomethylation
R.GITIDIALWK(+14.02)FETPK.Y Y 15.28 1744.9763 15 23.2 437.2615 4 68.49 3 39044 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 71 85 Methylation(KR)
K.FETPKYNVTVIDAPGHR(+14.02).D Y 15.27 1957.0057 17 5.1 490.2612 4 68.07 2 31412 AEV_1_3_RA2_01_1232.d 9.51E4 1 1 81 97 Methylation(KR)
R.GITIDIALWK(+28.03).F Y 15.26 1156.6855 10 -9.4 386.5655 3 42.74 2 16829 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 71 80 Dimethylation(KR)
R.R(+31.99)TVAVGVIKSVVK(+42.01).S Y 15.24 1428.8663 13 -4.3 358.2223 4 39.61 2 15282 AEV_1_3_RA2_01_1232.d 0 1 1 430 442 Dihydroxy; Acetylation (K)
K.A(+42.01)GGKVTK.A Y 15.24 701.4072 7 5.2 351.7127 2 12.93 2 3566 AEV_1_3_RA2_01_1232.d 0 1 1 446 452 Acetylation (N-term)
K.C(+45.99)GGIDSR.T Y 15.14 752.2946 7 65.4 377.1791 2 21.48 1 5216 AEV 2_3_RA2_01_1224.d 0 1 1 32 38 Beta-methylthiolation
K.S(+43.01)GDAAIVK.M Y 15.14 802.4185 8 -65.4 402.1902 2 30.81 1 9462 AEV 2_3_RA2_01_1224.d 2.58E5 1 1 395 402 Carbamylation
total 249 peptides
C1G3Y8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.M(+15.99)GTEVPGDSLGDEFKGYLFK.I Y 160.67 2205.0300 20 2.2 736.0189 3 81.60 2 41834 AEV_1_3_RA2_01_1232.d 2.57E6 6 6 32 51 Oxidation (M)
R.GAITNFDLSVLALSIIKQGEGEIPGLTDVVNPK.R Y 159.70 3407.8550 33 -0.9 1136.9579 3 97.49 2 50172 AEV_1_3_RA2_01_1232.d 8.14E5 4 4 99 131
R.GAITNFDLSVLALSIIK.Q Y 128.19 1774.0239 17 3.9 592.3509 3 95.05 2 49352 AEV_1_3_RA2_01_1232.d 5.86E6 15 15 99 115
R.LLLSDGHSC(+57.02)YRPR.R Y 121.84 1572.7831 13 6.4 394.2056 4 57.29 2 24299 AEV_1_3_RA2_01_1232.d 9.53E6 22 22 75 87 Carbamidomethylation
R.MGTEVPGDSLGDEFKGYLFK.I Y 118.42 2189.0349 20 -1.2 730.6847 3 82.59 2 42590 AEV_1_3_RA2_01_1232.d 4.1E6 8 8 32 51
K.SVRGAITNFDLSVLALSIIKQGEGEIPGLTDVVNPK.R Y 117.45 3750.0566 36 -3.3 938.5183 4 94.87 3 57185 AEV_3_3_RA3_01_1233.d 9.22E5 6 6 96 131
MKLNISYPANGSQK.L Y 114.03 1549.7922 14 3.9 517.6067 3 62.71 2 27680 AEV_1_3_RA2_01_1232.d 2.14E6 6 6 1 14
K.ITGGNDKQGFPMKQGVLVPTR.V Y 113.63 2242.1892 21 7.4 561.5587 4 66.18 2 30074 AEV_1_3_RA2_01_1232.d 8.9E5 4 4 52 72
R.RAESAKEQANEYAK.L Y 112.01 1593.7747 14 5.3 532.2683 3 18.19 2 5674 AEV_1_3_RA2_01_1232.d 6.7E6 20 20 198 211
R.GAITNFDLSVLALSIIKQGEGE(+14.02)IPGLTDVVNPK.R Y 112.00 3421.8708 33 -2.0 1141.6287 3 97.53 3 58235 AEV_3_3_RA3_01_1233.d 1.33E5 1 1 99 131 Methylation(others)
R.AESAKEQANEYAK.L Y 110.74 1437.6736 13 0.6 719.8445 2 19.26 3 7458 AEV_3_3_RA3_01_1233.d 3.39E6 10 10 199 211
K.RMGTEVPGDSLGDEFKGYLFK.I Y 110.57 2345.1362 21 3.6 587.2935 4 79.99 2 40553 AEV_1_3_RA2_01_1232.d 1.18E6 4 4 31 51
K.QGEGEIPGLTDVVNPK.R Y 109.09 1651.8417 16 -0.1 826.9280 2 76.50 2 37825 AEV_1_3_RA2_01_1232.d 1.63E6 7 7 116 131
K.RM(+15.99)GTEVPGDSLGDEFKGYLFK.I Y 108.46 2361.1311 21 9.2 591.2955 4 78.86 2 39676 AEV_1_3_RA2_01_1232.d 4.34E5 2 2 31 51 Oxidation (M)
K.QGEGEIPGLTDVVNPKR.L Y 105.88 1807.9427 17 -8.3 603.6498 3 72.40 2 34654 AEV_1_3_RA2_01_1232.d 4.83E5 2 2 116 132
K.SVRGAITNFDLSVLALSIIK.Q Y 101.65 2116.2256 20 0.0 706.4158 3 90.83 3 55171 AEV_3_3_RA3_01_1233.d 1.14E5 2 2 96 115
R.GAITNFDLSVLALSIIKQGEGEIPGLTDVVNPKR.L Y 101.21 3563.9563 34 0.0 891.9963 4 95.14 3 57290 AEV_3_3_RA3_01_1233.d 7.97E5 5 5 99 132
R.RRAESAKEQANEYAK.L Y 98.03 1749.8757 15 5.0 438.4784 4 20.70 2 6722 AEV_1_3_RA2_01_1232.d 2.11E6 6 6 197 211
K.FFGLDPKDDVR.K Y 97.66 1307.6509 11 2.8 436.8921 3 72.50 2 34736 AEV_1_3_RA2_01_1232.d 1.83E6 9 9 144 154
R.GAITNFDLSVLALSIIK(+14.02).Q Y 95.12 1788.0397 17 6.0 597.0240 3 96.80 2 49941 AEV_1_3_RA2_01_1232.d 4.06E5 6 6 99 115 Methylation(KR)
K.ITGGNDKQGFPM(+15.99)KQGVLVPTR.V Y 94.42 2258.1841 21 2.7 565.5548 4 60.14 3 32515 AEV_3_3_RA3_01_1233.d 5.46E5 3 3 52 72 Oxidation (M)
K.FFGLDPKDDVRK.F Y 94.22 1435.7458 12 7.7 479.5929 3 66.51 2 30305 AEV_1_3_RA2_01_1232.d 4.95E6 9 9 144 155
K.LIEIDDERKLRPFMEKR.M Y 94.17 2187.1833 17 -4.1 438.4422 5 67.07 3 37907 AEV_3_3_RA3_01_1233.d 2E5 1 1 15 31
K.ITGGNDKQGFPMK.Q Y 91.53 1391.6868 13 2.2 464.9039 3 41.62 3 20456 AEV_3_3_RA3_01_1233.d 1.64E6 9 9 52 64
R.VRLLLSDGHSC(+57.02)YRPR.R Y 91.31 1827.9526 15 -21.1 457.9858 4 58.56 3 31337 AEV_3_3_RA3_01_1233.d 7.83E5 4 4 73 87 Carbamidomethylation
MKLNISYPAN(+.98)GSQK.L Y 90.77 1550.7762 14 -3.4 776.3928 2 64.18 3 35683 AEV_3_3_RA3_01_1233.d 4.24E6 11 11 1 14 Deamidation (NQ)
M(+15.99)KLNISYPANGSQK.L Y 89.15 1565.7871 14 1.3 522.9370 3 51.34 3 26652 AEV_3_3_RA3_01_1233.d 1.93E6 10 10 1 14 Oxidation (M)
R.GAITN(+.98)FDLSVLALSIIK.Q Y 88.71 1775.0081 17 3.0 592.6784 3 96.05 3 57692 AEV_3_3_RA3_01_1233.d 1.71E5 3 3 99 115 Deamidation (NQ)
K.Q(-17.03)GEGEIPGLTDVVNPK.R Y 87.71 1634.8151 16 1.2 818.4158 2 82.36 2 42422 AEV_1_3_RA2_01_1232.d 4.2E6 9 9 116 131 Pyro-glu from Q
K.Q(-17.03)GEGEIPGLTDVVNPKR.L Y 85.82 1790.9163 17 -2.9 896.4628 2 78.29 3 46769 AEV_3_3_RA3_01_1233.d 1.23E6 3 3 116 132 Pyro-glu from Q
R.MGTEVPGDSLGDEFK.G Y 85.74 1580.7028 15 2.8 791.3609 2 73.46 2 35546 AEV_1_3_RA2_01_1232.d 2.04E5 4 4 32 46
R.M(+42.01)(+15.99)GTEVPGDSLGDEFKGYLFK.I Y 84.44 2247.0405 20 8.8 562.7723 4 78.46 3 46866 AEV_3_3_RA3_01_1233.d 8.18E4 1 1 32 51 Acetylation (N-term); Oxidation (M)
R.KFFGLDPKDDVR.K Y 81.45 1435.7458 12 18.9 479.5983 3 67.02 2 30667 AEV_1_3_RA2_01_1232.d 2.67E6 7 7 143 154
R.GAITNFD(+14.02)LSVLALSIIK.Q Y 81.06 1788.0397 17 4.1 597.0229 3 97.59 3 58240 AEV_3_3_RA3_01_1233.d 7.3E4 3 3 99 115 Methylation(others)
R.MGTEVPGDSLGDE(+14.02)FKGYLFK.I Y 77.89 2203.0505 20 1.3 735.3584 3 84.64 3 51453 AEV_3_3_RA3_01_1233.d 8.63E5 4 4 32 51 Methylation(others)
MKLNISYPANGSQKLIEIDDER.K Y 77.68 2533.2847 22 -11.1 634.3214 4 77.25 3 45902 AEV_3_3_RA3_01_1233.d 3.42E5 2 2 1 22
K.Q(-17.03)GFPMKQGVLVPTR.V Y 77.68 1539.8231 14 -0.7 770.9183 2 76.96 2 38146 AEV_1_3_RA2_01_1232.d 1.61E5 2 2 59 72 Pyro-glu from Q
R.LLLSDGHSC(+57.02)YRPR(+14.02).R Y 76.52 1586.7987 13 -0.6 397.7067 4 58.95 3 31702 AEV_3_3_RA3_01_1233.d 5.41E5 2 2 75 87 Carbamidomethylation; Methylation(KR)
R.AESAKEQ(+.98)ANEYAK.L Y 75.65 1438.6576 13 0.2 720.3362 2 24.41 3 10241 AEV_3_3_RA3_01_1233.d 3.33E5 3 3 199 211 Deamidation (NQ)
K.Q(+.98)GEGEIPGLTDVVNPK.R Y 75.39 1652.8257 16 -1.0 827.4193 2 77.10 3 45828 AEV_3_3_RA3_01_1233.d 4.23E5 3 3 116 131 Deamidation (NQ)
R.KFFGLDPKDDVRK.F Y 74.31 1563.8408 13 -0.8 391.9672 4 60.58 3 32909 AEV_3_3_RA3_01_1233.d 3.95E6 12 12 143 155
M(+15.99)KLNISYPAN(+.98)GSQK.L Y 74.03 1566.7711 14 2.3 784.3947 2 56.39 3 29785 AEV_3_3_RA3_01_1233.d 2.51E6 13 13 1 14 Oxidation (M); Deamidation (NQ)
R.MGTE(+14.02)VPGDSLGDEFKGYLFK.I Y 73.95 2203.0505 20 -0.4 735.3572 3 83.02 3 50318 AEV_3_3_RA3_01_1233.d 3.45E5 2 2 32 51 Methylation(others)
K.LNISYPANGSQK.L Y 72.67 1290.6567 12 -11.7 646.3281 2 58.35 3 31235 AEV_3_3_RA3_01_1233.d 5.63E5 4 4 3 14
K.LNISYPAN(+.98)GSQK.L Y 72.32 1291.6407 12 2.4 646.8292 2 62.39 2 27513 AEV_1_3_RA2_01_1232.d 8.45E5 5 5 3 14 Deamidation (NQ)
R.RAESAKEQ(+.98)ANEYAK.L Y 72.00 1594.7587 14 4.5 532.5959 3 22.72 2 7530 AEV_1_3_RA2_01_1232.d 8.36E5 5 5 198 211 Deamidation (NQ)
R.M(+15.99)GTEVPGDSLGDEFK(+14.02)GYLFK.I Y 71.03 2219.0457 20 10.3 740.6968 3 83.75 3 50909 AEV_3_3_RA3_01_1233.d 5.12E5 4 4 32 51 Oxidation (M); Methylation(KR)
K.ITGGNDKQGFPM(+15.99)K.Q Y 69.66 1407.6816 13 2.7 470.2357 3 29.44 3 13066 AEV_3_3_RA3_01_1233.d 2.43E6 11 11 52 64 Oxidation (M)
R.RAESAKEQANEYAK(+14.02).L Y 68.94 1607.7903 14 2.3 402.9558 4 23.68 3 9811 AEV_3_3_RA3_01_1233.d 1.81E6 9 9 198 211 Methylation(KR)
R.AESAKEQANEYAK(+14.02).L Y 68.25 1451.6892 13 4.7 484.9059 3 27.59 3 12017 AEV_3_3_RA3_01_1233.d 4.52E5 4 4 199 211 Methylation(KR)
R.LLLSDGHSC(+57.02)YRPRR.T Y 67.88 1728.8842 14 5.1 433.2305 4 47.77 3 24299 AEV_3_3_RA3_01_1233.d 1.12E6 5 5 75 88 Carbamidomethylation
R.MGTEVPGDSLGDEFK(+14.02)GYLFK.I Y 67.83 2203.0505 20 2.6 735.3594 3 83.64 2 43348 AEV_1_3_RA2_01_1232.d 6.5E5 2 2 32 51 Methylation(KR)
K.FFGLDPK.D Y 67.64 822.4276 7 0.4 412.2212 2 71.97 3 41771 AEV_3_3_RA3_01_1233.d 1.19E6 5 5 144 150
R.GAITNFDLSVLALS(-2.02)IIKQGEGEIPGLTDVVNPK.R Y 66.72 3405.8394 33 -17.9 852.4518 4 97.56 3 58227 AEV_3_3_RA3_01_1233.d 2.25E5 1 1 99 131 2-amino-3-oxo-butanoic_acid
K.LIEIDDER.K Y 65.58 1001.5029 8 3.8 501.7607 2 59.09 2 25286 AEV_1_3_RA2_01_1232.d 3.18E6 7 7 15 22
K.FFGLDPKDDVR(+14.02).K Y 64.74 1321.6666 11 -3.2 441.5614 3 75.38 3 44442 AEV_3_3_RA3_01_1233.d 1.26E5 3 3 144 154 Methylation(KR)
R.AE(+14.02)SAKEQANEYAK.L Y 64.54 1451.6892 13 -1.8 726.8506 2 24.75 3 10443 AEV_3_3_RA3_01_1233.d 4.17E5 4 4 199 211 Methylation(others)
R.TVTGKN(+.98)GKEYTKAPK.I Y 62.97 1621.8674 15 4.0 811.9442 2 18.45 3 7006 AEV_3_3_RA3_01_1233.d 6.73E5 5 5 161 175 Deamidation (NQ)
K.Q(-17.03)GVLVPTRVR.L Y 62.77 1106.6560 10 -4.1 554.3330 2 65.71 3 36838 AEV_3_3_RA3_01_1233.d 8.93E5 2 2 65 74 Pyro-glu from Q
R.AESAKEQANE(+14.02)YAK.L Y 62.31 1451.6892 13 0.0 484.9037 3 21.86 3 8845 AEV_3_3_RA3_01_1233.d 2.43E5 3 3 199 211 Methylation(others)
K.QGEGE(+14.02)IPGLTDVVNPK.R Y 62.28 1665.8573 16 -4.1 833.9325 2 78.19 2 39170 AEV_1_3_RA2_01_1232.d 2.48E5 2 2 116 131 Methylation(others)
K.QGE(+14.02)GEIPGLTDVVNPK.R Y 60.86 1665.8573 16 -0.6 833.9354 2 78.00 3 46498 AEV_3_3_RA3_01_1233.d 3.63E5 3 3 116 131 Methylation(others)
K.LIEIDDERK.L Y 60.80 1129.5979 9 1.4 565.8070 2 45.91 2 18385 AEV_1_3_RA2_01_1232.d 3.38E6 10 10 15 23
K.NGKEYTKAPK.I Y 60.49 1134.6033 10 11.1 568.3152 2 10.62 3 2825 AEV_3_3_RA3_01_1233.d 1.77E5 3 3 166 175
K.IRKFFGLDPKDDVR.K Y 60.44 1704.9310 14 1.2 341.9939 5 65.06 3 36323 AEV_3_3_RA3_01_1233.d 1.91E5 2 2 141 154
MKLNISYPANGSQ(+.98)KLIEIDDERK.L Y 59.61 2662.3635 23 -2.8 533.4785 5 74.25 3 43542 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 1 23 Deamidation (NQ)
K.N(+.98)GKEYTKAPK.I Y 59.55 1135.5873 10 1.8 568.8019 2 14.18 2 4037 AEV_1_3_RA2_01_1232.d 5.28E5 5 5 166 175 Deamidation (NQ)
R.TVTGKN(+.98)GKEYTK.A Y 59.26 1325.6826 12 2.7 663.8504 2 12.71 3 3877 AEV_3_3_RA3_01_1233.d 7.38E5 7 7 161 172 Deamidation (NQ)
R.R(+14.02)AESAKEQANEYAK.L Y 59.25 1607.7903 14 -14.8 402.9489 4 20.78 3 8235 AEV_3_3_RA3_01_1233.d 4.01E5 4 4 198 211 Methylation(KR)
R.RAESAKE(+14.02)QANEYAK.L Y 57.12 1607.7903 14 1.2 536.9380 3 19.15 3 7377 AEV_3_3_RA3_01_1233.d 2.9E5 2 2 198 211 Methylation(others)
R.RAESAKEQAN(+.98)EYAK.L Y 56.12 1594.7587 14 14.5 532.6012 3 17.02 3 6212 AEV_3_3_RA3_01_1233.d 7.57E5 4 4 198 211 Deamidation (NQ)
K.QGVLVPTR.V Y 55.29 868.5131 8 3.2 435.2652 2 47.66 2 19259 AEV_1_3_RA2_01_1232.d 3.93E6 8 8 65 72
K.Q(+15.00)GEGEIPGLTDVVNPK.R Y 55.18 1666.8413 16 6.9 834.4337 2 77.98 3 46483 AEV_3_3_RA3_01_1233.d 1.75E5 2 2 116 131 Deamidation followed by a methylation
K.ITGGNDK(-1.03)QGFPMKQGVLVPTR.V Y 55.09 2241.1575 21 -7.9 561.2922 4 65.45 3 36639 AEV_3_3_RA3_01_1233.d 0 1 1 52 72 Lysine oxidation to aminoadipic semialdehyde
R.RAESAKEQANE(+14.02)YAK.L Y 54.93 1607.7903 14 3.7 536.9393 3 18.35 3 6948 AEV_3_3_RA3_01_1233.d 1.35E5 2 2 198 211 Methylation(others)
K.Q(-17.03)GEGEIPGLTDVVNPK(+14.02).R Y 54.79 1648.8308 16 -0.6 825.4222 2 83.19 3 50446 AEV_3_3_RA3_01_1233.d 8.25E5 4 4 116 131 Pyro-glu from Q; Methylation(KR)
K.R(+42.01)(+14.02)MGTEVPGDSLGDEFKGYLFK.I Y 54.77 2401.1624 21 -2.5 601.2964 4 76.60 2 37871 AEV_1_3_RA2_01_1232.d 1.8E4 2 2 31 51 Acetylation (N-term); Methylation(KR)
K.ITGGNDKQGFPM(-48.00)K.Q Y 54.20 1343.6833 13 3.3 448.9032 3 20.47 3 8087 AEV_3_3_RA3_01_1233.d 2.74E6 4 4 52 64 Dethiomethyl
R.GAITNFDLSVLALSIIK(+14.02)QGEGEIPGLTDVVNPK.R Y 52.85 3421.8708 33 4.0 856.4784 4 97.50 3 58195 AEV_3_3_RA3_01_1233.d 3.34E5 2 2 99 131 Methylation(KR)
K.Q(-17.03)GFPM(+15.99)KQGVLVPTR.V Y 51.99 1555.8180 14 -2.7 778.9142 2 70.29 3 40456 AEV_3_3_RA3_01_1233.d 1.61E5 2 2 59 72 Pyro-glu from Q; Oxidation (M)
K.Q(-17.03)GEGEIPGLTDVVN(+.98)PK.R Y 51.44 1635.7992 16 12.0 818.9167 2 82.40 3 49886 AEV_3_3_RA3_01_1233.d 5.08E5 2 2 116 131 Pyro-glu from Q; Deamidation (NQ)
R.AESAKEQAN(+.98)EYAK.L Y 51.40 1438.6576 13 -0.9 720.3354 2 23.79 3 9868 AEV_3_3_RA3_01_1233.d 7.61E4 2 2 199 211 Deamidation (NQ)
MKLNISYPAN(+.98)GSQ(+.98)K.L Y 51.09 1551.7603 14 9.5 518.2656 3 64.95 3 36228 AEV_3_3_RA3_01_1233.d 4.26E5 2 2 1 14 Deamidation (NQ)
R.TVTGKNGKEYTK.A Y 50.56 1324.6986 12 6.0 442.5761 3 11.00 2 2844 AEV_1_3_RA2_01_1232.d 6.86E4 2 2 161 172
K.FFGLDPKDDVRK(+14.02).F Y 50.26 1449.7616 12 4.3 363.4492 4 67.31 3 38097 AEV_3_3_RA3_01_1233.d 2.16E5 1 1 144 155 Methylation(KR)
K.LRPFMEKR.M Y 50.10 1075.5961 8 1.6 359.5399 3 33.74 3 15587 AEV_3_3_RA3_01_1233.d 2.5E5 1 1 24 31
K.LIEIDDERKLRPFMEK.R Y 49.22 2031.0823 16 1.9 508.7788 4 70.21 3 40415 AEV_3_3_RA3_01_1233.d 2.44E5 1 1 15 30
K.QGVLVPTRVR.L Y 48.58 1123.6825 10 -6.8 375.5656 3 50.22 3 25874 AEV_3_3_RA3_01_1233.d 5.82E5 2 2 65 74
MKLNISYPANGSQ(+.98)K.L Y 48.12 1550.7762 14 6.7 517.9362 3 63.54 2 28250 AEV_1_3_RA2_01_1232.d 7.48E4 1 1 1 14 Deamidation (NQ)
MKLN(+.98)ISYPANGSQK.L Y 48.06 1550.7762 14 10.7 517.9382 3 61.65 3 33701 AEV_3_3_RA3_01_1233.d 2.98E5 1 1 1 14 Deamidation (NQ)
R.RRAESAKEQANEYAK(+14.02).L Y 47.31 1763.8914 15 2.3 441.9811 4 24.05 3 10025 AEV_3_3_RA3_01_1233.d 1.87E5 1 1 197 211 Methylation(KR)
K.F(+41.03)FGLDPKDDVRK.F Y 44.72 1476.7725 12 4.9 370.2022 4 66.65 2 30403 AEV_1_3_RA2_01_1232.d 4.26E4 1 1 144 155 Amidination of lysines or N-terminal amines with methyl acetimidate
K.QGFPMKQGVLVPTR.V Y 44.54 1556.8497 14 51.1 519.9837 3 67.91 3 38586 AEV_3_3_RA3_01_1233.d 0 2 2 59 72
R.AESAK(+14.02)EQANEYAK.L Y 44.01 1451.6892 13 3.4 484.9053 3 23.15 3 9518 AEV_3_3_RA3_01_1233.d 1.49E5 1 1 199 211 Methylation(KR)
R.LVTPQR.L Y 43.75 712.4232 6 -90.2 357.1867 2 33.94 1 11153 AEV 2_3_RA2_01_1224.d 8.01E6 10 10 179 184
K.Q(-17.03)GVLVPTR.V Y 43.26 851.4865 8 -3.6 426.7490 2 66.86 3 37740 AEV_3_3_RA3_01_1233.d 1.83E6 3 3 65 72 Pyro-glu from Q
K.R(+43.01)(+14.02)MGTEVPGDSLGDEFKGYLFK.I Y 43.01 2402.1575 21 3.3 481.4404 5 75.77 3 44735 AEV_3_3_RA3_01_1233.d 3.56E5 2 2 31 51 Carbamylation; Methylation(KR)
K.IRKFFGLDPK.D Y 42.86 1219.7076 10 -3.6 407.5750 3 62.68 3 34488 AEV_3_3_RA3_01_1233.d 1.31E5 2 2 141 150
R.M(-48.00)GTEVPGDSLGDEFKGYLFK.I Y 41.82 2141.0317 20 0.7 536.2656 4 78.36 3 46833 AEV_3_3_RA3_01_1233.d 4.47E5 1 1 32 51 Dethiomethyl
K.EQANEYAK.L Y 41.76 951.4297 8 -87.6 476.6805 2 20.28 1 4854 AEV 2_3_RA2_01_1224.d 3.7E5 2 2 204 211
R.M(+15.99)GTEVPGDSLGDEFKGYLFK(+14.02).I Y 41.50 2219.0457 20 -1.1 740.6884 3 82.31 3 49818 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 32 51 Oxidation (M); Methylation(KR)
MKLNISYPAN(+.98)GSQK(+14.02).L Y 41.01 1564.7919 14 2.4 522.6058 3 66.43 2 30256 AEV_1_3_RA2_01_1232.d 2.92E5 3 3 1 14 Deamidation (NQ); Methylation(KR)
K.LNISYPANGSQ(+.98)K.L Y 39.86 1291.6407 12 -5.2 646.8243 2 62.69 3 34498 AEV_3_3_RA3_01_1233.d 2.88E5 1 1 3 14 Deamidation (NQ)
R.K(+42.01)S(+79.97)VRGAITN(+.98)FDLSVLALSIIK.Q Y 39.45 2367.2815 21 46.2 592.8550 4 94.28 3 56912 AEV_3_3_RA3_01_1233.d 8.18E4 1 1 95 115 Acetylation (N-term); Phosphorylation (STY); Deamidation (NQ)
R.LVTPQRLQR.K Y 39.10 1109.6669 9 8.8 370.8995 3 41.48 2 16194 AEV_1_3_RA2_01_1232.d 3.13E6 4 4 179 187
K.ITGGNDKQ(+.98)GFPMKQGVLVPTR.V Y 38.92 2243.1731 21 -5.9 561.7972 4 66.54 3 37495 AEV_3_3_RA3_01_1233.d 2.36E5 2 2 52 72 Deamidation (NQ)
R.MGTEVPGDS(+14.02)LGDEFKGYLFK.I Y 38.20 2203.0505 20 7.6 735.3630 3 81.89 3 49510 AEV_3_3_RA3_01_1233.d 3.8E4 1 1 32 51 Methylation(others)
K.LIEIDDER(+14.02)K.L Y 37.68 1143.6135 9 6.0 382.2141 3 50.98 3 26359 AEV_3_3_RA3_01_1233.d 6.3E5 2 2 15 23 Methylation(KR)
K.ITGGNDKQ(+.98)GFPMK.Q Y 37.64 1392.6708 13 4.1 465.2328 3 45.72 3 23001 AEV_3_3_RA3_01_1233.d 2.62E5 2 2 52 64 Deamidation (NQ)
K.QGVLVPTR(+14.02).V Y 37.50 882.5287 8 -21.3 442.2622 2 53.62 3 28126 AEV_3_3_RA3_01_1233.d 0 1 1 65 72 Methylation(KR)
R.TVTGKNGKEYTKAPK.I Y 36.70 1620.8834 15 -18.1 541.2920 3 15.03 3 5139 AEV_3_3_RA3_01_1233.d 1.11E6 2 2 161 175
R.MGTEVPGDSLGD(+14.02)EFKGYLFK.I Y 36.30 2203.0505 20 0.1 735.3575 3 85.05 3 51728 AEV_3_3_RA3_01_1233.d 2.99E5 1 1 32 51 Methylation(others)
K.Q(+.98)GVLVPTR.V Y 35.91 869.4971 8 1.4 435.7564 2 49.38 3 25332 AEV_3_3_RA3_01_1233.d 9.87E5 3 3 65 72 Deamidation (NQ)
R.KFFGLDPK.D Y 34.55 950.5225 8 0.5 317.8483 3 63.54 3 35181 AEV_3_3_RA3_01_1233.d 2.13E5 2 2 143 150
R.MGTEVPGDSLGDEFKGYLFK(+14.02).I Y 33.73 2203.0505 20 3.5 1102.5364 2 83.36 3 50572 AEV_3_3_RA3_01_1233.d 2.48E5 2 2 32 51 Methylation(KR)
K.LIEIDDER(+14.02).K Y 33.71 1015.5186 8 5.6 508.7694 2 64.16 2 28671 AEV_1_3_RA2_01_1232.d 1.15E6 5 5 15 22 Methylation(KR)
R.LLLSDGHSC(+57.02)YR(+.98)PR.R Y 33.69 1573.7671 13 26.8 394.4596 4 60.46 2 26224 AEV_1_3_RA2_01_1232.d 0 1 1 75 87 Carbamidomethylation; Deamidation (R)
R.K(+411.26)SVRGAITNFDLSVLALSIIK.Q Y 33.30 2655.5798 21 -74.3 886.1348 3 94.83 3 57143 AEV_3_3_RA3_01_1233.d 1.61E5 1 1 95 115 LeudimethylArgGlyGly
K.RMGTEVPGDSLGDEFK.G Y 32.95 1736.8040 16 8.4 579.9468 3 68.77 2 31937 AEV_1_3_RA2_01_1232.d 1.68E5 4 4 31 46
K.LIE(+14.02)IDDER.K Y 32.75 1015.5186 8 -3.5 508.7648 2 61.98 3 34003 AEV_3_3_RA3_01_1233.d 9.64E5 3 3 15 22 Methylation(others)
R.KLRPFMEKR.M Y 32.27 1203.6910 9 1.6 402.2383 3 31.60 3 14327 AEV_3_3_RA3_01_1233.d 2.1E5 1 1 23 31
K.L(+42.01)IEIDDERK.L Y 32.11 1171.6084 9 -5.2 391.5414 3 43.85 3 21812 AEV_3_3_RA3_01_1233.d 0 1 1 15 23 Acetylation (Protein N-term)
R.M(+15.99)GTEVPGDSLGDEFK.G Y 31.96 1596.6978 15 -6.5 400.1791 4 60.72 1 27018 AEV 2_3_RA2_01_1224.d 0 1 1 32 46 Oxidation (M)
K.ITGGN(+.98)DKQGFPMKQGVLVPTR.V Y 31.84 2243.1731 21 5.4 561.8036 4 67.42 2 30946 AEV_1_3_RA2_01_1232.d 2.78E5 2 2 52 72 Deamidation (NQ)
K.Q(+.98)GEGEIPGLTDVVNPKR.L Y 31.42 1808.9268 17 20.9 603.9955 3 73.10 3 42658 AEV_3_3_RA3_01_1233.d 0 1 1 116 132 Deamidation (NQ)
R.AESAKEQANEYAKLLAAR.V Y 31.38 1962.0170 18 6.6 491.5148 4 67.11 3 37939 AEV_3_3_RA3_01_1233.d 7.95E4 1 1 199 216
K.I(+43.01)TGGNDK(+14.02)QGFPMKQGVLVPTR.V Y 31.28 2299.2107 21 -0.3 575.8098 4 54.33 3 28566 AEV_3_3_RA3_01_1233.d 6.39E5 1 1 52 72 Carbamylation; Methylation(KR)
R.L(+56.06)LLSDGHSC(+57.02)YRPR.R Y 31.13 1628.8457 13 -8.4 408.2153 4 56.88 3 30131 AEV_3_3_RA3_01_1233.d 6.73E4 1 1 75 87 Diethylation; Carbamidomethylation
R.MGTEVPGDSLGDEFKGY(+15.01)LFK.I Y 30.99 2204.0459 20 6.4 735.6939 3 84.96 2 44289 AEV_1_3_RA2_01_1232.d 1.62E5 2 2 32 51 Tyrosine oxidation to 2-aminotyrosine
R.VHEEKAKR.T Y 30.53 995.5512 8 7.6 498.7867 2 7.45 2 1747 AEV_1_3_RA2_01_1232.d 1.45E3 1 1 217 224
R.VR(+39.99)LLLSDGHSC(+57.02)YRPR.R Y 30.20 1867.9475 15 63.0 374.6203 5 60.76 2 26402 AEV_1_3_RA2_01_1232.d 2.08E5 1 1 73 87 Glyoxal-derived hydroimiadazolone; Carbamidomethylation
R.M(+15.99)GTE(+43.99)VPGDSLGDEFKGYLFK.I Y 29.95 2249.0198 20 46.2 563.2882 4 78.97 2 39748 AEV_1_3_RA2_01_1232.d 0 1 1 32 51 Oxidation (M); Carboxylation (E)
R.VHEEK(+14.02)AKR.T Y 29.79 1009.5668 8 1.4 505.7914 2 8.96 3 2153 AEV_3_3_RA3_01_1233.d 6.32E3 1 1 217 224 Methylation(KR)
K.LIEIDDE(+14.02)RK.L Y 28.93 1143.6135 9 -0.5 382.2116 3 55.12 3 29025 AEV_3_3_RA3_01_1233.d 3.38E5 1 1 15 23 Methylation(others)
K.F(+43.01)FGLDPKDDVR.K Y 28.53 1350.6567 11 60.6 451.2535 3 72.71 2 34900 AEV_1_3_RA2_01_1232.d 4.6E4 1 1 144 154 Carbamylation
R.LVTPQ(+.98)R.L Y 27.51 713.4072 6 2.4 357.7117 2 24.35 3 10208 AEV_3_3_RA3_01_1233.d 1.06E6 3 3 179 184 Deamidation (NQ)
MK(+14.02)LN(+.98)ISYPANGSQK.L Y 27.43 1564.7919 14 34.9 783.4305 2 51.28 3 26628 AEV_3_3_RA3_01_1233.d 1.75E5 2 2 1 14 Methylation(KR); Deamidation (NQ)
K.GYLFK.I Y 27.08 626.3428 5 -31.0 627.3306 1 55.34 3 29147 AEV_3_3_RA3_01_1233.d 0 1 1 47 51
MK(+14.02)LNISYPANGSQK.L Y 26.78 1563.8079 14 -67.9 522.2411 3 51.53 3 26740 AEV_3_3_RA3_01_1233.d 0 1 1 1 14 Methylation(KR)
R.MGTEVPGDS(-18.01)LGDEFK(+14.02)GYLFK.I Y 26.59 2185.0400 20 -92.0 729.2869 3 87.63 1 47827 AEV 2_3_RA2_01_1224.d 3.75E4 1 1 32 51 Dehydration; Methylation(KR)
R.AES(-18.01)AK.E Y 26.55 486.2438 5 5.2 487.2536 1 37.16 2 14104 AEV_1_3_RA2_01_1232.d 0 1 1 199 203 Dehydration
R.VRLLLSDGHS(-18.01)C(+57.02)YR(+14.02)PR.R Y 26.43 1823.9576 15 20.9 457.0062 4 58.66 3 31412 AEV_3_3_RA3_01_1233.d 0 1 1 73 87 Dehydration; Carbamidomethylation; Methylation(KR)
R.LVTPQR(+14.02).L Y 26.35 726.4388 6 -27.3 364.2168 2 29.43 3 13107 AEV_3_3_RA3_01_1233.d 1.99E5 2 2 179 184 Methylation(KR)
K.ITGGND(-18.01)KQGFPM(+15.99)KQGVLVPTR.V Y 26.30 2240.1736 21 -28.8 561.0345 4 66.84 3 37726 AEV_3_3_RA3_01_1233.d 3.1E4 1 1 52 72 Dehydration; Oxidation (M)
R.KFFGLDPKDDVRK(+14.02).F Y 26.21 1577.8564 13 -5.6 316.5768 5 62.84 3 34612 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 143 155 Methylation(KR)
M.KLNISYPAN(+.98)GSQK.L Y 25.34 1419.7357 13 0.4 474.2527 3 53.07 3 27812 AEV_3_3_RA3_01_1233.d 2.84E5 1 1 2 14 Deamidation (NQ)
M(+15.99)KLNISYPAN(+.98)GSQK(+14.02).L Y 25.08 1580.7869 14 2.6 527.9376 3 59.77 3 32248 AEV_3_3_RA3_01_1233.d 1.62E5 1 1 1 14 Oxidation (M); Deamidation (NQ); Methylation(KR)
K.FFGLDPKDDVR(+14.02)K.F Y 24.66 1449.7616 12 -1.8 363.4470 4 68.21 3 38826 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 144 155 Methylation(KR)
K.ITGGNDK(+97.02).Q Y 24.21 800.3665 7 -17.5 801.3597 1 89.99 1 49614 AEV 2_3_RA2_01_1224.d 1.23E4 1 1 52 58 Maleimide
K.LNISYPAN(+.98)GSQK(+42.01)LIEIDDER(+14.02).K Y 24.04 2331.1594 20 12.7 467.2451 5 42.85 2 16881 AEV_1_3_RA2_01_1232.d 0 1 1 3 22 Deamidation (NQ); Acetylation (K); Methylation(KR)
R.AESAK.E Y 23.46 504.2543 5 16.3 505.2698 1 54.89 3 28923 AEV_3_3_RA3_01_1233.d 0 1 1 199 203
K.ITGGN(+.98)DKQGFPMK.Q Y 22.34 1392.6708 13 7.4 465.2343 3 49.48 3 25410 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 52 64 Deamidation (NQ)
K.IQR(+31.99)LVTPQRLQ(+.98)R.K Y 22.19 1539.8845 12 -8.3 385.9752 4 42.84 3 21179 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 176 187 Dihydroxy; Deamidation (NQ)
K.I(+42.01)TGGNDK(+14.02)Q(+.98)GFPMKQGVLVPTR.V Y 22.15 2299.1995 21 4.2 575.8096 4 53.91 3 28292 AEV_3_3_RA3_01_1233.d 6.39E5 1 1 52 72 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
R.RAESAK(+21.98).E Y 21.73 682.3374 6 14.7 683.3547 1 55.43 1 23470 AEV 2_3_RA2_01_1224.d 2.5E5 1 1 198 203 Sodium adduct
M(+15.99)KLNISYPANGSQ(+.98)K.L Y 21.69 1566.7711 14 10.8 523.2700 3 58.83 3 31547 AEV_3_3_RA3_01_1233.d 7.72E5 2 2 1 14 Oxidation (M); Deamidation (NQ)
K.I(+42.01)TGGNDKQGFPMK(+14.02)Q(+.98)GVLVPTR.V Y 21.67 2299.1995 21 11.2 460.8523 5 57.27 2 24283 AEV_1_3_RA2_01_1232.d 2.92E5 1 1 52 72 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
R.TVTGKN(+.98)GK(+14.02)EYTKAPK.I Y 21.30 1635.8832 15 0.5 409.9783 4 21.00 3 8366 AEV_3_3_RA3_01_1233.d 8.87E4 1 1 161 175 Deamidation (NQ); Methylation(KR)
K.AKRT(+79.96)ELR.K Y 21.22 952.4760 7 -19.8 318.4930 3 10.05 2 2503 AEV_1_3_RA2_01_1232.d 0 1 1 222 228 Sulfation
R.AESAK(+43.01).E Y 20.93 547.2601 5 -12.0 548.2609 1 68.45 1 32776 AEV 2_3_RA2_01_1224.d 0 1 1 199 203 Carbamylation
K.E(+14.02)QANEYAK.L Y 20.82 965.4454 8 10.2 483.7349 2 19.04 2 6013 AEV_1_3_RA2_01_1232.d 8.82E4 1 1 204 211 Methylation(others)
K.L(+41.03)IEIDDERK.L Y 20.67 1170.6244 9 13.4 391.2206 3 46.15 2 18555 AEV_1_3_RA2_01_1232.d 0 1 1 15 23 Amidination of lysines or N-terminal amines with methyl acetimidate
K.E(+42.01)QANEYAK(+28.03).L Y 20.56 1021.4716 8 -13.8 1022.4648 1 112.08 1 59355 AEV 2_3_RA2_01_1224.d 0 1 1 204 211 Acetylation (N-term); Dimethylation(KR)
R.L(+42.01)VTPQR.L Y 20.52 754.4337 6 -31.4 378.2123 2 23.16 2 7715 AEV_1_3_RA2_01_1232.d 0 1 1 179 184 Acetylation (N-term)
K.I(+27.99)TGGNDK.Q Y 20.45 731.3450 7 29.9 732.3741 1 79.97 2 40536 AEV_1_3_RA2_01_1232.d 6.9E4 1 1 52 58 Formylation
K.F(+42.01)FGLDPK(+14.02).D Y 20.44 878.4537 7 -35.7 879.4297 1 94.11 2 49041 AEV_1_3_RA2_01_1232.d 4.74E4 1 1 144 150 Acetylation (N-term); Methylation(KR)
R.LVT(+79.96)PQR.L Y 20.39 792.3800 6 64.1 397.2227 2 22.24 3 9013 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 179 184 Sulfation
K.LNISYPANGSQK(+28.03).L Y 19.85 1318.6881 12 14.2 330.6840 4 17.50 2 5365 AEV_1_3_RA2_01_1232.d 2.65E5 1 1 3 14 Dimethylation(KR)
K.ITGGNDK.Q Y 19.81 703.3500 7 -1.9 704.3560 1 92.18 3 55884 AEV_3_3_RA3_01_1233.d 0 2 2 52 58
K.LIEIDDERK(+14.02).L Y 19.70 1143.6135 9 -15.3 572.8053 2 50.82 3 26245 AEV_3_3_RA3_01_1233.d 8.14E4 1 1 15 23 Methylation(KR)
R.MGTEVPGD(-18.01)SLGDEFKGYLFK.I Y 19.66 2171.0244 20 9.8 724.6891 3 82.68 2 42638 AEV_1_3_RA2_01_1232.d 2.31E4 1 1 32 51 Dehydration
R.TVTGKNGK(+43.01).E Y 19.55 846.4559 8 11.8 424.2402 2 45.00 3 22559 AEV_3_3_RA3_01_1233.d 1.39E4 1 1 161 168 Carbamylation
K.NGK(+31.99)EYT(+79.97)KAPK.I Y 19.11 1246.5594 10 -92.9 624.2291 2 46.57 1 18217 AEV 2_3_RA2_01_1224.d 2.84E4 1 1 166 175 Dihydroxy; Phosphorylation (STY)
K.LNISYP(+31.99)ANGSQK(+42.01).L Y 19.09 1364.6572 12 -26.9 455.8808 3 13.21 2 3670 AEV_1_3_RA2_01_1232.d 7.39E4 1 1 3 14 Dihydroxy; Acetylation (K)
R.RTGER.K Y 18.74 617.3245 5 -46.0 309.6553 2 23.88 1 6072 AEV 2_3_RA2_01_1224.d 5.75E4 1 1 88 92
K.ITGGNDK(-1.03)QGFPMKQGVLVPTRVR.L Y 18.62 2496.3271 23 -33.7 500.2559 5 64.87 3 36169 AEV_3_3_RA3_01_1233.d 0 1 1 52 74 Lysine oxidation to aminoadipic semialdehyde
K.R(+54.01)MGTEVPGDSLGDEFKGYLFK.I Y 18.21 2399.1467 21 42.3 600.8193 4 76.04 3 44950 AEV_3_3_RA3_01_1233.d 0 1 1 31 51 Methylglyoxal-derived hydroimidazolone
R.K(+14.02)FFGLDPKDDVR.K Y 18.21 1449.7616 12 1.0 363.4480 4 64.53 3 35964 AEV_3_3_RA3_01_1233.d 6.35E4 1 1 143 154 Methylation(KR)
K.I(+226.08)TGGNDK.Q Y 18.00 929.4276 7 -46.5 930.3917 1 95.50 1 53458 AEV 2_3_RA2_01_1224.d 0 1 1 52 58 Biotinylation
K.QGEGEIPGLTDVVN(+.98)PK(+14.02).R Y 17.90 1666.8413 16 -10.9 834.4188 2 78.89 3 47201 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 116 131 Deamidation (NQ); Methylation(KR)
R.Q(-17.03)RIALK.R Y 17.78 710.4439 6 -8.9 356.2261 2 40.45 3 19662 AEV_3_3_RA3_01_1233.d 3.55E5 1 1 190 195 Pyro-glu from Q
K.QGEGEIP(+31.99)GLTDVVNPK.R Y 17.77 1683.8315 16 3.7 842.9261 2 88.17 3 53691 AEV_3_3_RA3_01_1233.d 4.39E4 1 1 116 131 Dihydroxy
K.FVIRR.T Y 17.51 689.4337 5 1.8 345.7247 2 30.53 2 10964 AEV_1_3_RA2_01_1232.d 2.85E6 2 2 156 160
K.ITGGN(+.98)DK(+42.01).Q Y 17.36 746.3446 7 -46.4 374.1623 2 22.04 1 5401 AEV 2_3_RA2_01_1224.d 0 2 2 52 58 Deamidation (NQ); Acetylation (K)
K.ITGGN(+203.08)DK.Q Y 17.30 906.4294 7 -30.1 454.2083 2 49.47 1 19943 AEV 2_3_RA2_01_1224.d 1.15E5 2 2 52 58 HexNAcylation (N)
MK(-1.03)LNISYPANGSQK.L Y 17.22 1548.7606 14 36.5 517.2797 3 62.03 3 33981 AEV_3_3_RA3_01_1233.d 0 1 1 1 14 Lysine oxidation to aminoadipic semialdehyde
R.KFVIRR.T Y 17.08 817.5286 6 -3.7 409.7701 2 21.65 3 8720 AEV_3_3_RA3_01_1233.d 2.21E5 1 1 155 160
K.ITGGNDKQGFPMK(+14.02)Q(+.98)GVLVPTR.V Y 16.99 2257.1890 21 -64.5 753.3550 3 60.32 3 32655 AEV_3_3_RA3_01_1233.d 0 1 1 52 72 Methylation(KR); Deamidation (NQ)
R.MGTEVP(+15.99)GDSLGDEFKGYLFK.I Y 16.96 2205.0300 20 13.4 736.0272 3 84.74 3 51525 AEV_3_3_RA3_01_1233.d 9.57E4 1 1 32 51 Oxidation or Hydroxylation
K.L(+42.01)IE(+43.99)IDDERK.L Y 16.92 1215.5983 9 10.2 406.2108 3 44.08 3 21977 AEV_3_3_RA3_01_1233.d 0 1 1 15 23 Acetylation (Protein N-term); Carboxylation (E)
R.MGTE(+43.99)VPGDSLGDEFK(+14.02)GYLFK.I Y 16.90 2247.0405 20 -76.4 562.7245 4 84.76 1 45584 AEV 2_3_RA2_01_1224.d 8.98E4 1 1 32 51 Carboxylation (E); Methylation(KR)
R.KFVIR.R N 16.88 661.4275 5 -3.4 331.7199 2 31.48 2 11399 AEV_1_3_RA2_01_1232.d 9.15E4 1 1 155 159
K.ITGGNDK(-.98).Q Y 16.88 702.3660 7 -82.1 703.3156 1 94.82 1 53025 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 52 58 Amidation
MKLNIS(+79.96)YPAN(+.98)GSQK.L Y 16.79 1630.7330 14 100.3 408.7314 4 63.22 2 28029 AEV_1_3_RA2_01_1232.d 6.89E4 1 1 1 14 Sulfation; Deamidation (NQ)
R.AT(+79.97)K(+43.99)IRKFFGLDPK.D Y 16.72 1643.8436 13 9.0 411.9719 4 62.25 3 34166 AEV_3_3_RA3_01_1233.d 9.82E4 1 1 138 150 Phosphorylation (STY); Carboxylation (DKW)
K.F(+127.06)FGLDPKDDVR.K Y 16.60 1434.7142 11 15.9 479.2530 3 65.71 3 36840 AEV_3_3_RA3_01_1233.d 2.09E5 1 1 144 154 N-Succinimidyl-2-morpholine acetate
K.LNIS(-18.01)YPANGSQK.L Y 16.47 1272.6462 12 -63.3 425.1958 3 77.49 1 39847 AEV 2_3_RA2_01_1224.d 6.93E4 1 1 3 14 Dehydration
K.ITGGND(-18.01)K.Q Y 16.40 685.3395 7 -84.9 686.2886 1 85.22 1 45957 AEV 2_3_RA2_01_1224.d 8.22E4 1 1 52 58 Dehydration
K.GYLFK(+21.98).I Y 16.36 648.3247 5 1.4 649.3329 1 66.79 2 30508 AEV_1_3_RA2_01_1232.d 5.39E4 1 1 47 51 Sodium adduct
R.RTVTGKNGKEYTK.A Y 16.33 1480.7998 13 21.8 371.2153 4 43.93 3 21877 AEV_3_3_RA3_01_1233.d 0 1 1 160 172
K.FFGLDPK(+14.02).D Y 16.26 836.4432 7 2.4 419.2299 2 75.27 2 36821 AEV_1_3_RA2_01_1232.d 1.04E5 1 1 144 150 Methylation(KR)
K.IR(+80.99)KFFGLDPK.D Y 16.23 1300.6927 10 -14.3 326.1758 4 27.72 3 12084 AEV_3_3_RA3_01_1233.d 9.41E4 1 1 141 150 Arginine replacement by Nitropyrimidyl ornithine
K.FFGLDPKDDVR(+14.02)K(+43.01).F Y 16.22 1492.7673 12 38.7 374.2136 4 42.88 3 21208 AEV_3_3_RA3_01_1233.d 0 1 1 144 155 Methylation(KR); Carbamylation
R.ASSIR(+31.99).K Y 16.14 564.2867 5 -20.5 565.2825 1 23.49 3 9700 AEV_3_3_RA3_01_1233.d 1.25E4 1 1 232 236 Dihydroxy
R.A(+42.01)ESAK(+21.98).E Y 16.08 568.2469 5 -174.2 569.1552 1 19.85 1 4737 AEV 2_3_RA2_01_1224.d 7.72E3 1 1 199 203 Acetylation (N-term); Sodium adduct
K.QGVLVPT(+79.97)R.V Y 16.04 948.4794 8 -104.6 475.1974 2 37.69 1 13104 AEV 2_3_RA2_01_1224.d 0 1 1 65 72 Phosphorylation (STY)
R.LLLSD(+14.02)GHSC(+57.02)YRPR.R Y 15.96 1586.7987 13 -1.6 397.7063 4 58.14 3 31045 AEV_3_3_RA3_01_1233.d 1.56E5 1 1 75 87 Methylation(others); Carbamidomethylation
K.I(+43.01)TGGNDK.Q Y 15.88 746.3558 7 -50.8 374.1662 2 38.31 1 13452 AEV 2_3_RA2_01_1224.d 0 1 1 52 58 Carbamylation
K.RMGTEVP(+31.99)GDSLGDEFK(+42.01).G Y 15.85 1810.8043 16 10.8 453.7133 4 70.62 1 34436 AEV 2_3_RA2_01_1224.d 4.6E4 1 1 31 46 Dihydroxy; Acetylation (K)
K.L(+42.01)NISYPANGS(+79.97)QKLIEIDDERK.L Y 15.79 2524.2209 21 2.1 632.0638 4 80.13 3 48165 AEV_3_3_RA3_01_1233.d 0 1 1 3 23 Acetylation (Protein N-term); Phosphorylation (STY)
R.T(+43.01)GERK.R Y 15.73 632.3242 5 -18.1 317.1636 2 49.99 1 20253 AEV 2_3_RA2_01_1224.d 0 1 1 89 93 Carbamylation
MKLN(+.98)ISYPANGSQ(+.98)K.L Y 15.73 1551.7603 14 6.9 518.2643 3 66.36 3 37352 AEV_3_3_RA3_01_1233.d 1.78E5 1 1 1 14 Deamidation (NQ)
K.FF(+31.99)GLDPK.D Y 15.72 854.4174 7 -36.2 428.2005 2 56.19 1 23945 AEV 2_3_RA2_01_1224.d 0 1 1 144 150 Dihydroxy
R.LVT(+79.97)PQR.L Y 15.49 792.3895 6 -94.2 397.1647 2 29.35 1 8640 AEV 2_3_RA2_01_1224.d 0 1 1 179 184 Phosphorylation (STY)
K.RLGPK.R N 15.32 569.3649 5 1.7 570.3731 1 10.64 3 2835 AEV_3_3_RA3_01_1233.d 3.55E4 1 1 132 136
R.M(-4.99)GTEVPGDSLGDEFK.G Y 15.31 1575.7164 15 -1.1 788.8646 2 73.48 2 35482 AEV_1_3_RA2_01_1232.d 8.22E4 1 1 32 46 Methionine replacement by azido homoalanine
R.IALKR.R N 15.29 599.4119 5 3.5 300.7143 2 16.40 2 4916 AEV_1_3_RA2_01_1232.d 3.87E5 1 1 192 196
R.M(+42.01)GTEVPGDSLGDEFKGYLFK.I Y 15.09 2231.0457 20 2.0 744.6907 3 81.58 3 49274 AEV_3_3_RA3_01_1233.d 0 1 1 32 51 Acetylation (N-term)
K.LNISYPANGSQK(+14.02).L Y 15.08 1304.6725 12 10.8 327.1789 4 15.75 3 5531 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 3 14 Methylation(KR)
M(+42.01)K(+14.02)LNISYPANGSQK.L Y 15.08 1605.8185 14 -16.3 536.2714 3 43.12 2 17019 AEV_1_3_RA2_01_1232.d 9.06E4 1 1 1 14 Acetylation (Protein N-term); Methylation(KR)
R.TVTGKNGK(+27.99).E Y 15.08 831.4450 8 19.7 416.7380 2 39.61 2 15281 AEV_1_3_RA2_01_1232.d 0 1 1 161 168 Formylation
K.Q(+42.01)GVLVPT(+79.97)R.V Y 15.06 990.4899 8 -35.5 496.2347 2 65.00 1 30169 AEV 2_3_RA2_01_1224.d 5.46E4 1 1 65 72 Acetylation (N-term); Phosphorylation (STY)
R.M(+71.04)GTEVPGDSLGDEFKGYLFK.I Y 15.06 2260.0720 20 -19.7 566.0142 4 78.99 3 47278 AEV_3_3_RA3_01_1233.d 0 1 1 32 51 Propionamide (K, X@N-term)
total 223 peptides
C1GMV8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.LLQLAGVHDIYTSSSGSTK.T Y 169.54 1976.0215 19 4.0 989.0220 2 73.21 2 35304 AEV_1_3_RA2_01_1232.d 5.64E6 9 9 194 212
R.GYWGSNLGEPHSLPTKESGK.C Y 143.64 2143.0334 20 6.4 536.7690 4 65.18 2 29381 AEV_1_3_RA2_01_1232.d 1.02E6 4 4 149 168
K.RLLQLAGVHDIYTSSSGSTK.T Y 129.58 2132.1226 20 -4.3 534.0356 4 69.83 3 40095 AEV_3_3_RA3_01_1233.d 1.75E6 6 6 193 212
K.AVVVIGDSEGHVGLGIK.T Y 127.46 1648.9148 17 1.9 550.6466 3 73.44 2 35451 AEV_1_3_RA2_01_1232.d 8.84E5 6 6 107 123
K.LIRSPLDEFGDVLR.E Y 121.43 1628.8885 14 4.3 543.9725 3 82.16 2 42275 AEV_1_3_RA2_01_1232.d 2.21E6 7 7 242 255
R.GYWGSNLGEPHSLPTK.E Y 120.35 1741.8423 16 1.4 581.6222 3 69.30 2 32321 AEV_1_3_RA2_01_1232.d 3.38E6 8 8 149 164
K.TLENTLKATFVAVANTYSFLTPNLWK.E Y 110.14 2941.5588 26 1.0 981.5278 3 97.37 3 58130 AEV_3_3_RA3_01_1233.d 2.96E5 2 2 213 238
K.TLENTLKATFVAVANTYSFLTPNLWKETK.L Y 107.35 3299.7441 29 0.9 825.9441 4 93.90 3 56744 AEV_3_3_RA3_01_1233.d 3.07E5 3 3 213 241
K.ATFVAVANTYSFLTPNLWK.E Y 101.17 2142.1150 19 3.0 1072.0680 2 89.68 3 54541 AEV_3_3_RA3_01_1233.d 1.11E6 7 7 220 238
R.SPLDEFGDVLR.E Y 100.60 1246.6193 11 6.9 624.3212 2 81.90 2 42107 AEV_1_3_RA2_01_1232.d 3.87E6 5 5 245 255
K.SEEKEWQPVTK.L Y 96.85 1359.6670 11 0.6 680.8412 2 37.38 3 17857 AEV_3_3_RA3_01_1233.d 3.64E6 13 13 37 47
R.SPLDEFGDVLREGK.K Y 96.36 1560.7783 14 5.4 521.2695 3 79.90 2 40534 AEV_1_3_RA2_01_1232.d 4.09E5 3 3 245 258
R.RGYWGSNLGEPHSLPTK.E Y 94.61 1897.9435 17 8.0 475.4969 4 64.19 3 35644 AEV_3_3_RA3_01_1233.d 3.68E5 3 3 148 164
R.SPLDEFGDVLREGKKY Y 94.15 1851.9366 16 -0.8 618.3190 3 78.53 3 46917 AEV_3_3_RA3_01_1233.d 7.41E5 4 4 245 260
K.ATFVAVANTYSFLTPNLWKETK.L Y 92.12 2500.3000 22 2.7 1251.1606 2 85.83 3 52259 AEV_3_3_RA3_01_1233.d 1.85E5 2 2 220 241
R.FKAVVVIGDSEGHVGLGIK.T Y 90.70 1924.0781 19 7.0 482.0302 4 75.54 2 37027 AEV_1_3_RA2_01_1232.d 6.28E5 5 5 105 123
K.ISNMEQIYLHSLPIKEYQIVDFFLPNLKDEVMK.I Y 88.99 3994.0623 33 4.1 799.8230 5 91.19 3 55358 AEV_3_3_RA3_01_1233.d 8.77E5 2 2 57 89
K.LIRSPLDEFGDVLREGK.K Y 88.52 1943.0476 17 -2.0 486.7682 4 80.22 3 48243 AEV_3_3_RA3_01_1233.d 4.82E5 4 4 242 258
R.GTGLVASPAVKR.L Y 87.52 1154.6771 12 0.6 578.3462 2 42.02 2 16509 AEV_1_3_RA2_01_1232.d 1.33E7 16 16 182 193
R.LLQLAGVHDIYTSSSGSTK(+14.02).T Y 84.74 1990.0371 19 -1.6 664.3519 3 73.17 3 42794 AEV_3_3_RA3_01_1233.d 9.15E5 5 5 194 212 Methylation(KR)
R.RGPKSEEKEWQPVTK.L Y 82.89 1797.9373 15 0.8 450.4919 4 31.22 3 14094 AEV_3_3_RA3_01_1233.d 2.03E6 6 6 33 47
K.EVATAIRAAIIIAKLSVLPVRR.G Y 79.79 2359.4790 22 3.0 590.8788 4 86.29 3 52567 AEV_3_3_RA3_01_1233.d 2.35E5 3 3 127 148
K.ESGKC(+57.02)GSVTVR.L Y 77.83 1178.5714 11 0.8 590.2935 2 14.66 3 4940 AEV_3_3_RA3_01_1233.d 9.09E5 6 6 165 175 Carbamidomethylation
R.SPLDE(+14.02)FGDVLR.E Y 77.55 1260.6350 11 3.2 631.3268 2 84.48 2 43956 AEV_1_3_RA2_01_1232.d 5.65E5 2 2 245 255 Methylation(others)
K.TSKEVATAIR.A Y 75.96 1074.6033 10 -0.3 538.3088 2 22.87 3 9394 AEV_3_3_RA3_01_1233.d 2.81E6 13 13 124 133
R.GTGLVASPAVK.R Y 72.92 998.5760 11 3.6 500.2971 2 52.37 2 21653 AEV_1_3_RA2_01_1232.d 4.37E6 13 13 182 192
K.LIRSPLDE(+14.02)FGDVLR.E Y 71.40 1642.9042 14 -1.2 548.6414 3 84.12 3 51100 AEV_3_3_RA3_01_1233.d 3.7E5 2 2 242 255 Methylation(others)
R.SPLDEFGDVLR(+14.02).E Y 71.06 1260.6350 11 2.0 631.3260 2 83.95 2 43579 AEV_1_3_RA2_01_1232.d 9.63E5 3 3 245 255 Methylation(KR)
R.GYWGSNLGE(+14.02)PHSLPTK.E Y 70.25 1755.8580 16 3.2 586.2952 3 72.45 2 34694 AEV_1_3_RA2_01_1232.d 3.46E5 3 3 149 164 Methylation(others)
R.GY(-2.02)WGSNLGEPHSLPTKESGK.C Y 70.18 2141.0178 20 13.3 536.2689 4 64.51 3 35887 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 149 168 2-amino-3-oxo-butanoic_acid
K.LIRSPLDEFGDVLR(+14.02).E Y 69.55 1642.9042 14 3.4 548.6439 3 83.78 2 43477 AEV_1_3_RA2_01_1232.d 9.42E4 1 1 242 255 Methylation(KR)
R.LLQ(+.98)LAGVHDIYTSSSGSTK.T Y 68.38 1977.0055 19 7.5 660.0140 3 72.81 3 42431 AEV_3_3_RA3_01_1233.d 1.63E6 2 2 194 212 Deamidation (NQ)
K.C(+57.02)GSVTVR.L Y 67.00 777.3803 7 6.0 389.6998 2 16.49 2 4960 AEV_1_3_RA2_01_1232.d 2.95E5 3 3 169 175 Carbamidomethylation
K.EYQIVDFFLPNLKDEVMK.I Y 66.53 2227.1235 18 10.1 743.3893 3 89.14 3 54232 AEV_3_3_RA3_01_1233.d 1.31E4 1 1 72 89
R.GPKSEEKEWQPVTK.L Y 65.53 1641.8362 14 2.0 548.2871 3 33.97 3 15737 AEV_3_3_RA3_01_1233.d 4.77E5 2 2 34 47
K.LIRSPLDEFGDVLR(+14.02)EGK.K Y 64.88 1957.0632 17 -2.1 490.2720 4 82.09 3 49661 AEV_3_3_RA3_01_1233.d 1.53E5 2 2 242 258 Methylation(KR)
R.SPLDEFGDVLREGK(+14.02).K Y 64.23 1574.7939 14 -2.2 525.9374 3 81.54 3 49241 AEV_3_3_RA3_01_1233.d 1.1E5 2 2 245 258 Methylation(KR)
K.EVATAIRAAIIIAKLSVLPVR.R Y 61.97 2203.3779 21 -8.3 551.8472 4 89.30 3 54331 AEV_3_3_RA3_01_1233.d 5.14E4 1 1 127 147
R.GYWGSNLGEPHSLPTK(+14.02)ESGK.C Y 59.87 2157.0491 20 16.5 720.0355 3 66.48 3 37443 AEV_3_3_RA3_01_1233.d 0 1 1 149 168 Methylation(KR)
K.SEEK(+14.02)EWQPVTK.L Y 58.72 1373.6826 11 2.7 458.9027 3 45.94 3 23145 AEV_3_3_RA3_01_1233.d 8.73E5 4 4 37 47 Methylation(KR)
R.GYWGSNLGEPHSLPTK(+14.02).E Y 58.26 1755.8580 16 3.3 586.2952 3 71.02 2 33610 AEV_1_3_RA2_01_1232.d 0 1 1 149 164 Methylation(KR)
K.LIRSPLDEFGDVLREGKK(+163.05).Y Y 57.82 2234.1880 18 9.9 559.5598 4 79.34 3 47549 AEV_3_3_RA3_01_1233.d 5.52E5 3 3 242 259 Phenethyl isothiocyanate
R.GTGLVASPAVKRLLQLAGVHDIYTSSSGSTK.T Y 57.27 3112.6880 31 2.9 623.5467 5 83.41 2 43180 AEV_1_3_RA2_01_1232.d 1.33E5 2 2 182 212
R.SPLDEFGDVLR(+14.02)EGK.K Y 57.26 1574.7939 14 5.6 525.9415 3 82.20 2 42278 AEV_1_3_RA2_01_1232.d 1.18E5 1 1 245 258 Methylation(KR)
K.SEEKEWQ(+.98)PVTK.L Y 56.94 1360.6510 11 -2.0 681.3314 2 41.51 3 20338 AEV_3_3_RA3_01_1233.d 1.52E5 2 2 37 47 Deamidation (NQ)
R.LLQLAGVHD(+14.02)IYTSSSGSTK.T Y 55.86 1990.0371 19 -9.0 664.3470 3 75.30 2 36858 AEV_1_3_RA2_01_1232.d 2.47E5 2 2 194 212 Methylation(others)
K.TLENTLKATFVAVANTYS(-2.02)FLTPNLWK.E Y 55.25 2939.5432 26 9.4 980.8643 3 97.43 3 58158 AEV_3_3_RA3_01_1233.d 8.11E4 1 1 213 238 2-amino-3-oxo-butanoic_acid
R.GYW(+15.99)GSNLGEPHSLPTK.E Y 54.95 1757.8373 16 9.1 586.9584 3 66.02 3 37080 AEV_3_3_RA3_01_1233.d 2.26E5 2 2 149 164 Oxidation (HW)
K.C(+58.01)GSVTVR.L Y 54.65 778.3643 7 2.6 390.1904 2 22.08 2 7251 AEV_1_3_RA2_01_1232.d 1.27E6 8 8 169 175 Carboxymethyl
K.LSVLPVRR.G Y 54.47 938.6025 8 -1.7 470.3077 2 58.04 2 24658 AEV_1_3_RA2_01_1232.d 3.47E6 10 10 141 148
R.LLQLAGVHDIYTSSSGSTKTLENTLK.A Y 54.16 2775.4653 26 -1.2 926.1613 3 77.75 3 46303 AEV_3_3_RA3_01_1233.d 1.75E4 1 1 194 219
R.AAIIIAKLSVLPVRR.G Y 54.07 1619.0609 15 -21.8 405.7637 4 75.57 3 44577 AEV_3_3_RA3_01_1233.d 0 1 1 134 148
R.GT(-2.02)GLVASPAVKRLLQLAGVHDIYTSSSGSTK.T Y 53.60 3110.6724 31 1.6 623.1428 5 82.78 3 50155 AEV_3_3_RA3_01_1233.d 0 1 1 182 212 2-amino-3-oxo-butanoic_acid
K.AVVVIGDSE(+14.02)GHVGLGIK.T Y 53.42 1662.9304 17 1.5 555.3182 3 75.78 2 37239 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 107 123 Methylation(others)
R.GTGLVASPAVKR(+14.02).L Y 52.87 1168.6927 12 -32.8 585.3345 2 44.27 3 22096 AEV_3_3_RA3_01_1233.d 0 2 2 182 193 Methylation(KR)
K.TLENTLK.A Y 52.74 817.4545 7 -1.7 409.7338 2 32.85 3 15059 AEV_3_3_RA3_01_1233.d 4.66E6 9 9 213 219
K.E(+316.20)VATAIRAAIIIAKLSVLPVRR.G Y 52.08 2675.6829 22 -20.2 536.1331 5 86.26 3 52548 AEV_3_3_RA3_01_1233.d 1.94E5 1 1 127 148 Levuglandinyl-lysine pyrrole adduct
K.IKPVQKQTR.A Y 51.34 1096.6716 9 -4.3 549.3408 2 10.91 2 2810 AEV_1_3_RA2_01_1232.d 1.19E5 4 4 90 98
K.TLE(+37.96)NTLKATFVAVANTYSFLTPNLWKETK.L Y 50.62 3337.7000 29 10.6 835.4411 4 85.79 3 52232 AEV_3_3_RA3_01_1233.d 3.87E5 1 1 213 241 Replacement of proton by potassium
R.LIPAPR.G Y 50.24 665.4224 6 4.0 333.7198 2 38.82 2 14933 AEV_1_3_RA2_01_1232.d 4.15E6 10 10 176 181
R.GTGLVASPAVK(+14.02)R.L Y 48.81 1168.6927 12 -0.2 585.3535 2 47.47 2 19177 AEV_1_3_RA2_01_1232.d 6.16E5 5 5 182 193 Methylation(KR)
K.C(+57.02)GSVTVR(+14.02).L Y 46.36 791.3960 7 0.0 396.7053 2 26.51 3 11428 AEV_3_3_RA3_01_1233.d 2.29E5 1 1 169 175 Carbamidomethylation; Methylation(KR)
R.G(+41.03)TGLVASPAVKR.L Y 46.19 1195.7036 12 -16.1 399.5687 3 42.20 2 16586 AEV_1_3_RA2_01_1232.d 5.26E4 1 1 182 193 Amidination of lysines or N-terminal amines with methyl acetimidate
K.LIRSPLDEFGDVLREGK(+14.02).K Y 44.37 1957.0632 17 -6.9 490.2697 4 82.44 2 42458 AEV_1_3_RA2_01_1232.d 1.44E5 1 1 242 258 Methylation(KR)
K.LSVLPVR.R Y 44.13 782.5014 7 4.1 392.2596 2 65.90 2 29906 AEV_1_3_RA2_01_1232.d 1.39E6 5 5 141 147
R.GGAR(+28.03)GGFGSR.G Y 43.48 948.4889 10 11.0 475.2570 2 15.49 3 5388 AEV_3_3_RA3_01_1233.d 6.27E5 3 3 7 16 Dimethylation(KR)
R.SPLD(+14.02)EFGDVLR.E Y 42.26 1260.6350 11 2.7 631.3265 2 80.68 2 41105 AEV_1_3_RA2_01_1232.d 1.95E5 1 1 245 255 Methylation(others)
K.ISNMEQIYLHSLPIKEYQIVDFFLPNLKDEVM(+15.99)K.I Y 42.13 4010.0571 33 -3.5 803.0159 5 90.74 2 47589 AEV_1_3_RA2_01_1232.d 3.14E5 1 1 57 89 Oxidation (M)
K.EVATAIR.A Y 41.47 758.4286 7 4.7 380.2234 2 27.43 2 9561 AEV_1_3_RA2_01_1232.d 1.47E6 4 4 127 133
K.TLENTLK(+71.04).A Y 41.41 888.4916 7 2.4 445.2542 2 48.42 2 19658 AEV_1_3_RA2_01_1232.d 1.18E6 4 4 213 219 Propionamide (K, X@N-term)
R.GYWGSNLGE(+14.02)PHSLPTKESGK.C Y 41.20 2157.0491 20 -0.4 540.2693 4 67.31 3 38122 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 149 168 Methylation(others)
R.AAIIIAK.L Y 40.32 698.4690 7 -2.5 350.2409 2 43.37 3 21506 AEV_3_3_RA3_01_1233.d 4.05E6 10 10 134 140
R.LLQLAGVHDIYTSSSGST(-18.01)K.T Y 37.04 1958.0109 19 0.7 980.0134 2 83.67 2 43388 AEV_1_3_RA2_01_1232.d 1.94E5 1 1 194 212 Dehydration
R.GYWGSN(+.98)LGEPHSLPTKESGK.C Y 36.38 2144.0173 20 12.3 537.0182 4 65.10 2 29324 AEV_1_3_RA2_01_1232.d 8.26E4 1 1 149 168 Deamidation (NQ)
K.IKPVQK.Q Y 35.84 711.4643 6 3.8 356.7408 2 10.41 2 2627 AEV_1_3_RA2_01_1232.d 5.01E5 2 2 90 95
K.T(+42.01)SKEVATAIR.A Y 35.63 1116.6139 10 24.4 373.2210 3 22.96 3 9418 AEV_3_3_RA3_01_1233.d 0 1 1 124 133 Acetylation (N-term)
K.ISNM(+15.99)EQIYLHSLPIKEYQIVDFFLPNLKDEVMK.I Y 34.38 4010.0571 33 11.4 803.0278 5 90.03 2 47245 AEV_1_3_RA2_01_1232.d 1.4E5 1 1 57 89 Oxidation (M)
K.L(+42.01)IRSPLDEFGDVLR.E Y 34.07 1670.8992 14 0.3 557.9738 3 82.30 2 42351 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 242 255 Acetylation (N-term)
R.SPLDEFGDVLR(+14.02)EGKKY Y 32.42 1865.9523 16 -7.0 622.9870 3 80.38 3 48433 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 245 260 Methylation(KR)
K.ATFVAVANTYSFLTP(+31.99)NLWK.E Y 31.15 2174.1047 19 -3.9 1088.0554 2 86.70 2 45433 AEV_1_3_RA2_01_1232.d 1.24E5 2 2 220 238 Dihydroxy
K.E(+14.02)SGKC(+57.02)GSVTVR.L Y 30.49 1192.5870 11 2.1 597.3021 2 18.15 3 6841 AEV_3_3_RA3_01_1233.d 3.01E4 1 1 165 175 Methylation(others); Carbamidomethylation
R.G(+27.99)GARGGFGSR.G Y 30.39 948.4525 10 -49.5 317.1425 3 32.72 1 10482 AEV 2_3_RA2_01_1224.d 5.58E5 3 3 7 16 Formylation (Protein N-term)
K.TSK(+14.02)EVAT(-18.01)AIR.A Y 29.79 1070.6084 10 -28.3 357.8666 3 23.10 3 9495 AEV_3_3_RA3_01_1233.d 0 1 1 124 133 Methylation(KR); Dehydration
K.TLENTLK(+172.05).A Y 29.35 989.5070 7 -2.6 495.7595 2 48.08 3 24532 AEV_3_3_RA3_01_1233.d 0 1 1 213 219 Menadione hydroquinone derivative
R.SP(+13.98)LDEFGDVLR.E Y 29.31 1260.5986 11 -63.4 631.2666 2 88.99 1 48869 AEV 2_3_RA2_01_1224.d 6.14E5 1 1 245 255 Proline oxidation to pyroglutamic acid
K.TSKE(+14.02)VATAIR.A Y 29.25 1088.6189 10 -27.3 545.3019 2 29.87 3 13314 AEV_3_3_RA3_01_1233.d 8.58E4 3 3 124 133 Methylation(others)
R.RGYWGSNLGEPHS(-18.01)LPTK(+14.02)ESGK.C Y 28.96 2295.1396 21 -8.2 574.7875 4 60.81 3 33033 AEV_3_3_RA3_01_1233.d 4.31E4 1 1 148 168 Dehydration; Methylation(KR)
R.GGAR(+28.03)GGFGSRGDR.G Y 28.71 1276.6384 13 3.2 426.5548 3 15.11 3 5228 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 7 19 Dimethylation(KR)
MADTPRGGAR.G Y 28.25 1030.4978 10 12.1 516.2624 2 33.82 1 11100 AEV 2_3_RA2_01_1224.d 5.59E4 4 4 1 10
R.GT(+79.97)GLVASPAVKR(+14.02).L Y 27.55 1248.6591 12 9.6 417.2310 3 47.60 2 19238 AEV_1_3_RA2_01_1232.d 3.03E5 1 1 182 193 Phosphorylation (STY); Methylation(KR)
R.LLQ(+.98)LAGVHDIYTSSSGSTK(+14.02).T Y 27.39 1991.0211 19 6.5 664.6853 3 74.71 3 43905 AEV_3_3_RA3_01_1233.d 4.43E4 1 1 194 212 Deamidation (NQ); Methylation(KR)
K.ESGKC(+57.02)GSVTVR(+14.02).L Y 27.33 1192.5870 11 -0.2 597.3007 2 22.75 3 9303 AEV_3_3_RA3_01_1233.d 3.26E4 1 1 165 175 Carbamidomethylation; Methylation(KR)
K.TLENTLK(+14.02).A Y 26.32 831.4702 7 -88.3 416.7057 2 63.19 1 28921 AEV 2_3_RA2_01_1224.d 1.82E5 1 1 213 219 Methylation(KR)
K.LIRSPLDEFGDVLR(-.98)(+14.02).E Y 26.07 1641.9202 14 -54.7 548.2841 3 83.45 3 50635 AEV_3_3_RA3_01_1233.d 1.33E5 2 2 242 255 Amidation; Methylation(KR)
R.GGFGSR(+31.99).G Y 25.86 611.2663 6 -35.6 612.2518 1 73.47 1 36665 AEV 2_3_RA2_01_1224.d 0 1 1 11 16 Dihydroxy
R.GYWGSN(+.98)LGEPHSLPTKESGK(+14.02).C Y 25.44 2158.0330 20 -1.8 540.5145 4 64.36 3 35771 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 149 168 Deamidation (NQ); Methylation(KR)
R.GGAR(+14.02)GGFGSRGDR.G Y 25.19 1262.6228 13 -2.5 421.8805 3 14.18 3 4670 AEV_3_3_RA3_01_1233.d 6.51E4 1 1 7 19 Methylation(KR)
R.RGPKSEEK(+14.02)EWQPVTK.L Y 25.16 1811.9529 15 5.9 604.9951 3 38.71 3 18642 AEV_3_3_RA3_01_1233.d 5.95E4 1 1 33 47 Methylation(KR)
K.EWQPVTK.L Y 25.11 886.4548 7 10.0 444.2391 2 39.84 3 19306 AEV_3_3_RA3_01_1233.d 4.62E5 2 2 41 47
K.ISNMEQIYLHSLPIK.E Y 25.01 1784.9495 15 0.5 595.9907 3 79.23 2 39951 AEV_1_3_RA2_01_1232.d 6.54E4 1 1 57 71
K.EVAT(+79.96)AIR.A Y 24.81 838.3854 7 48.4 420.2203 2 61.04 3 33213 AEV_3_3_RA3_01_1233.d 0 1 1 127 133 Sulfation
R.G(+42.01)GARGGFGSRGDR.G Y 23.58 1290.6177 13 15.6 646.3262 2 46.96 2 18917 AEV_1_3_RA2_01_1232.d 0 1 1 7 19 Acetylation (Protein N-term)
M.A(+42.01)DTPR(+28.03)GGAR.G Y 23.51 969.4991 9 0.9 485.7573 2 18.99 3 7289 AEV_3_3_RA3_01_1233.d 1.53E6 2 2 2 10 Acetylation (Protein N-term); Dimethylation(KR)
R.GGFGSRGDR.G Y 23.23 907.4260 9 6.9 454.7234 2 12.39 2 3385 AEV_1_3_RA2_01_1232.d 1.91E5 2 2 11 19
R.GTGLVASPAVK(+170.04).R Y 22.88 1168.6128 11 -18.7 390.5376 3 62.74 1 28584 AEV 2_3_RA2_01_1224.d 1.99E5 1 1 182 192 Menadione quinone derivative
K.IK(+31.99)PVQKQ(+.98)TRAGQR.T Y 22.84 1541.8638 13 -2.8 514.9604 3 23.25 3 9569 AEV_3_3_RA3_01_1233.d 5.7E4 1 1 90 102 Dihydroxy; Deamidation (NQ)
R.G(+42.01)TGLVASPAVK.R Y 21.98 1040.5865 11 12.3 347.8737 3 36.00 3 16932 AEV_3_3_RA3_01_1233.d 0 1 1 182 192 Acetylation (N-term)
R.LIPAPR(+21.98).G Y 21.72 687.4044 6 4.8 688.4149 1 98.26 2 50441 AEV_1_3_RA2_01_1232.d 0 1 1 176 181 Sodium adduct
K.LIRS(-2.02)PLDEFGDVLREGK.K Y 21.63 1941.0319 17 27.7 486.2787 4 80.72 2 41133 AEV_1_3_RA2_01_1232.d 0 1 1 242 258 2-amino-3-oxo-butanoic_acid
R.AAIIIAK(+14.02).L Y 21.54 712.4847 7 -28.1 357.2396 2 55.21 3 29070 AEV_3_3_RA3_01_1233.d 0 1 1 134 140 Methylation(KR)
K.IKPVQ(+.98)K.Q Y 21.36 712.4483 6 -98.5 357.1964 2 25.55 1 6807 AEV 2_3_RA2_01_1224.d 6.46E4 1 1 90 95 Deamidation (NQ)
K.IKPVQK(+14.02).Q Y 20.65 725.4799 6 4.6 363.7489 2 14.59 2 4183 AEV_1_3_RA2_01_1232.d 4.37E4 1 1 90 95 Methylation(KR)
R.G(+42.01)GFGS(+79.97)RGDRGGDR.G Y 20.34 1414.5739 13 -26.1 708.2758 2 47.35 1 18690 AEV 2_3_RA2_01_1224.d 1.09E4 1 1 11 23 Acetylation (Protein N-term); Phosphorylation (STY)
K.ESGK(+14.02)C(+57.02)GSVTVR.L Y 20.33 1192.5870 11 0.1 398.5363 3 18.22 3 6873 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 165 175 Methylation(KR); Carbamidomethylation
R.GGARGGFGS(-18.01)R.G Y 19.93 902.4471 10 4.0 903.4579 1 94.57 2 49181 AEV_1_3_RA2_01_1232.d 8.98E4 1 1 7 16 Dehydration
R.L(+149.03)LQLAGVHDIYTSSSGSTK.T Y 19.13 2125.0513 19 6.1 532.2733 4 69.92 3 40163 AEV_3_3_RA3_01_1233.d 0 1 1 194 212 Benzyl isothiocyanate
K.LSVLPVR(+14.02).R Y 19.02 796.5170 7 -22.3 399.2569 2 70.60 2 33300 AEV_1_3_RA2_01_1232.d 0 1 1 141 147 Methylation(KR)
R.G(+42.01)RGRGR(+21.98).R Y 18.89 721.3708 6 4.7 722.3815 1 75.73 2 37177 AEV_1_3_RA2_01_1232.d 5.14E3 1 1 24 29 Acetylation (N-term); Sodium adduct
K.SEEK(+14.02)EWQ(+.98)PVTK.L Y 18.74 1374.6666 11 -2.9 688.3386 2 50.07 3 25785 AEV_3_3_RA3_01_1233.d 1.43E5 1 1 37 47 Methylation(KR); Deamidation (NQ)
R.GGFGSR(+14.02).G Y 18.65 593.2921 6 -4.7 594.2966 1 48.71 3 24902 AEV_3_3_RA3_01_1233.d 0 1 1 11 16 Methylation(KR)
K.E(+14.02)VATAIR.A Y 18.42 772.4443 7 25.4 387.2392 2 32.58 3 14916 AEV_3_3_RA3_01_1233.d 0 1 1 127 133 Methylation(others)
K.EYQIVDFFLPNLKDEVM(+15.99)K.I Y 17.99 2243.1184 18 32.6 748.7378 3 82.10 2 42207 AEV_1_3_RA2_01_1232.d 1.84E4 1 1 72 89 Oxidation (M)
R.SPLDEFGDVLREGK(+14.02)KY Y 17.78 1865.9523 16 1.2 467.4959 4 80.56 3 48498 AEV_3_3_RA3_01_1233.d 2.25E5 1 1 245 260 Methylation(KR)
R.GGFGS(-18.01)R.G Y 17.74 561.2659 6 -46.6 562.2471 1 33.29 1 10793 AEV 2_3_RA2_01_1224.d 5.74E4 2 2 11 16 Dehydration
K.T(+42.01)SK(+14.02)EVATAIR.A Y 17.66 1130.6295 10 -52.8 377.8639 3 35.34 3 16538 AEV_3_3_RA3_01_1233.d 2.93E5 2 2 124 133 Acetylation (N-term); Methylation(KR)
K.DEVMK(+14.02)IKPVQ(+.98)K.Q Y 17.52 1328.7373 11 -16.3 333.1862 4 49.72 3 25556 AEV_3_3_RA3_01_1233.d 0 1 1 85 95 Methylation(KR); Deamidation (NQ)
R.RGYWGSNLGEPHSLPTK(-.98).E Y 17.36 1896.9595 17 -7.3 633.3225 3 65.32 2 29482 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 148 164 Amidation
K.Q(+27.99)TRAGQRTR.F Y 17.14 1100.5798 9 18.4 367.8740 3 70.94 3 40961 AEV_3_3_RA3_01_1233.d 4.17E4 1 1 96 104 Formylation
R.G(+42.01)GFGS(-18.01)R.G Y 17.12 603.2765 6 2.1 604.2850 1 16.61 3 6004 AEV_3_3_RA3_01_1233.d 0 1 1 11 16 Acetylation (Protein N-term); Dehydration
R.GGFGSR(+28.03)GDR.G Y 17.05 935.4573 9 3.5 312.8275 3 15.37 3 5337 AEV_3_3_RA3_01_1233.d 1.92E5 1 1 11 19 Dimethylation(KR)
R.GY(-2.02)WGSNLGEPHSLPTK.E Y 16.83 1739.8267 16 29.2 580.9664 3 69.68 2 32615 AEV_1_3_RA2_01_1232.d 8.1E4 1 1 149 164 2-amino-3-oxo-butanoic_acid
R.GGAR(+14.02)GGFGSR.G Y 16.82 934.4733 10 31.2 468.2585 2 29.40 3 13041 AEV_3_3_RA3_01_1233.d 2.18E4 2 2 7 16 Methylation(KR)
K.DEVMK.I Y 16.65 620.2839 5 -26.0 621.2751 1 67.98 1 32421 AEV 2_3_RA2_01_1224.d 0 1 1 85 89
R.G(+27.99)TGLVASPAVK.R Y 16.61 1026.5709 11 -11.1 343.1938 3 24.59 3 10343 AEV_3_3_RA3_01_1233.d 0 1 1 182 192 Formylation
R.G(+42.01)GARGGFGSR(+28.03)GDR.G Y 16.49 1318.6490 13 7.1 440.5601 3 19.38 3 7510 AEV_3_3_RA3_01_1233.d 0 1 1 7 19 Acetylation (Protein N-term); Dimethylation(KR)
R.SPLDE(+14.02)FGDVLREGKKY Y 16.19 1865.9523 16 -3.2 467.4939 4 80.90 2 41276 AEV_1_3_RA2_01_1232.d 1.95E5 1 1 245 260 Methylation(others)
R.GTGLVASP(+13.98)AVK.R Y 16.09 1012.5553 11 -54.7 507.2572 2 68.73 1 32997 AEV 2_3_RA2_01_1224.d 6.08E4 1 1 182 192 Proline oxidation to pyroglutamic acid
R.LIPAPR(+28.03).G Y 15.85 693.4537 6 14.8 694.4713 1 99.39 2 50836 AEV_1_3_RA2_01_1232.d 2.32E4 1 1 176 181 Dimethylation(KR)
K.ESGKC(+57.02)GSVT(+79.97)VR.L Y 15.80 1258.5377 11 76.9 630.3245 2 64.71 2 29054 AEV_1_3_RA2_01_1232.d 3.68E4 1 1 165 175 Carbamidomethylation; Phosphorylation (STY)
R.G(+42.01)GFGSR(+14.02)GDRGGDR.G Y 15.79 1348.6232 13 4.9 675.3221 2 54.67 2 22836 AEV_1_3_RA2_01_1232.d 0 1 1 11 23 Acetylation (Protein N-term); Methylation(KR)
K.EWQPVTK(+31.99).L Y 15.54 918.4447 7 2.4 919.4542 1 74.39 3 43656 AEV_3_3_RA3_01_1233.d 2.8E4 1 1 41 47 Dihydroxy
R.GGAR(+14.02)GGFGS(+79.96)R.G Y 15.02 1014.4301 10 56.8 508.2512 2 27.84 2 9744 AEV_1_3_RA2_01_1232.d 0 1 1 7 16 Methylation(KR); Sulfation
total 142 peptides
C1GLI9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.LYVTAEPLNEEVSKDIESGK.I Y 144.61 2220.1162 20 1.5 741.0471 3 76.27 2 37634 AEV_1_3_RA2_01_1232.d 6.89E5 5 5 574 593
R.FIEPIEDVPAGNILGLVGVDQFLLK.S Y 140.75 2695.4836 25 1.9 1348.7517 2 97.49 3 58194 AEV_3_3_RA3_01_1233.d 2.7E5 3 3 429 453
K.KFLPAADALMEMMVLHLPSPVTAQK.Y Y 127.33 2737.4368 25 2.8 685.3684 4 91.59 2 47991 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 314 338
R.AFNQFILDPIFK.I Y 123.01 1451.7812 12 4.6 726.9012 2 87.25 2 45782 AEV_1_3_RA2_01_1232.d 1.26E6 5 5 260 271
K.FLPAADALMEMMVLHLPSPVTAQK.Y Y 118.80 2609.3418 24 3.6 653.3451 4 94.76 2 49268 AEV_1_3_RA2_01_1232.d 9.44E5 6 6 315 338
R.ALLELQVTKEDLYQSFSR.T Y 116.66 2139.1211 18 -17.7 714.0350 3 81.83 2 42046 AEV_1_3_RA2_01_1232.d 0 1 1 152 169
K.YRAETLYEGPPDDEAC(+57.02)IGIR.D Y 111.02 2324.0742 20 7.8 775.7047 3 73.20 3 42743 AEV_3_3_RA3_01_1233.d 2.75E5 2 2 339 358 Carbamidomethylation
K.AYLPVNESFGFTADLR.G Y 107.31 1798.8889 16 0.1 900.4518 2 83.95 2 43577 AEV_1_3_RA2_01_1232.d 9.26E5 6 6 758 773
R.LYVTAEPLNEEVSKDIESGKIGPR.D Y 106.99 2643.3755 24 5.2 661.8546 4 77.88 2 38876 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 574 597
R.AFNQFILDPIFKIFNAITHSK.T Y 104.18 2463.3313 21 2.8 616.8418 4 97.35 2 50110 AEV_1_3_RA2_01_1232.d 2.29E5 3 3 260 280
K.NGEYEGKPLER.A Y 102.11 1290.6204 11 4.3 646.3203 2 29.56 2 10546 AEV_1_3_RA2_01_1232.d 1.24E6 13 13 249 259
R.KGIKEVVPGVDNYYDKL Y 98.86 1936.0305 17 -1.7 485.0141 4 73.39 2 35411 AEV_1_3_RA2_01_1232.d 5.23E5 3 3 815 831
K.FSVSPVVQR.S Y 96.12 1017.5607 9 2.5 509.7889 2 63.44 2 28184 AEV_1_3_RA2_01_1232.d 1.18E6 5 5 471 479
R.TIESVNVIIATYFDKALGDVQVYPYK.G Y 95.61 2945.5425 26 2.9 737.3950 4 94.35 2 49103 AEV_1_3_RA2_01_1232.d 2.19E5 4 4 170 195
R.AETLYEGPPDDEAC(+57.02)IGIR.D Y 93.89 2004.9098 18 0.2 1003.4624 2 75.54 3 44553 AEV_3_3_RA3_01_1233.d 1.38E5 2 2 341 358 Carbamidomethylation
K.YRAETLYEGPPDDEAC(+57.02)IGIRDC(+57.02)DPK.A Y 92.80 2939.3064 25 2.1 735.8354 4 70.13 3 40325 AEV_3_3_RA3_01_1233.d 8.54E4 1 1 339 363 Carbamidomethylation
K.ALGDVQVYPYK.G Y 91.50 1251.6499 11 0.7 626.8326 2 70.03 2 32869 AEV_1_3_RA2_01_1232.d 5.49E5 3 3 185 195
R.KIWC(+57.02)FGPDTTGANLLVDQTK.A Y 90.64 2263.1306 20 -1.3 755.3832 3 80.53 3 48476 AEV_3_3_RA3_01_1233.d 4.72E5 3 3 620 639 Carbamidomethylation
R.AETLYEGPPDDEAC(+57.02)IGIRDC(+57.02)DPK.A Y 90.63 2620.1421 23 -1.0 874.3871 3 71.58 3 41468 AEV_3_3_RA3_01_1233.d 2.78E5 2 2 341 363 Carbamidomethylation
R.LYVTAEPLNEEVSK.D Y 89.24 1590.8141 14 0.6 796.4148 2 70.93 3 40955 AEV_3_3_RA3_01_1233.d 1.44E5 2 2 574 587
R.IQGPNYTPGRKEDLYIK.A Y 89.24 1991.0476 17 6.0 498.7722 4 63.00 2 27885 AEV_1_3_RA2_01_1232.d 6.54E5 4 4 401 417
K.SGTLTTSETAHNLK.V Y 88.51 1458.7314 14 0.6 487.2514 3 34.55 3 16050 AEV_3_3_RA3_01_1233.d 2.52E6 10 10 454 467
R.GHVFAEEQRPGTPLFNVK.A Y 86.00 2025.0431 18 0.3 507.2682 4 69.07 2 32155 AEV_1_3_RA2_01_1232.d 5.03E5 3 3 740 757
K.STAISLYAHLPDEEDLKDIPQK.V Y 85.26 2482.2590 22 15.4 621.5816 4 78.01 2 38983 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 60 81
R.ILADEHGWDVTDAR.K Y 83.25 1596.7532 14 -1.0 533.2578 3 67.46 3 38223 AEV_3_3_RA3_01_1233.d 3.93E5 6 6 606 619
K.GIKEVVPGVDNYYDKL Y 82.77 1807.9355 16 7.0 603.6567 3 77.14 2 38286 AEV_1_3_RA2_01_1232.d 2.98E5 3 3 816 831
K.AVQYLHEIKDSVVSGFQWATR.E Y 81.90 2433.2441 21 3.9 609.3207 4 82.80 2 42728 AEV_1_3_RA2_01_1232.d 1.39E5 1 1 640 660
K.IWC(+57.02)FGPDTTGANLLVDQTK.A Y 80.79 2135.0356 19 -2.0 1068.5229 2 84.36 3 51275 AEV_3_3_RA3_01_1233.d 1.28E5 2 2 621 639 Carbamidomethylation
R.TIESVNVIIATYFDK.A Y 79.66 1711.9032 15 1.0 856.9597 2 88.62 3 53966 AEV_3_3_RA3_01_1233.d 1.28E5 2 2 170 184
R.LWGDNYFNPK.T Y 78.81 1252.5876 10 0.5 627.3014 2 76.50 2 37783 AEV_1_3_RA2_01_1232.d 8.79E5 4 4 233 242
R.AFNQFILD(+14.02)PIFK.I Y 77.68 1465.7969 12 3.4 733.9082 2 89.15 2 46802 AEV_1_3_RA2_01_1232.d 3.27E4 1 1 260 271 Methylation(others)
K.EDLYQSFSR.T Y 73.64 1143.5197 9 20.6 572.7789 2 66.50 2 30310 AEV_1_3_RA2_01_1232.d 2.48E5 2 2 161 169
K.N(+.98)GEYEGKPLER.A Y 72.65 1291.6044 11 0.4 646.8097 2 37.27 3 17752 AEV_3_3_RA3_01_1233.d 2.29E6 11 11 249 259 Deamidation (NQ)
R.EGPIAEEPM(+15.99)R.S Y 71.74 1143.5229 10 3.1 572.7705 2 38.47 3 18496 AEV_3_3_RA3_01_1233.d 1.8E5 1 1 661 670 Oxidation (M)
R.IKPVC(+57.02)IINKVDR.A Y 71.49 1453.8439 12 -3.9 364.4668 4 59.17 3 31796 AEV_3_3_RA3_01_1233.d 7.42E5 2 2 140 151 Carbamidomethylation
R.AFNQFILDPIFK(+14.02).I Y 71.21 1465.7969 12 4.4 733.9089 2 88.17 3 53704 AEV_3_3_RA3_01_1233.d 1.77E4 1 1 260 271 Methylation(KR)
R.IQGPNYTPGR.K Y 68.17 1101.5566 10 8.0 551.7900 2 46.15 2 18505 AEV_1_3_RA2_01_1232.d 1.59E6 7 7 401 410
R.SVEVKNANDLPK.L Y 66.05 1312.6986 12 22.3 657.3712 2 40.04 3 19425 AEV_3_3_RA3_01_1233.d 3.53E5 7 7 480 491
K.AYLPVNESFGFTADLR(+14.02).G Y 65.09 1812.9045 16 3.2 907.4624 2 85.26 3 51875 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 758 773 Methylation(KR)
K.FLPAADALM(+15.99)EMMVLHLPSPVTAQK.Y Y 64.13 2625.3369 24 0.4 657.3417 4 90.76 2 47600 AEV_1_3_RA2_01_1232.d 0 1 1 315 338 Oxidation (M)
K.SGTLTTSETAHNLK(+14.02).V Y 61.23 1472.7471 14 0.3 737.3810 2 45.41 3 22825 AEV_3_3_RA3_01_1233.d 3.47E4 1 1 454 467 Methylation(KR)
K.LTAEEKEQEGKPLLK.S Y 60.47 1711.9355 15 3.5 428.9927 4 40.31 3 19581 AEV_3_3_RA3_01_1233.d 5.44E5 4 4 295 309
R.FIE(+14.02)PIEDVPAGNILGLVGVDQFLLK.S Y 58.90 2709.4993 25 -5.5 1355.7495 2 97.62 2 50230 AEV_1_3_RA2_01_1232.d 2.19E4 1 1 429 453 Methylation(others)
R.GGGQIIPTAR.R N 58.52 968.5403 10 1.0 485.2779 2 47.12 3 23924 AEV_3_3_RA3_01_1233.d 1.34E6 8 8 689 698
R.VFAGTVR.S Y 53.64 748.4232 7 -88.2 375.1859 2 51.03 1 20835 AEV 2_3_RA2_01_1224.d 2.19E6 11 11 388 394
R.ETVGDKSSITALSK.S Y 53.43 1434.7566 14 -7.6 718.3801 2 52.11 2 21524 AEV_1_3_RA2_01_1232.d 8.2E5 5 5 553 566
R.EGPIAEEPMR.S Y 52.09 1127.5281 10 5.8 564.7746 2 54.12 2 22557 AEV_1_3_RA2_01_1232.d 3.1E5 1 1 661 670
R.FTDTRQDEQDRC(+57.02)ITIK.S Y 51.94 2024.9585 16 -0.8 675.9929 3 49.62 3 25500 AEV_3_3_RA3_01_1233.d 1.09E6 3 3 44 59 Carbamidomethylation
R.FTDTRQDEQDR.C Y 51.20 1409.6171 11 0.2 705.8160 2 17.29 3 6373 AEV_3_3_RA3_01_1233.d 2.71E4 1 1 44 54
K.APLMLYVSK.M Y 50.62 1020.5677 9 -5.7 511.2882 2 70.93 3 40952 AEV_3_3_RA3_01_1233.d 4.83E5 3 3 364 372
K.YRAETLYE(+14.02)GPPDDEAC(+57.02)IGIR.D Y 48.58 2338.0898 20 3.2 780.3730 3 75.23 3 44307 AEV_3_3_RA3_01_1233.d 8.12E4 1 1 339 358 Methylation(others); Carbamidomethylation
R.VSDPVVSYR.E Y 48.48 1020.5240 9 -87.4 511.2247 2 62.77 1 28604 AEV 2_3_RA2_01_1224.d 7.98E5 4 4 544 552
K.FSVSPVVQ(+.98)R.S Y 48.07 1018.5447 9 -1.6 510.2788 2 64.86 2 29154 AEV_1_3_RA2_01_1232.d 0 1 1 471 479 Deamidation (NQ)
K.EQEGKPLLK.S Y 46.43 1040.5865 9 -26.8 521.2866 2 23.61 2 7890 AEV_1_3_RA2_01_1232.d 8E4 2 2 301 309
K.NGEYEGKPLER(+14.02).A Y 43.78 1304.6360 11 4.7 653.3283 2 36.71 2 13875 AEV_1_3_RA2_01_1232.d 2.56E5 2 2 249 259 Methylation(KR)
R.ALLELQVTK.E Y 43.13 1013.6121 9 -14.6 507.8059 2 71.88 2 34307 AEV_1_3_RA2_01_1232.d 0 1 1 152 160
R.FYAFGR.V Y 42.85 759.3704 6 -3.0 380.6913 2 62.05 3 34001 AEV_3_3_RA3_01_1233.d 1.15E6 6 6 382 387
K.NGEYE(+14.02)GKPLER.A Y 41.97 1304.6360 11 0.1 653.3253 2 35.52 3 16693 AEV_3_3_RA3_01_1233.d 2.01E5 2 2 249 259 Methylation(others)
K.SGTLTTSE(+14.02)TAHNLK.V Y 41.45 1472.7471 14 -22.6 737.3641 2 44.73 3 22384 AEV_3_3_RA3_01_1233.d 0 1 1 454 467 Methylation(others)
K.NANDLPKLVEGLK(+42.02)R.L Y 41.37 1607.9106 14 13.0 402.9902 4 68.15 3 38771 AEV_3_3_RA3_01_1233.d 1.52E5 1 1 485 498 Guanidination
R.FIEPIEDVPAGNILGLVGVDQFLLK(-.98).S Y 40.93 2694.4995 25 -11.7 1348.2412 2 97.52 2 50180 AEV_1_3_RA2_01_1232.d 0 1 1 429 453 Amidation
R.KIWC(+57.02)FGPDTTGANLLVDQT(-18.01)K(+14.02).A Y 39.80 2259.1357 20 -20.3 754.0372 3 80.59 3 48526 AEV_3_3_RA3_01_1233.d 0 1 1 620 639 Carbamidomethylation; Dehydration; Methylation(KR)
R.LYVTAEPLNEEVSK(+14.02)DIESGKIGPR.D Y 38.95 2657.3911 24 4.3 665.3579 4 78.97 2 39742 AEV_1_3_RA2_01_1232.d 9.81E4 1 1 574 597 Methylation(KR)
R.AGIISAAK.A Y 37.81 729.4385 8 0.2 730.4459 1 32.35 2 11802 AEV_1_3_RA2_01_1232.d 5.98E5 4 4 31 38
K.M(+15.99)VPTSDKGR.F Y 37.63 1005.4913 9 -87.9 336.1416 3 21.25 1 5135 AEV 2_3_RA2_01_1224.d 2.24E5 4 4 373 381 Oxidation (M)
K.APLM(+15.99)LYVSK.M Y 37.11 1036.5626 9 -6.0 519.2855 2 65.53 3 36693 AEV_3_3_RA3_01_1233.d 4.2E4 1 1 364 372 Oxidation (M)
R.LYVTAEPLNE(+14.02)EVSKDIESGKIGPR.D Y 36.96 2657.3911 24 -2.7 665.3533 4 78.63 3 47026 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 574 597 Methylation(others)
R.LYVTAEPLNEEVSK(+14.02)DIESGK.I Y 36.86 2234.1318 20 4.8 745.7214 3 77.78 2 38797 AEV_1_3_RA2_01_1232.d 1.17E5 2 2 574 593 Methylation(KR)
K.MVPTSDKGR.F Y 35.98 989.4964 9 -0.8 330.8391 3 13.42 3 4267 AEV_3_3_RA3_01_1233.d 1.61E5 2 2 373 381
K.WTKN(+.98)GEYEGKPLER.A Y 35.10 1706.8263 14 9.5 427.7179 4 46.15 2 18509 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 246 259 Deamidation (NQ)
K.EVVPGVDNYYDKL Y 34.68 1509.7351 13 -2.0 755.8734 2 77.57 3 46161 AEV_3_3_RA3_01_1233.d 2.5E5 2 2 819 831
R.IK(-1.03)PVC(+57.02)IINKVDR.A Y 33.86 1452.8123 12 5.4 485.2806 3 61.16 2 26631 AEV_1_3_RA2_01_1232.d 0 2 2 140 151 Lysine oxidation to aminoadipic semialdehyde; Carbamidomethylation
R.FIEPIEDVPAGN(+15.00)ILGLVGVDQFLLK.S Y 32.80 2710.4832 25 -13.5 904.4895 3 97.63 3 58262 AEV_3_3_RA3_01_1233.d 2.97E4 1 1 429 453 Deamidation followed by a methylation
K.NGE(+14.02)YEGKPLER.A Y 32.68 1304.6360 11 1.9 653.3265 2 35.85 3 16851 AEV_3_3_RA3_01_1233.d 1.36E5 2 2 249 259 Methylation(others)
R.AFN(+.98)QFILDPIFK.I Y 31.97 1452.7653 12 12.8 727.3992 2 88.96 2 46702 AEV_1_3_RA2_01_1232.d 0 1 1 260 271 Deamidation (NQ)
R.GGGQIIPTARR.V N 31.65 1124.6414 11 -16.2 563.3188 2 35.73 3 16770 AEV_3_3_RA3_01_1233.d 1.95E5 2 2 689 699
R.ALLELQVTK(+14.02)EDLYQSFSR.T Y 30.99 2153.1367 18 -9.7 718.7125 3 82.79 3 50163 AEV_3_3_RA3_01_1233.d 1.65E5 1 1 152 169 Methylation(KR)
R.AFNQ(+.98)FILDPIFK.I Y 30.71 1452.7653 12 -99.8 727.3174 2 94.01 1 52540 AEV 2_3_RA2_01_1224.d 4.76E4 1 1 260 271 Deamidation (NQ)
R.IQ(+.98)GPNYTPGR.K Y 30.39 1102.5406 10 17.4 552.2872 2 47.85 2 19360 AEV_1_3_RA2_01_1232.d 0 1 1 401 410 Deamidation (NQ)
K.FLPAADALME(+14.02)MMVLHLPSPVTAQK.Y Y 30.23 2623.3577 24 6.2 656.8508 4 95.79 2 49609 AEV_1_3_RA2_01_1232.d 7.48E4 1 1 315 338 Methylation(others)
R.SGLKVR.I Y 29.67 658.4126 6 -13.4 330.2092 2 14.48 2 4140 AEV_1_3_RA2_01_1232.d 3.36E4 1 1 395 400
R.AETLYE(+14.02)GPPDDEAC(+57.02)IGIRDC(+57.02)DPK.A Y 29.65 2634.1577 23 -11.2 879.0500 3 73.63 3 43068 AEV_3_3_RA3_01_1233.d 6.29E4 1 1 341 363 Methylation(others); Carbamidomethylation
K.NANDLPK.L Y 29.63 770.3922 7 21.7 771.4162 1 65.96 2 29919 AEV_1_3_RA2_01_1232.d 5.6E5 3 3 485 491
K.WTK(+14.02)N(+.98)GEYEGKPLER.A Y 29.32 1720.8420 14 65.9 431.2462 4 38.68 2 14833 AEV_1_3_RA2_01_1232.d 0 1 1 246 259 Methylation(KR); Deamidation (NQ)
R.AGIIS(+79.96)AAK(+14.02).A Y 28.57 823.4109 8 8.0 824.4248 1 87.04 3 53021 AEV_3_3_RA3_01_1233.d 1.23E5 2 2 31 38 Sulfation; Methylation(KR)
K.WTKNGEYEGKPLER.A Y 27.98 1705.8423 14 43.4 342.1906 5 16.46 2 4934 AEV_1_3_RA2_01_1232.d 0 1 1 246 259
R.ETVGD(-18.01)K.S Y 26.90 629.3021 6 7.5 630.3141 1 52.36 2 21649 AEV_1_3_RA2_01_1232.d 0 1 1 553 558 Dehydration
R.QDEQ(+.98)D(-18.01)RC(+57.02)ITIK.S Y 26.84 1387.6401 11 2.7 694.8292 2 54.71 2 22859 AEV_1_3_RA2_01_1232.d 7.3E4 1 1 49 59 Deamidation (NQ); Dehydration; Carbamidomethylation
R.S(+42.01)VEVKNANDLPK(+43.01).L Y 26.56 1397.7150 12 -19.4 699.8512 2 78.54 3 46932 AEV_3_3_RA3_01_1233.d 5.8E4 1 1 480 491 Acetylation (N-term); Carbamylation
K.DIPQK.V Y 26.12 599.3279 5 -33.7 600.3149 1 98.73 2 50598 AEV_1_3_RA2_01_1232.d 0 1 1 77 81
R.AFNQFILDP(+13.98)IFK.I Y 26.09 1465.7605 12 -68.9 733.8370 2 95.09 1 53197 AEV 2_3_RA2_01_1224.d 1.79E5 2 2 260 271 Proline oxidation to pyroglutamic acid
K.VMKFSVSPVVQR.S Y 25.89 1375.7645 12 -26.2 344.9394 4 52.11 3 27160 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 468 479
R.GHVFAEEQR(+14.02)PGT(-18.01)PLFNVK.A Y 25.59 2021.0482 18 -41.4 506.2484 4 67.81 3 38502 AEV_3_3_RA3_01_1233.d 5.9E4 1 1 740 757 Methylation(KR); Dehydration
K.M(+15.99)VPTSDK.G Y 25.26 792.3688 7 42.6 793.4098 1 91.07 2 47748 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 373 379 Oxidation (M)
K.SSITALSK.S Y 25.18 805.4545 8 -88.8 403.6988 2 48.75 1 19492 AEV 2_3_RA2_01_1224.d 2.5E5 1 1 559 566
K.SGTLTTSETAHN(+.98)LK.V Y 24.92 1459.7155 14 -74.0 487.5431 3 52.71 1 21787 AEV 2_3_RA2_01_1224.d 1.51E5 1 1 454 467 Deamidation (NQ)
R.A(+43.01)GIISAAKAGEAR.F Y 24.87 1256.6836 13 -57.5 315.1601 4 61.59 1 27676 AEV 2_3_RA2_01_1224.d 0 1 1 31 43 Carbamylation
K.AGEARFTD(-18.01)TR.Q Y 24.85 1104.5311 10 -87.7 369.1520 3 37.05 1 12733 AEV 2_3_RA2_01_1224.d 3.21E5 1 1 39 48 Dehydration
R.V(+27.99)SDPVVSYR.E Y 24.59 1048.5189 9 3.5 525.2686 2 32.12 3 14650 AEV_3_3_RA3_01_1233.d 5.59E4 1 1 544 552 Formylation
R.VSDPVVSYRETVGDKSSITALSK.S Y 24.21 2437.2700 23 1.0 610.3254 4 70.17 2 32974 AEV_1_3_RA2_01_1232.d 8.48E4 1 1 544 566
R.ETVGD(-18.01)KSSITALSK.S Y 24.02 1416.7460 14 11.9 709.3887 2 83.14 3 50408 AEV_3_3_RA3_01_1233.d 0 1 1 553 566 Dehydration
R.A(+226.08)GIISAAK(+42.01).A Y 23.95 997.5266 8 -3.8 499.7687 2 48.35 2 19673 AEV_1_3_RA2_01_1232.d 3.05E4 1 1 31 38 Biotinylation; Acetylation (K)
K.G(+42.01)IKEVVPGVDNY(+79.97)Y(+79.97)DK.L Y 23.49 1896.7947 15 -14.9 633.2628 3 62.35 1 28269 AEV 2_3_RA2_01_1224.d 1.54E5 1 1 816 830 Acetylation (N-term); Phosphorylation (STY)
K.DSVVSGFQWATR.E Y 23.38 1351.6521 12 -113.1 338.8821 4 44.85 1 17206 AEV 2_3_RA2_01_1224.d 0 1 1 649 660
R.QALGER.I Y 23.25 672.3555 6 2.5 673.3644 1 102.47 1 56537 AEV 2_3_RA2_01_1224.d 3.68E5 2 2 134 139
R.IQGPN(-17.03)YTPGR.K Y 23.13 1084.5302 10 -42.3 543.2494 2 58.58 1 25487 AEV 2_3_RA2_01_1224.d 2.15E5 1 1 401 410 Ammonia-loss (N)
K.YR(+14.02)AETLYEGPPDDEAC(+57.02)IGIRDC(+57.02)DPK.A Y 22.98 2953.3220 25 6.6 739.3427 4 72.52 2 34751 AEV_1_3_RA2_01_1232.d 9.78E4 1 1 339 363 Methylation(KR); Carbamidomethylation
R.LWGDN(+.98)YFN(+.98)PK.T Y 22.91 1254.5557 10 -58.3 628.2485 2 81.45 1 42975 AEV 2_3_RA2_01_1224.d 1.78E4 1 1 233 242 Deamidation (NQ)
R.ETVGDK.S Y 22.83 647.3126 6 -22.2 648.3055 1 98.09 3 58427 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 553 558
R.GGGQIIPT(+79.97)AR(+14.02).R N 22.83 1062.5223 10 14.2 355.1864 3 39.17 2 15070 AEV_1_3_RA2_01_1232.d 2.1E5 1 1 689 698 Phosphorylation (STY); Methylation(KR)
R.VFAGTVR(+14.02).S Y 22.30 762.4388 7 -6.5 382.2242 2 51.07 2 20991 AEV_1_3_RA2_01_1232.d 4.02E4 2 2 388 394 Methylation(KR)
K.A(+28.03)GEAR.F N 22.18 530.2812 5 -9.7 531.2834 1 62.11 2 27265 AEV_1_3_RA2_01_1232.d 0 1 1 39 43 Ethylation
R.EGPIAEEPM(+15.99)RSVR.F Y 21.99 1485.7245 13 1.1 496.2493 3 40.82 3 19893 AEV_3_3_RA3_01_1233.d 0 1 1 661 673 Oxidation (M)
K.AVQYLHEIK(+31.99).D Y 21.82 1131.5924 9 -1.7 378.2041 3 54.69 3 28805 AEV_3_3_RA3_01_1233.d 2.04E5 1 1 640 648 Dihydroxy
K.LVEGLK.R N 21.74 657.4061 6 -154.6 658.3118 1 46.10 1 17931 AEV 2_3_RA2_01_1224.d 8.37E5 2 2 492 497
R.A(+127.06)GIISAAKAGEAR.F Y 21.56 1340.7412 13 13.8 336.1972 4 53.50 3 28044 AEV_3_3_RA3_01_1233.d 0 1 1 31 43 N-Succinimidyl-2-morpholine acetate
R.Q(+42.01)ALGER(+21.98).I Y 21.56 736.3480 6 -47.7 737.3201 1 72.83 1 36162 AEV 2_3_RA2_01_1224.d 1.31E4 1 1 134 139 Acetylation (N-term); Sodium adduct
K.H(+43.01)NRLYVTAEPLNEEVSK.D Y 21.31 2041.0228 17 -19.2 1021.4991 2 88.26 3 53751 AEV_3_3_RA3_01_1233.d 6.52E4 1 1 571 587 Carbamylation
K.DIESGK(-.98).I Y 21.30 646.3286 6 -127.7 647.2533 1 41.64 1 15351 AEV 2_3_RA2_01_1224.d 0 1 1 588 593 Amidation
R.LYVTAEPLNEEVSKD(+21.98)IES(+79.97)GK.I Y 21.24 2322.0645 20 20.2 775.0444 3 84.47 2 43949 AEV_1_3_RA2_01_1232.d 0 1 1 574 593 Sodium adduct; Phosphorylation (STY)
R.ETVGDKSSITALS(+79.97)K(+21.98).S Y 21.16 1536.7048 14 96.1 385.2204 4 65.23 1 30311 AEV 2_3_RA2_01_1224.d 0 1 1 553 566 Phosphorylation (STY); Sodium adduct
R.Q(+42.01)(+.98)ALGER.I Y 20.98 715.3500 6 -7.4 716.3521 1 55.71 3 29355 AEV_3_3_RA3_01_1233.d 0 1 1 134 139 Acetylation (N-term); Deamidation (NQ)
K.LVEGLK(+31.99).R N 20.90 689.3959 6 -35.7 690.3786 1 98.98 2 50692 AEV_1_3_RA2_01_1232.d 0 1 1 492 497 Dihydroxy
R.GGGQ(+.98)IIPT(+79.97)AR.R N 20.88 1049.4906 10 -16.9 525.7437 2 21.08 2 6841 AEV_1_3_RA2_01_1232.d 0 1 1 689 698 Deamidation (NQ); Phosphorylation (STY)
K.DIPQK(+21.98).V Y 20.66 621.3098 5 7.3 622.3217 1 81.79 3 49434 AEV_3_3_RA3_01_1233.d 0 1 1 77 81 Sodium adduct
R.Q(-17.03)FAVK.Y N 20.52 574.3115 5 -13.2 575.3112 1 56.49 3 29892 AEV_3_3_RA3_01_1233.d 1.91E5 1 1 213 217 Pyro-glu from Q
K.MVPTSDK.G Y 20.26 776.3738 7 15.7 777.3933 1 98.80 3 58664 AEV_3_3_RA3_01_1233.d 2.85E4 1 1 373 379
K.SSITALSKSPNKHNR.L Y 20.06 1638.8801 15 20.5 410.7357 4 67.58 3 38317 AEV_3_3_RA3_01_1233.d 0 1 1 559 573
R.ETVGD(-18.01)K(+14.02)SSITALSK.S Y 19.90 1430.7616 14 -24.3 477.9162 3 50.35 3 25955 AEV_3_3_RA3_01_1233.d 1.41E5 1 1 553 566 Dehydration; Methylation(KR)
R.FTDT(-18.01)R.Q Y 19.83 620.2918 5 41.7 621.3250 1 69.29 3 39686 AEV_3_3_RA3_01_1233.d 3.03E5 1 1 44 48 Dehydration
R.NMSVIAHVDHGK.S Y 19.82 1306.6451 12 0.4 436.5558 3 38.28 3 18360 AEV_3_3_RA3_01_1233.d 2.1E5 1 1 9 20
K.A(+42.01)PLMLYVSK.M Y 19.55 1062.5784 9 2.8 355.2010 3 18.77 2 5895 AEV_1_3_RA2_01_1232.d 0 1 1 364 372 Acetylation (N-term)
R.C(+57.02)(+42.01)ITIK.S Y 19.34 675.3625 5 -117.5 676.2905 1 90.85 1 50234 AEV 2_3_RA2_01_1224.d 9.44E4 1 1 55 59 Carbamidomethylation; Acetylation (N-term)
K.AGEAR.F N 19.26 502.2499 5 -16.6 503.2489 1 51.40 1 20990 AEV 2_3_RA2_01_1224.d 1.09E5 1 1 39 43
K.N(+42.01)ANDLPK.L Y 19.19 812.4028 7 13.4 813.4210 1 97.30 2 50094 AEV_1_3_RA2_01_1232.d 0 1 1 485 491 Acetylation (N-term)
K.AGEARFT(+79.97)DTR.Q Y 18.96 1202.5081 10 60.2 602.2975 2 55.97 2 23519 AEV_1_3_RA2_01_1232.d 0 1 1 39 48 Phosphorylation (STY)
K.AGE(+43.99)ARFT(+79.97)DTR.Q Y 18.69 1246.4979 10 13.3 624.2645 2 52.96 1 21940 AEV 2_3_RA2_01_1224.d 6.15E4 1 1 39 48 Carboxylation (E); Phosphorylation (STY)
R.AGIISAAK(+97.02).A Y 18.64 826.4548 8 -32.7 414.2212 2 47.84 1 19031 AEV 2_3_RA2_01_1224.d 3.82E5 1 1 31 38 Maleimide
R.G(+42.01)GGQIIPTAR.R N 18.63 1010.5508 10 -97.9 337.8246 3 66.35 1 31142 AEV 2_3_RA2_01_1224.d 0 1 1 689 698 Acetylation (N-term)
R.GGGQ(+.98)IIPTAR.R N 18.63 969.5243 10 -24.1 485.7578 2 19.42 3 7527 AEV_3_3_RA3_01_1233.d 1.53E6 1 1 689 698 Deamidation (NQ)
K.TKKWTK(+175.04)NGEYEGKPLER.A Y 18.58 2238.1221 17 5.4 747.0520 3 77.57 2 38625 AEV_1_3_RA2_01_1232.d 1.1E5 1 1 243 259 Naphthalene-2,3-dicarboxaldehyde
R.FYAFGR(+14.02).V Y 18.52 773.3860 6 -92.0 387.6647 2 74.36 1 37354 AEV 2_3_RA2_01_1224.d 5.11E4 1 1 382 387 Methylation(KR)
R.TIESVNVIIATYFDK(+27.99).A Y 18.43 1739.8981 15 -0.4 580.9731 3 77.19 3 45850 AEV_3_3_RA3_01_1233.d 7.28E4 1 1 170 184 Formylation
MDR(+14.02)PANIR.N Y 18.24 985.5127 8 -7.0 329.5092 3 56.99 1 24408 AEV 2_3_RA2_01_1224.d 2.43E5 1 1 1 8 Methylation(KR)
R.ETVGDK(-.98).S Y 17.89 646.3286 6 -68.3 324.1495 2 66.50 1 31258 AEV 2_3_RA2_01_1224.d 3.22E4 1 1 553 558 Amidation
K.S(+42.01)SIT(+79.97)ALSK(+14.02)SPNK.H Y 17.70 1367.6697 12 15.6 456.9043 3 47.22 2 19044 AEV_1_3_RA2_01_1232.d 0 1 1 559 570 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
K.AYLPVN(+.98)ESFGFTADLR.G Y 17.56 1799.8729 16 21.7 900.9633 2 84.96 3 51670 AEV_3_3_RA3_01_1233.d 2.59E4 1 1 758 773 Deamidation (NQ)
R.LWGDN(+.98)YFNPK.T Y 17.42 1253.5717 10 22.4 627.8071 2 77.15 3 45820 AEV_3_3_RA3_01_1233.d 4.22E4 1 1 233 242 Deamidation (NQ)
K.DIESGK(+28.03)IGPR.D Y 17.27 1098.6033 10 -2.4 550.3076 2 34.98 2 13068 AEV_1_3_RA2_01_1232.d 2.57E5 2 2 588 597 Dimethylation(KR)
K.M(+27.99)VPTSDK(+14.02).G Y 17.26 818.3844 7 -52.8 410.1779 2 70.51 1 34355 AEV 2_3_RA2_01_1224.d 0 1 1 373 379 Formylation; Methylation(KR)
R.NK(+42.01)MMERLWGDNYFN(+.98)PK.T Y 17.25 2084.9448 16 -34.2 522.2256 4 77.55 1 39891 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 227 242 Acetylation (K); Deamidation (NQ)
K.GTVAFGSGLHGWAFTVRQFAVKY(+79.97)AK.K Y 17.13 2777.3843 25 -1.7 695.3522 4 64.61 3 35971 AEV_3_3_RA3_01_1233.d 3.66E4 1 1 196 220 Phosphorylation (STY)
R.DDFK(+28.03)AR.A Y 17.10 778.3973 6 -17.0 390.1993 2 13.64 3 4373 AEV_3_3_RA3_01_1233.d 0 1 1 598 603 Dimethylation(KR)
K.EDLYIKAIQR.T Y 17.10 1247.6874 10 -21.6 416.8941 3 42.97 2 16947 AEV_1_3_RA2_01_1232.d 1.63E5 1 1 412 421
K.HNR(+31.99)LYVTAEPLNEEVSK.D Y 17.08 2030.0068 17 -75.3 677.6252 3 94.98 1 53129 AEV 2_3_RA2_01_1224.d 0 1 1 571 587 Dihydroxy
R.IKPVC(+57.02)IINK(+14.02)VDR.A Y 16.89 1467.8595 12 4.3 367.9737 4 63.77 2 28410 AEV_1_3_RA2_01_1232.d 4.24E4 1 1 140 151 Carbamidomethylation; Methylation(KR)
R.KGIKEVVPGVDNYYDKL(-.98) Y 16.60 1935.0465 17 -23.4 646.0077 3 72.45 3 42160 AEV_3_3_RA3_01_1233.d 2.82E4 1 1 815 831 Amidation
K.DIESGK(+27.99)IGPR.D Y 16.19 1098.5669 10 -48.6 550.2640 2 54.07 1 22599 AEV 2_3_RA2_01_1224.d 4.93E5 1 1 588 597 Formylation
K.MVPTSDKGRFYAFGR.V Y 16.13 1730.8562 15 4.0 577.9617 3 74.17 2 36002 AEV_1_3_RA2_01_1232.d 1.27E5 1 1 373 387
K.VMK(+42.01)FSVSPVVQ(+.98)R.S Y 16.13 1418.7592 12 13.1 355.7017 4 47.67 3 24238 AEV_3_3_RA3_01_1233.d 2.47E6 1 1 468 479 Acetylation (K); Deamidation (NQ)
K.AGEARFT(+79.97)DTRQDEQDR.C Y 16.04 1973.8228 16 -4.6 658.9452 3 86.57 1 47017 AEV 2_3_RA2_01_1224.d 3.68E4 1 1 39 54 Phosphorylation (STY)
K.SSITALSK(-.98).S Y 15.84 804.4705 8 -73.4 805.4188 1 80.95 3 48803 AEV_3_3_RA3_01_1233.d 7.18E4 1 1 559 566 Amidation
MDRPANIR.N Y 15.70 971.4971 8 23.0 324.8471 3 28.53 3 12547 AEV_3_3_RA3_01_1233.d 0 1 1 1 8
K.EVVPGVDNYYDK.L Y 15.59 1396.6510 12 -56.0 699.2937 2 93.97 1 52472 AEV 2_3_RA2_01_1224.d 0 1 1 819 830
K.VM(+15.99)KFSVSPVVQR.S Y 15.57 1391.7595 12 45.0 348.9628 4 34.01 2 12597 AEV_1_3_RA2_01_1232.d 0 1 1 468 479 Oxidation (M)
R.IQGPNYTPGR(+14.02).K Y 15.47 1115.5724 10 24.0 372.8737 3 30.39 2 10888 AEV_1_3_RA2_01_1232.d 1.63E4 1 1 401 410 Methylation(KR)
R.SVEVK(+97.02).N Y 15.44 657.3333 5 -19.1 658.3280 1 55.77 3 29396 AEV_3_3_RA3_01_1233.d 0 1 1 480 484 Maleimide
K.AGEARFTDT(+79.97)R.Q Y 15.44 1202.5081 10 -1.3 602.2605 2 77.93 1 40203 AEV 2_3_RA2_01_1224.d 1.1E5 1 1 39 48 Phosphorylation (STY)
K.AGEAR(+21.98).F N 15.41 524.2319 5 -0.8 525.2387 1 27.52 1 7705 AEV 2_3_RA2_01_1224.d 0 1 1 39 43 Sodium adduct
R.AE(+14.02)TLYEGPPDDEAC(+57.02)IGIRDC(+57.02)DPK.A Y 15.28 2634.1577 23 5.9 879.0651 3 74.04 2 35908 AEV_1_3_RA2_01_1232.d 7.39E4 1 1 341 363 Methylation(others); Carbamidomethylation
K.FLPAAD(-18.01)ALMEM(+15.99)MVLHLPSPVTAQK.Y Y 15.05 2607.3262 24 -0.6 870.1155 3 94.74 2 49245 AEV_1_3_RA2_01_1232.d 2.81E4 1 1 315 338 Dehydration; Oxidation (M)
K.EDLYQS(+79.97)FSR(+14.02).T Y 15.05 1237.5016 9 13.2 619.7662 2 9.18 3 2226 AEV_3_3_RA3_01_1233.d 2.26E4 1 1 161 169 Phosphorylation (STY); Methylation(KR)
total 172 peptides
A0A0A0HS69
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VDGYILEGEELAFYQR.A Y 160.30 1900.9207 16 2.7 634.6492 3 84.45 2 43934 AEV_1_3_RA2_01_1232.d 1.75E6 8 8 432 447
K.VRVIVVSYHPSNNELVR.T Y 153.65 1980.0905 17 1.8 496.0308 4 68.19 2 31502 AEV_1_3_RA2_01_1232.d 6.44E5 3 3 325 341
K.SAVVQVDAAPFRQWYEAHYGQTLGR.R Y 153.36 2848.4045 25 3.7 950.4789 3 80.87 2 41269 AEV_1_3_RA2_01_1232.d 4.46E6 8 8 348 372
R.LYAVISSRPGQSGRVDGYILEGEELAFYQR.A Y 142.29 3372.7102 30 3.0 844.1874 4 83.58 2 43306 AEV_1_3_RA2_01_1232.d 1.28E6 4 4 418 447
R.VIVVSYHPSNNELVR.T Y 128.91 1724.9209 15 3.3 863.4706 2 67.73 2 31188 AEV_1_3_RA2_01_1232.d 8.72E6 14 14 327 341
R.FAAQGKVDPALEKQFEAGR.L Y 128.62 2061.0642 19 3.9 516.2753 4 66.38 2 30221 AEV_1_3_RA2_01_1232.d 9.03E5 6 6 399 417
R.Q(-17.03)WYEAHYGQTLGR.R Y 110.72 1590.7216 13 5.0 796.3721 2 75.21 2 36794 AEV_1_3_RA2_01_1232.d 6.51E5 4 4 360 372 Pyro-glu from Q
R.FAAQGKVDPALEK.Q Y 106.19 1372.7350 13 0.9 687.3754 2 53.28 2 22157 AEV_1_3_RA2_01_1232.d 4.3E6 13 13 399 411
R.ALRLESGNFSWGSEGISR.K Y 106.06 1964.9703 18 -1.4 983.4911 2 76.01 3 44928 AEV_3_3_RA3_01_1233.d 1.61E6 6 6 306 323
K.VDPALEKQFEAGR.L Y 102.59 1458.7466 13 -0.9 730.3799 2 61.69 3 33731 AEV_3_3_RA3_01_1233.d 4.92E5 7 7 405 417
R.LESGNFSWGSEGISR.K Y 95.09 1624.7480 15 2.0 813.3829 2 73.88 2 35807 AEV_1_3_RA2_01_1232.d 1.72E6 5 5 309 323
R.LESGNFSWGSEGISRK.V Y 94.11 1752.8430 16 4.9 585.2911 3 66.98 3 37867 AEV_3_3_RA3_01_1233.d 5.41E5 3 3 309 324
R.VDGYILEGEELAFYQRAIRK Y 92.47 2369.2378 20 3.4 593.3187 4 80.90 3 48766 AEV_3_3_RA3_01_1233.d 2.03E5 1 1 432 451
R.VDGYILEGEE(+14.02)LAFYQR.A Y 91.43 1914.9363 16 4.5 639.3223 3 87.13 2 45698 AEV_1_3_RA2_01_1232.d 2.19E5 3 3 432 447 Methylation(others)
R.QWYEAHYGQTLGR.R Y 91.26 1607.7480 13 1.7 536.9242 3 64.78 3 36101 AEV_3_3_RA3_01_1233.d 5.74E5 4 4 360 372
K.VDPALEKQFEAGRLYAVISSRPGQSGR.V Y 91.14 2930.5361 27 -14.2 587.1062 5 77.08 3 45762 AEV_3_3_RA3_01_1233.d 2.92E5 1 1 405 431
K.LGTENTEEKKSK.S Y 90.76 1362.6990 12 6.4 455.2432 3 9.60 2 2355 AEV_1_3_RA2_01_1232.d 8.98E5 9 9 378 389
K.SAVVQVDAAPFR(+14.02)QWYEAHYGQTLGR.R Y 90.18 2862.4202 25 3.2 716.6146 4 80.98 2 41330 AEV_1_3_RA2_01_1232.d 1.28E6 2 2 348 372 Methylation(KR)
R.VDGYILEGE(+14.02)ELAFYQR.A Y 88.32 1914.9363 16 0.7 639.3198 3 87.90 3 53533 AEV_3_3_RA3_01_1233.d 6.79E5 5 5 432 447 Methylation(others)
R.Q(-17.03)QKLGTENTEEKKSK.S Y 87.03 1729.8846 15 3.8 577.6377 3 14.69 3 4935 AEV_3_3_RA3_01_1233.d 2.87E5 4 4 375 389 Pyro-glu from Q
K.SAVVQVDAAPFR.Q Y 85.79 1258.6670 12 2.0 630.3420 2 70.10 2 32951 AEV_1_3_RA2_01_1232.d 1.9E6 4 4 348 359
R.LYAVISSRPGQSGR.V Y 84.73 1489.8000 14 -1.6 497.6065 3 55.12 3 29024 AEV_3_3_RA3_01_1233.d 2.5E6 6 6 418 431
R.AFEKGRQPANTR.I Y 83.18 1373.7163 12 3.5 458.9143 3 14.01 3 4602 AEV_3_3_RA3_01_1233.d 2.54E6 5 5 275 286
R.LE(+14.02)SGNFSWGSEGISR.K Y 81.77 1638.7638 15 -2.5 820.3871 2 75.49 3 44543 AEV_3_3_RA3_01_1233.d 2.56E5 2 2 309 323 Methylation(others)
K.SAVVQVDAAPFRQWYEAHYGQ(+.98)TLGR.R Y 78.04 2849.3884 25 2.0 950.8053 3 80.96 3 48812 AEV_3_3_RA3_01_1233.d 4.43E4 1 1 348 372 Deamidation (NQ)
R.Q(-17.03)QKLGTENTEEKK.S Y 76.41 1514.7576 13 2.8 505.9279 3 19.20 3 7404 AEV_3_3_RA3_01_1233.d 4.88E5 6 6 375 387 Pyro-glu from Q
R.VIVVSYHPSNNELVR(+14.02).T Y 73.79 1738.9366 15 2.0 580.6540 3 70.41 2 33225 AEV_1_3_RA2_01_1232.d 1.62E6 6 6 327 341 Methylation(KR)
K.SAVVQ(+.98)VDAAPFRQWYEAHYGQTLGR.R Y 72.33 2849.3884 25 1.0 713.3551 4 81.36 3 49102 AEV_3_3_RA3_01_1233.d 6.57E5 2 2 348 372 Deamidation (NQ)
R.ALRLESGNFSWGSEGISRK.V Y 72.19 2093.0654 19 -4.1 698.6929 3 71.14 3 41148 AEV_3_3_RA3_01_1233.d 4.03E5 2 2 306 324
R.VIVVSYHPSNN(+.98)ELVR.T Y 71.78 1725.9049 15 5.0 576.3118 3 68.91 2 32028 AEV_1_3_RA2_01_1232.d 2.43E5 1 1 327 341 Deamidation (NQ)
R.LESGNFSWGSEGISR(+14.02).K Y 69.50 1638.7638 15 0.1 820.3893 2 76.79 3 45531 AEV_3_3_RA3_01_1233.d 5.35E5 4 4 309 323 Methylation(KR)
K.LGTENTEEK.K Y 68.05 1019.4771 9 7.2 510.7495 2 15.56 2 4581 AEV_1_3_RA2_01_1232.d 8.55E5 5 5 378 386
K.LGTENTEEKK.S Y 67.81 1147.5720 10 4.1 574.7957 2 11.62 3 3321 AEV_3_3_RA3_01_1233.d 1.39E6 8 8 378 387
R.ALR(+14.02)LESGNFSWGSEGISR.K Y 66.20 1978.9861 18 2.3 660.6708 3 78.25 2 39171 AEV_1_3_RA2_01_1232.d 3.94E5 2 2 306 323 Methylation(KR)
R.Q(-17.03)WYEAHYGQTLGR(+14.02).R Y 64.84 1604.7372 13 9.6 803.3835 2 75.33 3 44386 AEV_3_3_RA3_01_1233.d 7.38E4 2 2 360 372 Pyro-glu from Q; Methylation(KR)
R.Q(-17.03)QKLGTENTEEK.K Y 64.72 1386.6627 12 -0.4 694.3384 2 27.43 3 11924 AEV_3_3_RA3_01_1233.d 1.23E5 3 3 375 386 Pyro-glu from Q
K.LGTENTEEKKSK(+14.02).S Y 63.20 1376.7147 12 4.3 689.3676 2 11.95 3 3479 AEV_3_3_RA3_01_1233.d 1.27E5 2 2 378 389 Methylation(KR)
R.FAAQ(+.98)GKVDPALEKQFEAGR.L Y 62.13 2062.0483 19 9.8 688.3635 3 66.40 2 30237 AEV_1_3_RA2_01_1232.d 1.64E5 2 2 399 417 Deamidation (NQ)
K.LGTENTEEK(+14.02).K Y 62.05 1033.4928 9 -0.5 517.7534 2 23.89 3 9935 AEV_3_3_RA3_01_1233.d 1.05E6 8 8 378 386 Methylation(KR)
K.LGTENTEEK(+14.02)KSK.S Y 60.53 1376.7147 12 -0.2 689.3645 2 12.93 3 4008 AEV_3_3_RA3_01_1233.d 1.1E5 3 3 378 389 Methylation(KR)
K.SAVVQVDAAPFR(+14.02).Q Y 60.46 1272.6826 12 0.0 637.3486 2 73.14 2 35225 AEV_1_3_RA2_01_1232.d 1.63E5 1 1 348 359 Methylation(KR)
R.VIVVSYHPSNNE(+14.02)LVR.T Y 60.33 1738.9366 15 -2.4 580.6514 3 69.36 3 39735 AEV_3_3_RA3_01_1233.d 6.51E5 1 1 327 341 Methylation(others)
K.LGTENTE(+14.02)EKKSK.S Y 60.03 1376.7147 12 0.2 689.3647 2 12.44 3 3731 AEV_3_3_RA3_01_1233.d 6.67E4 2 2 378 389 Methylation(others)
K.SAVVQVDAAPFRQWYEAHY(+125.90)GQTLGR.R Y 59.60 2974.3010 25 0.6 744.5830 4 83.19 3 50448 AEV_3_3_RA3_01_1233.d 3.05E5 2 2 348 372 Iodination
R.VDGYILEGEELAFYQR(+14.02).A Y 59.57 1914.9363 16 4.0 639.3219 3 85.23 2 44473 AEV_1_3_RA2_01_1232.d 3.54E5 4 4 432 447 Methylation(KR)
R.QQKLGTENTEEKK.S Y 59.42 1531.7842 13 3.6 511.6038 3 12.04 3 3518 AEV_3_3_RA3_01_1233.d 9.92E4 3 3 375 387
R.FAAQ(+.98)GKVDPALEK.Q Y 59.18 1373.7190 13 -1.2 687.8660 2 55.47 3 29240 AEV_3_3_RA3_01_1233.d 2.18E5 2 2 399 411 Deamidation (NQ)
R.VIVVSYHPSN(+.98)NELVR.T Y 58.07 1725.9049 15 -6.1 576.3054 3 68.94 3 39409 AEV_3_3_RA3_01_1233.d 4.51E5 4 4 327 341 Deamidation (NQ)
R.LESGNFSW(+31.99)GSEGISR.K Y 58.00 1656.7379 15 2.0 829.3779 2 65.52 2 29624 AEV_1_3_RA2_01_1232.d 9.79E4 1 1 309 323 Dihydroxy
R.FAAQGKVDPALEKQFEAGR(+14.02).L Y 57.16 2075.0798 19 6.6 519.7806 4 68.42 2 31672 AEV_1_3_RA2_01_1232.d 8.07E5 2 2 399 417 Methylation(KR)
K.VDPALEKQFE(+14.02)AGR.L Y 57.15 1472.7623 13 2.3 491.9292 3 64.78 3 36103 AEV_3_3_RA3_01_1233.d 2.42E5 1 1 405 417 Methylation(others)
K.SAVVQ(+.98)VDAAPFR(+14.02)QWYEAHYGQTLGR.R Y 56.91 2863.4041 25 4.2 716.8613 4 81.33 3 49080 AEV_3_3_RA3_01_1233.d 2.19E5 1 1 348 372 Deamidation (NQ); Methylation(KR)
R.LESGNFSW(+15.99)GSEGISR.K Y 54.96 1640.7430 15 -3.0 821.3763 2 70.25 3 40424 AEV_3_3_RA3_01_1233.d 2.34E5 5 5 309 323 Oxidation (HW)
R.F(+42.01)AAQGKVDPALEK.Q Y 54.31 1414.7456 13 -6.7 472.5860 3 51.08 3 26431 AEV_3_3_RA3_01_1233.d 1.43E5 1 1 399 411 Acetylation (N-term)
R.ALRLESGN(+.98)FSWGSEGISRK.V Y 53.67 2094.0493 19 10.5 524.5251 4 71.09 3 41078 AEV_3_3_RA3_01_1233.d 1.43E4 1 1 306 324 Deamidation (NQ)
K.VDPALEK.Q Y 52.68 770.4174 7 -87.5 386.1823 2 36.25 1 12350 AEV 2_3_RA2_01_1224.d 1.59E6 5 5 405 411
R.FAAQGK(+14.02).V Y 52.42 634.3438 6 -1.0 635.3505 1 16.92 2 5120 AEV_1_3_RA2_01_1232.d 3.48E5 4 4 399 404 Methylation(KR)
K.LGTENTEEK(+14.02)K.S Y 52.38 1161.5876 10 2.7 388.2042 3 16.63 3 6008 AEV_3_3_RA3_01_1233.d 5.53E5 5 5 378 387 Methylation(KR)
K.GRQPANTR.I Y 52.05 898.4733 8 1.6 450.2446 2 7.71 2 1809 AEV_1_3_RA2_01_1232.d 4.06E3 1 1 279 286
K.LGTENTEEKK(+14.02).S Y 50.92 1161.5876 10 -3.6 581.7990 2 16.35 2 4888 AEV_1_3_RA2_01_1232.d 9.55E5 5 5 378 387 Methylation(KR)
K.SVEKKQAVR.F Y 50.27 1043.6086 9 -4.0 522.8095 2 9.28 3 2260 AEV_3_3_RA3_01_1233.d 2.06E3 1 1 390 398
R.FAAQGKVDPALEK(+14.02).Q Y 49.92 1386.7506 13 1.1 463.2580 3 59.47 2 25541 AEV_1_3_RA2_01_1232.d 4.3E5 3 3 399 411 Methylation(KR)
R.VDGYILEGE(+28.03)ELAFYQR.A Y 49.18 1928.9519 16 12.8 643.9995 3 92.09 2 48208 AEV_1_3_RA2_01_1232.d 4.02E4 1 1 432 447 Ethylation
R.F(+41.03)AAQGKVDPALEK.Q Y 49.10 1413.7616 13 -48.8 472.2382 3 51.07 3 26437 AEV_3_3_RA3_01_1233.d 0 1 1 399 411 Amidination of lysines or N-terminal amines with methyl acetimidate
K.SAVVQ(+.98)VDAAPFR.Q Y 46.68 1259.6510 12 -2.7 630.8311 2 71.02 3 41027 AEV_3_3_RA3_01_1233.d 1.78E5 2 2 348 359 Deamidation (NQ)
R.AFEKGRQ(+.98)PANTR.I Y 46.51 1374.7003 12 3.3 459.2422 3 15.49 3 5386 AEV_3_3_RA3_01_1233.d 6.26E4 2 2 275 286 Deamidation (NQ)
K.RIHLVR.T Y 46.09 792.5082 6 -4.4 397.2596 2 28.83 3 12707 AEV_3_3_RA3_01_1233.d 8.19E5 4 4 291 296
R.LYAVISSRPGQSGR(+14.02).V Y 45.92 1503.8157 14 -2.4 502.2780 3 56.97 3 30204 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 418 431 Methylation(KR)
K.VRVIVVSYHPS(-18.01)NNELVR(+14.02).T Y 45.61 1976.0956 17 -27.3 495.0177 4 67.06 3 37902 AEV_3_3_RA3_01_1233.d 0 1 1 325 341 Dehydration; Methylation(KR)
R.TRGGNQKFR.A Y 44.42 1062.5682 9 3.9 532.2935 2 10.24 3 2650 AEV_3_3_RA3_01_1233.d 6.37E5 5 5 297 305
K.RAFEKGRQPANTR.I Y 43.70 1529.8175 13 4.8 383.4635 4 14.60 3 4882 AEV_3_3_RA3_01_1233.d 6.6E4 1 1 274 286
K.VDPALEK(+14.02)QFEAGR.L Y 43.34 1472.7623 13 8.8 491.9324 3 65.99 3 37054 AEV_3_3_RA3_01_1233.d 0 1 1 405 417 Methylation(KR)
R.IHLVR.T Y 43.32 636.4071 5 2.3 319.2115 2 28.81 2 10166 AEV_1_3_RA2_01_1232.d 2.38E6 9 9 292 296
R.VDGYILEGEE(+28.03)LAFYQR.A Y 42.72 1928.9519 16 11.0 643.9983 3 89.53 3 54460 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 432 447 Ethylation
R.ALRLESGNFS(-2.02)WGSEGISR.K Y 42.47 1962.9547 18 22.8 655.3405 3 76.64 2 37896 AEV_1_3_RA2_01_1232.d 0 1 1 306 323 2-amino-3-oxo-butanoic_acid
R.ALRLESGNFSW(+15.99)GSEGISR.K Y 41.35 1980.9653 18 1.5 661.3300 3 73.99 2 35871 AEV_1_3_RA2_01_1232.d 2.55E5 3 3 306 323 Oxidation (HW)
R.VDGYILE(+28.03)GEELAFYQR.A Y 40.61 1928.9519 16 3.6 643.9935 3 90.25 2 47347 AEV_1_3_RA2_01_1232.d 6.11E4 1 1 432 447 Ethylation
K.LGTE(+14.02)NTEEKK.S Y 40.39 1161.5876 10 1.0 581.8017 2 15.19 3 5221 AEV_3_3_RA3_01_1233.d 9.84E4 2 2 378 387 Methylation(others)
R.Q(-17.03)WYEAHYGQTLGRR.R Y 40.32 1746.8226 14 9.0 583.2867 3 69.68 2 32606 AEV_1_3_RA2_01_1232.d 8.26E4 1 1 360 373 Pyro-glu from Q
R.LYAVISSR(+14.02)PGQSGR.V Y 39.32 1503.8157 14 0.0 502.2791 3 58.97 2 25205 AEV_1_3_RA2_01_1232.d 3.82E4 1 1 418 431 Methylation(KR)
K.SAVVQVDAAP(+13.98)FR.Q Y 36.83 1272.6462 12 -62.4 637.2907 2 79.31 1 41293 AEV 2_3_RA2_01_1224.d 1.84E4 1 1 348 359 Proline oxidation to pyroglutamic acid
K.LGTE(+14.02)NTEEK.K Y 36.60 1033.4928 9 18.4 517.7632 2 22.66 2 7504 AEV_1_3_RA2_01_1232.d 8.4E4 1 1 378 386 Methylation(others)
R.FAAQGK.V Y 36.29 620.3282 6 -94.5 621.2769 1 18.76 1 4454 AEV 2_3_RA2_01_1224.d 1.35E4 1 1 399 404
R.QQKLGTENTEEK.K Y 35.44 1403.6892 12 6.2 468.9066 3 15.77 2 4654 AEV_1_3_RA2_01_1232.d 8.28E4 2 2 375 386
R.LYAVISSRPGQSGRVDGYILEGEE(+14.02)LAFYQR.A Y 34.02 3386.7258 30 7.5 678.3575 5 84.24 3 51184 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 418 447 Methylation(others)
K.VDPALEK(+14.02).Q Y 31.81 784.4330 7 -110.3 785.3538 1 48.93 1 19611 AEV 2_3_RA2_01_1224.d 2.66E5 2 2 405 411 Methylation(KR)
K.GRQPANTR(+14.02).I Y 31.06 912.4890 8 5.9 457.2545 2 9.88 2 2444 AEV_1_3_RA2_01_1232.d 5.22E4 2 2 279 286 Methylation(KR)
K.LGTE(+14.02)NTEEKKSK.S Y 30.08 1376.7147 12 0.5 345.1861 4 12.39 3 3740 AEV_3_3_RA3_01_1233.d 1.91E5 1 1 378 389 Methylation(others)
R.T(+42.01)NTLT(+79.97)K.S Y 29.67 798.3525 6 -29.5 799.3362 1 97.70 1 54804 AEV 2_3_RA2_01_1224.d 2.06E5 1 1 342 347 Acetylation (N-term); Phosphorylation (STY)
K.RAHYR.K N 29.56 701.3721 5 1.5 351.6939 2 8.67 3 2061 AEV_3_3_RA3_01_1233.d 8.12E3 1 1 267 271
K.LGTENT(+14.02)EEK.K Y 28.82 1033.4928 9 4.1 517.7558 2 23.12 2 7697 AEV_1_3_RA2_01_1232.d 8.4E4 1 1 378 386 Methylation(others)
R.F(+42.01)AAQGK.V Y 28.73 662.3387 6 -4.8 663.3428 1 59.91 3 32358 AEV_3_3_RA3_01_1233.d 4.02E4 1 1 399 404 Acetylation (N-term)
R.Q(-17.03)Q(+.98)KLGTENTEEKK.S Y 28.70 1515.7416 13 8.4 506.2587 3 19.62 3 7657 AEV_3_3_RA3_01_1233.d 0 1 1 375 387 Pyro-glu from Q; Deamidation (NQ)
R.LYAVISSRPGQ(+.98)SGR.V Y 28.32 1490.7841 14 5.5 497.9380 3 58.75 2 25083 AEV_1_3_RA2_01_1232.d 6.25E4 1 1 418 431 Deamidation (NQ)
R.VIVVS(-2.02)YHPSNNELVR.T Y 28.23 1722.9053 15 -29.8 575.2919 3 67.32 3 38112 AEV_3_3_RA3_01_1233.d 2E5 1 1 327 341 2-amino-3-oxo-butanoic_acid
K.V(+42.01)DPALEK.Q Y 27.23 812.4280 7 -54.0 407.1993 2 25.81 3 11039 AEV_3_3_RA3_01_1233.d 0 1 1 405 411 Acetylation (N-term)
R.LESGN(+.98)FSWGSEGISR.K Y 27.15 1625.7322 15 2.2 813.8751 2 75.33 3 44384 AEV_3_3_RA3_01_1233.d 1.34E5 1 1 309 323 Deamidation (NQ)
R.TNTLTK(+14.02).S Y 27.13 690.3912 6 2.7 346.2038 2 15.19 3 5215 AEV_3_3_RA3_01_1233.d 1.05E5 1 1 342 347 Methylation(KR)
R.ALRLESGNFSWGSEGISR(+14.02).K Y 26.89 1978.9861 18 -5.1 660.6660 3 77.09 2 38255 AEV_1_3_RA2_01_1232.d 6.12E4 1 1 306 323 Methylation(KR)
M(+15.99)STATPKENAPQPQR.Q Y 26.33 1670.8046 15 -21.4 836.3917 2 76.76 2 38014 AEV_1_3_RA2_01_1232.d 9.63E4 2 2 1 15 Oxidation (M)
R.VDGYILE(+14.02)GEELAFYQR.A Y 26.28 1914.9363 16 -87.4 639.2635 3 92.98 1 51767 AEV 2_3_RA2_01_1224.d 4.17E5 2 2 432 447 Methylation(others)
R.LESGNFSWGSEGIS(+79.97)R.K Y 25.53 1704.7145 15 1.8 569.2465 3 68.01 1 32443 AEV 2_3_RA2_01_1224.d 0 1 1 309 323 Phosphorylation (STY)
R.L(+42.01)YAVISSRPGQSGR(+14.02).V Y 25.22 1545.8263 14 10.9 310.1759 5 16.82 3 6110 AEV_3_3_RA3_01_1233.d 0 1 1 418 431 Acetylation (N-term); Methylation(KR)
K.VD(+541.06)PALEKQFEAGR.L Y 24.95 1999.8077 13 84.5 501.0015 4 62.53 2 27561 AEV_1_3_RA2_01_1232.d 2.36E4 1 1 405 417 ADP Ribose addition
R.ALRLESGNFSWGS(+136.03)EGISR.K Y 24.83 2100.9993 18 30.7 526.2732 4 73.62 3 43064 AEV_3_3_RA3_01_1233.d 0 1 1 306 323 O-Diethylphosphorylation
R.ALRLESGNFSWGSEGISR(+28.03).K Y 24.53 1993.0017 18 2.9 665.3431 3 78.14 3 46617 AEV_3_3_RA3_01_1233.d 0 1 1 306 323 Dimethylation(KR)
K.V(+119.04)DPALEKQFEAGR.L Y 24.11 1577.7837 13 -5.3 526.9324 3 65.82 3 36931 AEV_3_3_RA3_01_1233.d 0 1 1 405 417 Pyridylacetyl
R.ALRLESGNFSWGSE(+14.02)GISR.K Y 24.08 1978.9861 18 -6.7 990.4937 2 77.93 3 46451 AEV_3_3_RA3_01_1233.d 3.07E4 1 1 306 323 Methylation(others)
K.QFEAGR.L Y 23.98 706.3398 6 -15.7 707.3360 1 60.15 3 32522 AEV_3_3_RA3_01_1233.d 3.81E4 5 5 412 417
R.GGNQK.F Y 23.85 502.2499 5 1.6 503.2580 1 98.85 3 58681 AEV_3_3_RA3_01_1233.d 3.76E4 2 2 299 303
R.I(+42.01)HLVR.T Y 23.76 678.4177 5 -84.5 340.1874 2 28.65 2 10108 AEV_1_3_RA2_01_1232.d 0 1 1 292 296 Acetylation (N-term)
R.ALRLESGNFSWGSEGIS(-18.01)R(+14.02).K Y 23.71 1960.9755 18 -1.2 654.6650 3 76.24 3 45100 AEV_3_3_RA3_01_1233.d 0 1 1 306 323 Dehydration; Methylation(KR)
R.LESGNFSWGSEGIS(-18.01)R(+14.02).K Y 23.42 1620.7532 15 -6.0 811.3790 2 73.76 3 43168 AEV_3_3_RA3_01_1233.d 0 1 1 309 323 Dehydration; Methylation(KR)
R.LESGNFSWGSE(+14.02)GISR.K Y 23.34 1638.7638 15 -87.8 820.3172 2 81.27 1 42827 AEV 2_3_RA2_01_1224.d 1.57E5 1 1 309 323 Methylation(others)
K.LGTENTEEKK(+14.02)SK.S Y 23.10 1376.7147 12 6.1 459.9150 3 12.61 2 3447 AEV_1_3_RA2_01_1232.d 4.22E5 2 2 378 389 Methylation(KR)
K.SKSVEK(+42.01).K Y 22.92 718.3861 6 16.5 360.2063 2 66.41 3 37399 AEV_3_3_RA3_01_1233.d 0 1 1 388 393 Acetylation (K)
K.VDPALEK(+42.01).Q Y 22.57 812.4280 7 12.7 407.2264 2 29.41 2 10441 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 405 411 Acetylation (K)
K.SAVVQVD(-18.01)AAPFR.Q Y 22.00 1240.6564 12 6.9 311.1735 4 28.94 3 12766 AEV_3_3_RA3_01_1233.d 8.18E4 1 1 348 359 Dehydration
K.LGTEN(+.98)TEEK.K Y 21.71 1020.4611 9 24.2 511.2502 2 15.70 2 4620 AEV_1_3_RA2_01_1232.d 1.98E4 1 1 378 386 Deamidation (NQ)
K.QAVRFAAQGK(+27.99).V Y 21.57 1102.5883 10 -45.9 552.2761 2 51.45 2 21186 AEV_1_3_RA2_01_1232.d 5.55E4 1 1 395 404 Formylation
R.QQQ(+.98)Q(+.98)QQQQR.Q Y 21.46 1200.5483 9 -17.5 401.1830 3 66.70 1 31402 AEV 2_3_RA2_01_1224.d 1.31E5 1 1 210 218 Deamidation (NQ)
R.SATGAK(+226.08).R N 20.82 759.3585 6 4.0 760.3688 1 43.29 1 16296 AEV 2_3_RA2_01_1224.d 0 1 1 261 266 Biotinylation
MSTATPK.E Y 20.80 734.3633 7 -4.5 735.3672 1 23.40 3 9656 AEV_3_3_RA3_01_1233.d 0 2 2 1 7
K.QFEAGR(+14.02).L Y 20.73 720.3555 6 -88.2 361.1533 2 36.21 1 12288 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 412 417 Methylation(KR)
R.GGNQ(+.98)K.F Y 20.45 503.2339 5 -96.9 504.1924 1 29.49 1 8714 AEV 2_3_RA2_01_1224.d 2.96E4 2 2 299 303 Deamidation (NQ)
R.GGNQKFR.A Y 19.41 805.4194 7 2.2 403.7179 2 10.26 2 2587 AEV_1_3_RA2_01_1232.d 5.85E4 2 2 299 305
R.QPANTR.I Y 19.40 685.3507 6 -82.0 686.3018 1 97.55 1 54739 AEV 2_3_RA2_01_1224.d 0 1 1 281 286
R.VDGYILEGEELAFY(+79.97)QR.A Y 19.26 1980.8870 16 -3.5 496.2273 4 79.23 1 41303 AEV 2_3_RA2_01_1224.d 0 1 1 432 447 Phosphorylation (STY)
R.IHLVR(+14.02).T Y 19.17 650.4228 5 -102.8 326.1852 2 65.45 1 30457 AEV 2_3_RA2_01_1224.d 3.14E5 4 4 292 296 Methylation(KR)
R.FAAQGK(+28.03).V Y 18.54 648.3595 6 32.0 325.1974 2 56.31 3 29730 AEV_3_3_RA3_01_1233.d 6.71E4 1 1 399 404 Dimethylation(KR)
R.QPANTRIGPK(-.98).R Y 18.47 1079.6200 10 -15.3 360.8751 3 57.48 3 30632 AEV_3_3_RA3_01_1233.d 8.41E4 1 1 281 290 Amidation
R.GGN(+.98)QK.F Y 18.10 503.2339 5 26.4 504.2545 1 98.26 2 50437 AEV_1_3_RA2_01_1232.d 0 1 1 299 303 Deamidation (NQ)
K.R(+14.02)PMKTSSK(+31.99).H Y 18.09 979.5120 8 -10.5 980.5090 1 90.49 3 54989 AEV_3_3_RA3_01_1233.d 1.56E5 1 1 79 86 Methylation(KR); Dihydroxy
K.LGTENT(+14.02)EEKKSK.S Y 17.98 1376.7147 12 7.6 459.9157 3 13.24 2 3681 AEV_1_3_RA2_01_1232.d 4.47E4 1 1 378 389 Methylation(others)
K.A(+43.01)VIHGDLTLALLAWPFRQAR.V Y 17.96 2290.2698 20 -53.2 573.5443 4 71.65 3 41523 AEV_3_3_RA3_01_1233.d 0 1 1 161 180 Carbamylation
MSTATPK(+42.01).E Y 17.60 776.3738 7 34.1 389.2074 2 19.73 3 7693 AEV_3_3_RA3_01_1233.d 0 1 1 1 7 Acetylation (K)
R.VIVVSYHPSN(+.98)NELVR(+14.02).T Y 17.44 1739.9207 15 -2.7 580.9792 3 72.19 2 34493 AEV_1_3_RA2_01_1232.d 6.58E4 1 1 327 341 Deamidation (NQ); Methylation(KR)
K.VDPALEK(+21.98).Q Y 17.12 792.3994 7 -115.4 793.3152 1 94.60 1 52883 AEV 2_3_RA2_01_1224.d 3.12E4 1 1 405 411 Sodium adduct
R.TN(+.98)TLT(+79.97)K.S Y 17.02 757.3259 6 5.2 758.3372 1 99.24 1 55415 AEV 2_3_RA2_01_1224.d 2.02E4 1 1 342 347 Deamidation (NQ); Phosphorylation (STY)
R.AAIM(+15.99)GIS(+79.97)R.D Y 16.91 913.4092 8 -13.5 457.7057 2 56.34 1 24036 AEV 2_3_RA2_01_1224.d 0 1 1 247 254 Oxidation (M); Phosphorylation (STY)
R.QPANT(+79.97)RIGPKR.I Y 16.72 1316.6714 11 1.8 330.1757 4 8.55 2 2021 AEV_1_3_RA2_01_1232.d 2.83E4 1 1 281 291 Phosphorylation (STY)
K.Q(+42.01)AVRFAAQGK(+42.01).V Y 16.69 1158.6145 10 4.9 387.2140 3 53.50 3 28041 AEV_3_3_RA3_01_1233.d 6.39E5 1 1 395 404 Acetylation (N-term); Acetylation (K)
K.LGTENTEEKK(+188.03).S Y 16.68 1335.6050 10 -62.0 446.1813 3 33.31 1 10801 AEV 2_3_RA2_01_1224.d 0 1 1 378 387 Lipoyl
K.LGTE(+43.99)NTEEKK.S Y 16.60 1191.5619 10 -87.3 398.1599 3 21.92 1 5359 AEV 2_3_RA2_01_1224.d 1.16E5 1 1 378 387 Carboxylation (E)
M(+42.01)(+15.99)STATPK.E Y 16.56 792.3688 7 -61.6 397.1673 2 40.12 1 14467 AEV 2_3_RA2_01_1224.d 0 1 1 1 7 Acetylation (Protein N-term); Oxidation (M)
K.V(+42.01)DPALEK(+42.01).Q Y 16.55 854.4385 7 -78.1 428.1932 2 65.40 1 30486 AEV 2_3_RA2_01_1224.d 6.68E4 1 1 405 411 Acetylation (N-term); Acetylation (K)
R.FAAQGK(+42.01).V Y 16.46 662.3387 6 9.7 663.3524 1 65.15 2 29357 AEV_1_3_RA2_01_1232.d 0 1 1 399 404 Acetylation (K)
K.QAVRFAAQ(+.98)GK(+14.02)VDPALEK(+14.02).Q Y 16.17 1856.0155 17 1.5 465.0118 4 69.70 2 32627 AEV_1_3_RA2_01_1232.d 8.72E4 1 1 395 411 Deamidation (NQ); Methylation(KR)
R.R(+42.01)Q(+.98)QKLGTENTEEK.K Y 16.05 1602.7849 13 18.7 802.4147 2 91.24 3 55393 AEV_3_3_RA3_01_1233.d 0 1 1 374 386 Acetylation (N-term); Deamidation (NQ)
R.TNTLT(+79.97)K.S Y 16.02 756.3419 6 24.3 757.3676 1 79.19 2 39919 AEV_1_3_RA2_01_1232.d 4.53E4 1 1 342 347 Phosphorylation (STY)
K.V(+42.01)D(+43.99)PALEKQFEAGR.L Y 15.96 1544.7471 13 39.1 515.9431 3 67.18 3 37998 AEV_3_3_RA3_01_1233.d 8.61E4 1 1 405 417 Acetylation (N-term); Carboxylation (DKW)
R.VIVVSYHPSNNELVR(+28.03).T Y 15.93 1752.9523 15 -3.1 585.3229 3 71.86 3 41690 AEV_3_3_RA3_01_1233.d 0 1 1 327 341 Dimethylation(KR)
R.LYAVISSRPGQS(-18.01)GR(+14.02).V Y 15.91 1485.8052 14 6.9 496.2791 3 55.40 3 29186 AEV_3_3_RA3_01_1233.d 7.92E4 1 1 418 431 Dehydration; Methylation(KR)
K.VDPALEK(+114.04).Q Y 15.71 884.4603 7 -36.7 443.2212 2 50.77 1 20668 AEV 2_3_RA2_01_1224.d 3.4E5 1 1 405 411 Ubiquitin
K.ENAPQPQR.Q Y 15.69 938.4570 8 -61.6 470.2068 2 41.23 1 15130 AEV 2_3_RA2_01_1224.d 0 2 2 8 15
K.R(+42.01)SATGAK(+226.08).R Y 15.62 957.4702 7 -12.5 320.1600 3 48.85 1 19561 AEV 2_3_RA2_01_1224.d 0 1 1 260 266 Acetylation (N-term); Biotinylation
K.S(+56.06)AVVQVDAAPFRQWYEAHYGQTLGR.R Y 15.59 2904.4670 25 -8.9 727.1176 4 81.16 3 48957 AEV_3_3_RA3_01_1233.d 0 1 1 348 372 Diethylation
R.QQ(+.98)QQQQQQ(+.98)RQQR.H Y 15.54 1612.7666 12 -32.6 538.5786 3 39.65 3 19188 AEV_3_3_RA3_01_1233.d 7.7E4 1 1 210 221 Deamidation (NQ)
R.AAIMGISR(+31.99)DSRHK.R Y 15.25 1472.7517 13 8.3 369.1982 4 35.19 2 13162 AEV_1_3_RA2_01_1232.d 3.5E4 1 1 247 259 Dihydroxy
K.LGTENTE(+14.02)EK.K Y 15.22 1033.4928 9 -85.2 517.7097 2 35.55 1 11968 AEV 2_3_RA2_01_1224.d 2.32E5 1 1 378 386 Methylation(others)
K.SAVVQVDAAPFR(+14.02)Q(+.98)WYEAHYGQTLGR(+14.02).R Y 15.20 2877.4197 25 -4.9 720.3586 4 81.04 2 41380 AEV_1_3_RA2_01_1232.d 1.41E5 1 1 348 372 Methylation(KR); Deamidation (NQ)
R.SATGAK(+21.98)(+14.02).R N 15.09 569.2785 6 -2.4 570.2844 1 29.21 2 10350 AEV_1_3_RA2_01_1232.d 0 1 1 261 266 Sodium adduct; Methylation(KR)
K.LGTENTEEKK(+229.01).S Y 15.07 1376.5861 10 -0.7 689.2998 2 29.45 1 8692 AEV 2_3_RA2_01_1224.d 3.71E4 1 1 378 387 Pyridoxal phosphate
total 163 peptides
C1GGT8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.ATHGIYPLQNVHIR.K Y 154.82 1617.8739 14 5.7 540.3016 3 65.70 2 29738 AEV_1_3_RA2_01_1232.d 4.17E6 10 10 199 212
R.IFEVSLADLQNDEDHAFR.K Y 145.15 2118.0017 18 3.6 707.0104 3 82.54 2 42548 AEV_1_3_RA2_01_1232.d 1.45E6 8 8 65 82
K.NC(+57.02)LTNFHGLDFTSDKLR.S Y 144.97 2036.9738 17 2.2 510.2518 4 75.99 2 37382 AEV_1_3_RA2_01_1232.d 2.48E6 8 8 95 111 Carbamidomethylation
R.IFEVSLADLQNDEDHAFRK.V Y 131.95 2246.0967 19 1.4 562.5322 4 79.52 2 40175 AEV_1_3_RA2_01_1232.d 2.37E6 7 7 65 83
K.TTDDYLLRLFAIAFTK.R Y 117.49 1887.0142 16 0.9 630.0126 3 93.70 3 56681 AEV_3_3_RA3_01_1233.d 1.24E6 7 7 129 144
K.FDLGALLALHGESSTDDKGQKVER.E Y 114.81 2585.3083 24 0.5 518.0692 5 77.52 3 46140 AEV_3_3_RA3_01_1233.d 6.94E5 4 4 222 245
R.TTGLKNANDALKGR.I Y 109.80 1457.7950 14 4.0 486.9409 3 35.96 2 13574 AEV_1_3_RA2_01_1232.d 5.84E6 14 14 51 64
R.IFEVSLADLQNDEDHAFRKVK.L Y 105.16 2473.2600 21 -6.6 495.6560 5 77.87 3 46413 AEV_3_3_RA3_01_1233.d 1.29E6 5 5 65 85
R.EIEKATHGIYPLQNVHIR.K Y 104.23 2117.1382 18 -0.1 424.4349 5 65.81 3 36920 AEV_3_3_RA3_01_1233.d 1.45E6 5 5 195 212
K.LIPEVIGREIEKATHGIYPLQNVHIR.K Y 103.77 2994.6765 26 1.6 599.9435 5 83.67 3 50783 AEV_3_3_RA3_01_1233.d 6.06E5 3 3 187 212
K.FDLGALLALHGESSTDDKGQK.V Y 100.80 2201.0964 21 -1.1 551.2808 4 79.81 3 47924 AEV_3_3_RA3_01_1233.d 5.48E5 4 4 222 242
K.TTYAQSSQIR.A Y 99.57 1153.5728 10 3.8 577.7958 2 31.91 2 11595 AEV_1_3_RA2_01_1232.d 5.27E6 11 11 153 162
K.TTDDYLLRLFAIAFTKR.R Y 98.83 2043.1152 17 0.9 511.7865 4 90.15 3 54815 AEV_3_3_RA3_01_1233.d 2.24E5 3 3 129 145
R.KWQTLIEANVTVK.T Y 94.54 1528.8613 13 -27.6 765.4168 2 72.26 3 41997 AEV_3_3_RA3_01_1233.d 3.79E5 3 3 116 128
K.SPKFDLGALLALHGESSTDDKGQK.V Y 93.92 2513.2761 24 -7.0 503.6590 5 77.22 3 45873 AEV_3_3_RA3_01_1233.d 3.39E5 3 3 219 242
K.KTTYAQSSQIR.A Y 88.48 1281.6677 11 1.9 428.2307 3 20.83 3 8297 AEV_3_3_RA3_01_1233.d 1.57E6 10 10 152 162
R.TQDPFSRKDEYSVKAPSTFAIR.D Y 87.98 2542.2815 22 7.0 509.4671 5 70.66 2 33342 AEV_1_3_RA2_01_1232.d 7.56E5 3 3 20 41
K.APSTFAIRDVGK.T Y 85.39 1260.6826 12 3.2 631.3506 2 59.44 2 25542 AEV_1_3_RA2_01_1232.d 3.97E5 5 5 34 45
R.KDEYSVKAPSTFAIR.D Y 84.46 1710.8940 15 18.7 428.7388 4 64.08 3 35572 AEV_3_3_RA3_01_1233.d 3.42E5 4 4 27 41
K.ATHGIYPLQ(+.98)NVHIR.K Y 84.35 1618.8579 14 12.2 405.7267 4 64.66 3 36008 AEV_3_3_RA3_01_1233.d 9.62E5 2 2 199 212 Deamidation (NQ)
K.GRIFEVSLADLQNDEDHAFR.K Y 83.63 2331.1243 20 8.3 583.7932 4 80.20 3 48222 AEV_3_3_RA3_01_1233.d 1.9E5 2 2 63 82
K.TTDDYLLRLFAIAFTK(+14.02).R Y 82.83 1901.0298 16 -0.1 634.6838 3 94.77 3 57122 AEV_3_3_RA3_01_1233.d 2.32E5 1 1 129 144 Methylation(KR)
R.TQDPFSRKDEYSVK.A Y 81.45 1698.8213 14 0.9 850.4187 2 51.05 3 26409 AEV_3_3_RA3_01_1233.d 3.59E6 10 10 20 33
K.TTDDYLLR.L Y 81.12 995.4924 8 -2.3 498.7523 2 60.26 3 32636 AEV_3_3_RA3_01_1233.d 2.87E6 7 7 129 136
R.LFAIAFTK.R Y 79.81 909.5323 8 -17.8 910.5234 1 77.80 3 46340 AEV_3_3_RA3_01_1233.d 2.07E6 6 6 137 144
K.NC(+57.02)LTNFHGLDFTSDKLR(+14.02).S Y 78.94 2050.9895 17 0.2 513.7548 4 76.95 3 45656 AEV_3_3_RA3_01_1233.d 1.9E5 2 2 95 111 Carbamidomethylation; Methylation(KR)
R.IFEVSLADLQNDE(+14.02)DHAFR.K Y 78.69 2132.0173 18 1.1 711.6805 3 85.92 3 52313 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 65 82 Methylation(others)
R.IFEVSLADLQ(+.98)NDEDHAFRK.V Y 77.88 2247.0808 19 1.0 562.7780 4 80.53 3 48495 AEV_3_3_RA3_01_1233.d 6.09E5 4 4 65 83 Deamidation (NQ)
K.TTYAQSSQ(+.98)IR.A Y 77.47 1154.5568 10 3.5 578.2877 2 33.37 3 15397 AEV_3_3_RA3_01_1233.d 1.13E6 3 3 153 162 Deamidation (NQ)
R.IFEVSLADLQNDED(+14.02)HAFR.K Y 74.98 2132.0173 18 2.4 711.6814 3 86.11 2 45048 AEV_1_3_RA2_01_1232.d 1.34E5 1 1 65 82 Methylation(others)
R.TTGLKNANDALK.G Y 74.53 1244.6725 12 2.2 623.3449 2 32.52 3 14876 AEV_3_3_RA3_01_1233.d 1.91E6 8 8 51 62
R.LFAIAFTKR.R Y 73.26 1065.6334 9 -4.2 356.2169 3 70.35 3 40536 AEV_3_3_RA3_01_1233.d 2.15E5 2 2 137 145
K.TTYAQ(+.98)SSQIR.A Y 72.28 1154.5568 10 15.5 578.2946 2 30.44 3 13641 AEV_3_3_RA3_01_1233.d 1.39E6 7 7 153 162 Deamidation (NQ)
R.IFEVSLADLQNDE(+14.02)DHAFRK.V Y 71.96 2260.1123 19 1.2 566.0360 4 82.87 3 50234 AEV_3_3_RA3_01_1233.d 4.59E5 2 2 65 83 Methylation(others)
K.LRVDEVQGK.N Y 70.18 1042.5770 9 -2.4 522.2946 2 30.31 3 13591 AEV_3_3_RA3_01_1233.d 6.18E6 11 11 86 94
K.N(+.98)C(+57.02)LTN(+.98)FHGLDFTSDKLR.S Y 69.91 2038.9418 17 17.3 680.6663 3 75.42 3 44453 AEV_3_3_RA3_01_1233.d 8.38E3 1 1 95 111 Deamidation (NQ); Carbamidomethylation
R.IFEVSLADLQNDEDHAFR(+14.02).K Y 69.83 2132.0173 18 0.6 1067.0166 2 85.96 3 52342 AEV_3_3_RA3_01_1233.d 7.83E4 3 3 65 82 Methylation(KR)
K.NANDALKGR.I Y 68.79 957.4991 9 3.8 479.7587 2 13.44 3 4352 AEV_3_3_RA3_01_1233.d 9.7E5 5 5 56 64
K.N(+.98)C(+57.02)LTNFHGLDFTSDKLR.S Y 68.53 2037.9578 17 -1.2 510.4961 4 77.63 2 38696 AEV_1_3_RA2_01_1232.d 1.7E5 3 3 95 111 Deamidation (NQ); Carbamidomethylation
R.IFE(+14.02)VSLADLQNDEDHAFR.K Y 66.98 2132.0173 18 2.4 711.6814 3 83.22 3 50488 AEV_3_3_RA3_01_1233.d 7.05E5 5 5 65 82 Methylation(others)
K.LIPEVIGREIEK.A Y 65.97 1394.8132 12 -11.5 698.4059 2 72.29 2 34612 AEV_1_3_RA2_01_1232.d 1.6E6 7 7 187 198
K.LIPEVIGR.E Y 65.59 895.5491 8 -3.1 448.7804 2 67.18 3 38054 AEV_3_3_RA3_01_1233.d 3.03E6 3 3 187 194
K.APSTFAIR.D Y 63.52 861.4708 8 -0.9 431.7423 2 53.42 3 27995 AEV_3_3_RA3_01_1233.d 2.97E6 6 6 34 41
R.IFEVSLADLQN(+.98)DEDHAFRK.V Y 63.26 2247.0808 19 1.5 562.7783 4 79.60 3 47762 AEV_3_3_RA3_01_1233.d 0 1 1 65 83 Deamidation (NQ)
K.RTQDPFSRKDEYSVK.A Y 63.14 1854.9224 15 17.0 464.7457 4 43.48 3 21590 AEV_3_3_RA3_01_1233.d 0 1 1 19 33
R.TQDPFSR.K Y 62.91 849.3981 7 3.6 425.7079 2 39.11 2 15038 AEV_1_3_RA2_01_1232.d 3.86E6 12 12 20 26
K.WQTLIEANVTVK.T Y 61.17 1400.7664 12 -22.0 701.3751 2 76.72 2 37958 AEV_1_3_RA2_01_1232.d 0 2 2 117 128
K.ATHGIYPLQNVHIR(+14.02).K Y 59.19 1631.8895 14 -4.1 408.9780 4 67.44 3 38201 AEV_3_3_RA3_01_1233.d 2.01E5 1 1 199 212 Methylation(KR)
K.TTYAQSSQIR(+14.02).A Y 57.54 1167.5884 10 0.7 584.8019 2 43.86 3 21822 AEV_3_3_RA3_01_1233.d 7.43E5 4 4 153 162 Methylation(KR)
K.A(+43.01)PSTFAIRDVGK.T Y 54.11 1303.6884 12 28.2 435.5823 3 57.90 3 30881 AEV_3_3_RA3_01_1233.d 0 1 1 34 45 Carbamylation
R.IFEVSLADLQN(+.98)DEDHAFR.K Y 53.72 2118.9858 18 29.1 707.3564 3 83.80 3 50879 AEV_3_3_RA3_01_1233.d 5.54E4 1 1 65 82 Deamidation (NQ)
K.NC(+57.02)LTN(+.98)FHGLDFTSDKLR.S Y 52.84 2037.9578 17 8.6 510.5011 4 77.17 3 45835 AEV_3_3_RA3_01_1233.d 9.38E4 1 1 95 111 Carbamidomethylation; Deamidation (NQ)
K.M(+15.99)VEIIQR.E Y 50.93 903.4848 7 -1.1 452.7492 2 45.47 3 22856 AEV_3_3_RA3_01_1233.d 7.49E5 4 4 168 174 Oxidation (M)
K.MVEIIQR.E Y 49.66 887.4899 7 -90.8 444.7119 2 67.37 1 31922 AEV 2_3_RA2_01_1224.d 1.76E6 7 7 168 174
R.IFEVSLADLQNDEDHAFR(+14.02)K.V Y 49.13 2260.1123 19 3.3 754.3805 3 83.16 2 42990 AEV_1_3_RA2_01_1232.d 4.91E4 2 2 65 83 Methylation(KR)
K.NC(+57.02)LTNFHGLD(+14.02)FTSDKLR.S Y 48.90 2050.9895 17 -2.9 513.7532 4 74.81 3 43977 AEV_3_3_RA3_01_1233.d 2.14E5 2 2 95 111 Carbamidomethylation; Methylation(others)
K.KTTYAQSSQ(+.98)IR.A Y 48.66 1282.6517 11 -1.5 642.3322 2 23.45 3 9679 AEV_3_3_RA3_01_1233.d 3.26E4 1 1 152 162 Deamidation (NQ)
K.FDLGALLALHGESSTDDKGQ(+.98)KVER.E Y 47.00 2586.2925 24 5.9 518.2688 5 77.58 3 46164 AEV_3_3_RA3_01_1233.d 8.8E4 1 1 222 245 Deamidation (NQ)
R.IFE(+14.02)VSLADLQNDEDHAFRK.V Y 46.96 2260.1123 19 -2.9 566.0337 4 80.31 2 40810 AEV_1_3_RA2_01_1232.d 2.14E5 1 1 65 83 Methylation(others)
R.T(-18.01)TGLK(+14.02)NANDALKGR.I Y 46.25 1453.8000 14 -3.0 364.4562 4 34.26 3 15885 AEV_3_3_RA3_01_1233.d 0 1 1 51 64 Dehydration; Methylation(KR)
R.SLAQLTK.L Y 46.10 759.4490 7 3.6 380.7332 2 39.59 2 15270 AEV_1_3_RA2_01_1232.d 6.96E6 9 9 180 186
R.DVGKTLVNR.T Y 45.26 1000.5665 9 1.4 334.5299 3 32.47 3 14852 AEV_3_3_RA3_01_1233.d 4.61E5 8 8 42 50
K.LRVDEVQGK(-1.03)NC(+57.02)LTNFHGLDFTSDKLR.S Y 44.95 3060.5085 26 13.9 613.1175 5 75.30 3 44361 AEV_3_3_RA3_01_1233.d 0 1 1 86 111 Lysine oxidation to aminoadipic semialdehyde; Carbamidomethylation
K.APSTFAIR(+14.02).D Y 44.89 875.4865 8 -3.1 438.7491 2 63.03 3 34762 AEV_3_3_RA3_01_1233.d 1.21E5 1 1 34 41 Methylation(KR)
K.FDLGALLALHGE(+14.02)SSTDDKGQK.V Y 43.20 2215.1121 21 -3.6 739.3753 3 81.02 3 48856 AEV_3_3_RA3_01_1233.d 8.83E4 1 1 222 242 Methylation(others)
K.GRIFEVS(-2.02)LADLQNDEDHAFR.K Y 42.42 2329.1086 20 38.9 583.3071 4 80.24 3 48258 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 63 82 2-amino-3-oxo-butanoic_acid
R.TQDPFSR(+14.02).K Y 41.78 863.4137 7 -1.4 432.7135 2 42.05 3 20734 AEV_3_3_RA3_01_1233.d 2.93E5 2 2 20 26 Methylation(KR)
K.ATHGIYPLQN(+.98)VHIR.K Y 41.44 1618.8579 14 6.5 405.7244 4 67.45 2 30989 AEV_1_3_RA2_01_1232.d 1.67E5 1 1 199 212 Deamidation (NQ)
R.TTGLKNAND(+14.02)ALKGR.I Y 39.86 1471.8107 14 1.1 491.6114 3 33.20 3 15262 AEV_3_3_RA3_01_1233.d 1.3E4 1 1 51 64 Methylation(others)
R.TTGLKN(+.98)ANDALKGR.I Y 39.37 1458.7791 14 -1.2 487.2664 3 42.06 3 20695 AEV_3_3_RA3_01_1233.d 2.99E5 3 3 51 64 Deamidation (NQ)
R.TQDPFSR(+14.02)KDEYSVKAPSTFAIR.D Y 38.56 2556.2971 22 4.7 512.2691 5 71.44 3 41358 AEV_3_3_RA3_01_1233.d 1.33E5 1 1 20 41 Methylation(KR)
R.SLAQLTK(+14.02).L Y 38.01 773.4647 7 0.1 387.7397 2 47.86 3 24365 AEV_3_3_RA3_01_1233.d 6.61E5 4 4 180 186 Methylation(KR)
K.TTYAQ(+.98)SSQIR(+14.02).A Y 37.84 1168.5724 10 9.8 585.2992 2 48.02 3 24460 AEV_3_3_RA3_01_1233.d 6.3E4 1 1 153 162 Deamidation (NQ); Methylation(KR)
K.ATHGIYPLQNVHIRK.V Y 37.48 1745.9689 15 3.3 350.2022 5 58.32 3 31187 AEV_3_3_RA3_01_1233.d 4.68E5 1 1 199 213
K.TTYAQ(+.98)SSQ(+.98)IR.A Y 36.32 1155.5408 10 -3.5 578.7756 2 31.38 2 11358 AEV_1_3_RA2_01_1232.d 3.61E4 1 1 153 162 Deamidation (NQ)
K.LRVDEVQGK(+14.02).N Y 35.31 1056.5928 9 0.0 529.3036 2 39.98 3 19388 AEV_3_3_RA3_01_1233.d 2.89E5 3 3 86 94 Methylation(KR)
R.SLVRKWQTLIEANVTVK.T Y 34.22 1984.1470 17 38.5 497.0631 4 78.72 3 47075 AEV_3_3_RA3_01_1233.d 0 1 1 112 128
K.NC(+57.02)LTNFHGLDFTSDK.L Y 33.92 1767.7886 15 39.6 590.2935 3 75.00 3 44201 AEV_3_3_RA3_01_1233.d 4.12E5 2 2 95 109 Carbamidomethylation
K.APSTFAIRDVGKTLVNR.T Y 33.01 1844.0267 17 -8.6 462.0100 4 69.54 3 39882 AEV_3_3_RA3_01_1233.d 6.57E4 1 1 34 50
R.SLAQ(+.98)LTK.L Y 32.96 760.4330 7 -1.4 381.2233 2 40.99 3 19994 AEV_3_3_RA3_01_1233.d 6.44E5 4 4 180 186 Deamidation (NQ)
R.S(+43.01)LAQLTK.L Y 32.94 802.4548 7 -21.0 402.2263 2 37.20 3 17707 AEV_3_3_RA3_01_1233.d 0 1 1 180 186 Carbamylation
R.KDEYSVK(-1.03)APSTFAIRDVGK.T Y 32.90 2109.0742 19 40.6 528.2972 4 65.05 2 29304 AEV_1_3_RA2_01_1232.d 0 1 1 27 45 Lysine oxidation to aminoadipic semialdehyde
K.TTDDYLLR(+14.02).L Y 32.67 1009.5080 8 -1.8 505.7604 2 66.19 3 37217 AEV_3_3_RA3_01_1233.d 4.06E5 2 2 129 136 Methylation(KR)
K.VKLRVDEVQGK.N Y 32.25 1269.7405 11 -2.0 635.8762 2 40.87 2 15874 AEV_1_3_RA2_01_1232.d 1.73E4 1 1 84 94
K.LIPEVIGREIEK(+14.02).A Y 31.35 1408.8289 12 -5.0 470.6146 3 74.37 3 43642 AEV_3_3_RA3_01_1233.d 2.26E5 1 1 187 198 Methylation(KR)
K.APSTFAIR(+14.02)DVGK.T Y 31.09 1274.6982 12 -6.9 425.9037 3 61.03 3 33203 AEV_3_3_RA3_01_1233.d 5.06E5 1 1 34 45 Methylation(KR)
K.LIPE(+14.02)VIGREIEK.A Y 30.83 1408.8289 12 2.4 470.6180 3 72.89 2 35031 AEV_1_3_RA2_01_1232.d 2.26E5 2 2 187 198 Methylation(others)
K.NANDALKGR(+14.02).I Y 30.80 971.5148 9 -83.6 324.8185 3 39.26 1 13977 AEV 2_3_RA2_01_1224.d 2.39E5 1 1 56 64 Methylation(KR)
K.K(+14.02)TTY(-18.01)AQSSQIR.A Y 30.52 1277.6727 11 -19.0 426.8901 3 20.80 3 8250 AEV_3_3_RA3_01_1233.d 0 1 1 152 162 Methylation(KR); Dehydration
K.TLVNR.T Y 30.48 601.3547 5 1.4 301.6851 2 16.00 3 5673 AEV_3_3_RA3_01_1233.d 6.9E5 2 2 46 50
K.N(+42.01)AN(+.98)DALKGR.I Y 29.19 1000.4937 9 -66.8 334.4829 3 26.03 1 6997 AEV 2_3_RA2_01_1224.d 9.06E4 1 1 56 64 Acetylation (N-term); Deamidation (NQ)
R.TQ(+.98)DPFSR.K Y 28.81 850.3821 7 -58.5 426.1735 2 55.26 1 23354 AEV 2_3_RA2_01_1224.d 0 1 1 20 26 Deamidation (NQ)
K.APS(+44.01)TFAIRDVGK.T Y 28.79 1304.6910 12 26.5 435.9158 3 59.48 2 25548 AEV_1_3_RA2_01_1232.d 5.75E4 1 1 34 45 S-Ethylcystine from Serine
K.NC(+57.02)LTNFHGLDFTSDK(+14.02)LR.S Y 28.69 2050.9895 17 -5.5 684.6667 3 77.52 2 38583 AEV_1_3_RA2_01_1232.d 2.48E5 1 1 95 111 Carbamidomethylation; Methylation(KR)
K.TTY(+125.90)AQSSQIR.A Y 28.66 1279.4694 10 19.4 640.7544 2 48.12 3 24535 AEV_3_3_RA3_01_1233.d 0 1 1 153 162 Iodination
K.RTQDPFSR.K Y 27.89 1005.4991 8 -7.9 503.7529 2 27.69 3 12062 AEV_3_3_RA3_01_1233.d 3.33E5 2 2 19 26
R.EAGTR.S N 26.64 532.2605 5 -1.4 533.2670 1 13.61 3 4365 AEV_3_3_RA3_01_1233.d 0 2 2 175 179
K.TTDD(+14.02)YLLRLFAIAFTK.R Y 26.36 1901.0298 16 0.9 634.6844 3 94.10 3 56834 AEV_3_3_RA3_01_1233.d 1.96E3 1 1 129 144 Methylation(others)
K.LLKSPK.F N 25.75 684.4534 6 -16.8 343.2282 2 15.85 2 4706 AEV_1_3_RA2_01_1232.d 3.31E5 3 3 216 221
R.TTGLKNANDALK(+14.02).G Y 25.61 1258.6881 12 -2.8 420.5688 3 41.99 3 20637 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 51 62 Methylation(KR)
K.LIPE(+14.02)VIGR.E Y 24.99 909.5647 8 2.0 455.7905 2 70.44 3 40574 AEV_3_3_RA3_01_1233.d 2.7E5 1 1 187 194 Methylation(others)
R.IFEVSLADLQNDE(+14.02)DHAFRKVK.L Y 24.72 2487.2756 21 11.4 498.4681 5 81.53 3 49234 AEV_3_3_RA3_01_1233.d 9.15E4 1 1 65 85 Methylation(others)
K.KTTYAQ(+.98)SSQIR.A Y 24.61 1282.6517 11 -2.9 642.3313 2 23.95 3 9973 AEV_3_3_RA3_01_1233.d 3.26E4 2 2 152 162 Deamidation (NQ)
R.IFEVSLAD(+43.04)LQNDEDHAFRK.V Y 24.23 2289.1389 19 -70.3 573.2518 4 85.22 1 46011 AEV 2_3_RA2_01_1224.d 1.29E5 1 1 65 83 Carboxyl modification with ethanolamine
R.T(-18.01)TGLK(+14.02)NANDALK.G Y 23.77 1240.6775 12 -22.7 414.5571 3 32.78 3 15033 AEV_3_3_RA3_01_1233.d 6.27E4 1 1 51 62 Dehydration; Methylation(KR)
R.RPNQIKK.T Y 23.62 882.5399 7 -4.7 442.2751 2 8.80 2 2093 AEV_1_3_RA2_01_1232.d 1.39E4 2 2 146 152
K.LIPEVIGR(+14.02).E Y 22.92 909.5647 8 -34.9 455.7737 2 70.05 2 32886 AEV_1_3_RA2_01_1232.d 0 1 1 187 194 Methylation(KR)
R.EAGT(-18.01)R.S N 22.49 514.2499 5 7.1 515.2609 1 20.24 2 6503 AEV_1_3_RA2_01_1232.d 0 2 2 175 179 Dehydration
R.EAGTRSLAQLTK(+43.99).L Y 22.43 1317.6888 12 -28.1 330.4202 4 18.75 3 7163 AEV_3_3_RA3_01_1233.d 1.31E6 1 1 175 186 Carboxylation (DKW)
K.LRVD(+43.99)EVQGK.N Y 22.37 1086.5669 9 0.5 363.1964 3 30.37 3 13603 AEV_3_3_RA3_01_1233.d 2.14E5 1 1 86 94 Carboxylation (DKW)
R.T(+43.01)TGLKNANDALKGR.I Y 22.13 1500.8008 14 -107.9 376.1670 4 56.10 1 23893 AEV 2_3_RA2_01_1224.d 3.54E5 1 1 51 64 Carbamylation
R.EIEK(+43.01)ATHGIYPLQ(+.98)NVHIR.K Y 21.98 2161.1279 18 -13.8 541.2818 4 66.15 3 37188 AEV_3_3_RA3_01_1233.d 8.61E4 1 1 195 212 Carbamylation; Deamidation (NQ)
K.MVE(+14.02)IIQR.E Y 21.78 901.5055 7 -1.6 451.7593 2 62.18 3 34108 AEV_3_3_RA3_01_1233.d 2.57E5 1 1 168 174 Methylation(others)
K.LRVDEVQ(+.98)GK.N Y 21.73 1043.5610 9 0.2 522.7879 2 37.81 2 14426 AEV_1_3_RA2_01_1232.d 5.77E4 1 1 86 94 Deamidation (NQ)
K.KM(-48.00)VEIIQR.E Y 21.32 967.5814 8 0.8 323.5347 3 21.91 3 8846 AEV_3_3_RA3_01_1233.d 2.78E5 1 1 167 174 Dethiomethyl
K.WQTLIEAN(+.98)VT(+79.97)VK.T Y 21.22 1481.7167 12 -2.4 494.9117 3 57.24 3 30447 AEV_3_3_RA3_01_1233.d 1.43E5 1 1 117 128 Deamidation (NQ); Phosphorylation (STY)
R.S(+42.01)LAQLTK(+226.08).L Y 21.17 1027.5372 7 -2.8 1028.5416 1 91.09 2 47753 AEV_1_3_RA2_01_1232.d 0 1 1 180 186 Acetylation (N-term); Biotinylation
K.LIPEVIGR(+14.02)EIEK.A Y 21.01 1408.8289 12 -1.5 470.6162 3 75.21 2 36773 AEV_1_3_RA2_01_1232.d 1.26E5 1 1 187 198 Methylation(KR)
K.T(+42.01)LVNR.T Y 20.70 643.3653 5 -52.0 322.6732 2 16.13 3 5781 AEV_3_3_RA3_01_1233.d 0 1 1 46 50 Acetylation (N-term)
K.TTYAQSSQ(+.98)IR(+14.02).A Y 20.34 1168.5724 10 4.8 585.2963 2 49.34 2 20114 AEV_1_3_RA2_01_1232.d 5.2E4 1 1 153 162 Deamidation (NQ); Methylation(KR)
K.FDLGALLALHGESSTDDK.G Y 20.16 1887.9214 18 6.5 630.3185 3 83.25 3 50496 AEV_3_3_RA3_01_1233.d 9.49E4 1 1 222 239
R.SLAQ(+.98)LTK(+14.02).L Y 20.06 774.4487 7 -9.6 388.2279 2 52.83 3 27602 AEV_3_3_RA3_01_1233.d 4.17E4 1 1 180 186 Deamidation (NQ); Methylation(KR)
M(+15.99)AVGK(+43.01).N Y 19.29 563.2737 5 -0.7 564.2806 1 52.56 2 21756 AEV_1_3_RA2_01_1232.d 0 1 1 1 5 Oxidation (M); Carbamylation
M(+15.99)AVGK.N Y 19.26 520.2679 5 -39.0 521.2549 1 51.73 3 26872 AEV_3_3_RA3_01_1233.d 1.92E5 3 3 1 5 Oxidation (M)
R.TTGLKNANDALK(+14.02)GR.I Y 19.08 1471.8107 14 -11.1 368.9559 4 42.84 3 21176 AEV_3_3_RA3_01_1233.d 6.49E5 1 1 51 64 Methylation(KR)
K.T(-2.02)TDDYLLR.L Y 19.00 993.4767 8 13.2 497.7522 2 61.23 3 33395 AEV_3_3_RA3_01_1233.d 8.03E4 1 1 129 136 2-amino-3-oxo-butanoic_acid
K.WQTLIEANVT(-18.01)VK(+42.01).T Y 18.84 1424.7664 12 9.2 357.2021 4 50.14 3 25819 AEV_3_3_RA3_01_1233.d 0 1 1 117 128 Dehydration; Acetylation (K)
K.LR(+14.02)VDEVQGK.N Y 18.70 1056.5928 9 11.4 529.3097 2 35.99 3 16921 AEV_3_3_RA3_01_1233.d 5.45E5 1 1 86 94 Methylation(KR)
K.KMVEIIQR.E Y 18.65 1015.5848 8 -42.5 508.7781 2 48.85 3 25026 AEV_3_3_RA3_01_1233.d 5.26E4 1 1 167 174
R.DVGKTLVNR(+14.02).T Y 18.28 1014.5822 9 12.3 339.2055 3 37.88 3 18129 AEV_3_3_RA3_01_1233.d 2.43E5 1 1 42 50 Methylation(KR)
K.TLVNR(+14.02).T Y 18.11 615.3704 5 4.7 308.6939 2 23.98 2 8046 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 46 50 Methylation(KR)
R.IFEVSLAD(+14.02)LQNDEDHAFRK.V Y 17.88 2260.1123 19 -89.8 565.9846 4 89.22 1 49039 AEV 2_3_RA2_01_1224.d 2.48E5 1 1 65 83 Methylation(others)
R.KDEYSVKAPS(-2.02)TFAIR.D Y 17.75 1708.8784 15 -19.0 428.2188 4 64.32 3 35739 AEV_3_3_RA3_01_1233.d 1.95E4 1 1 27 41 2-amino-3-oxo-butanoic_acid
R.DVGKT(+79.96)LVNR.T Y 17.74 1080.5233 9 32.8 361.1935 3 28.00 3 12253 AEV_3_3_RA3_01_1233.d 1.17E4 1 1 42 50 Sulfation
R.S(+42.01)LAQLTK.L Y 17.72 801.4596 7 -24.5 401.7273 2 39.16 2 15064 AEV_1_3_RA2_01_1232.d 1.55E5 1 1 180 186 Acetylation (N-term)
K.T(+79.97)LVNR.T Y 17.66 681.3211 5 -197.1 682.1941 1 118.23 1 60866 AEV 2_3_RA2_01_1224.d 0 1 1 46 50 Phosphorylation (STY)
K.TTYAQSSQIR(+199.07).A Y 17.55 1352.6394 10 6.6 677.3314 2 69.60 2 32548 AEV_1_3_RA2_01_1232.d 4.33E4 1 1 153 162 Oxidized Arginine biotinylated with biotin hydrazide
R.T(+42.01)TGLKNANDALK(+42.01).G Y 17.42 1328.6936 12 -11.6 333.1768 4 33.67 3 15543 AEV_3_3_RA3_01_1233.d 0 1 1 51 62 Acetylation (N-term); Acetylation (K)
R.SLAQ(+.98)LT(-18.01)K.L Y 17.09 742.4225 7 -32.2 372.2066 2 19.61 2 6242 AEV_1_3_RA2_01_1232.d 1.48E5 1 1 180 186 Deamidation (NQ); Dehydration
R.TTGLKNAN(+.98)DALK(+42.01).G Y 16.85 1287.6670 12 0.0 430.2296 3 57.82 3 30818 AEV_3_3_RA3_01_1233.d 7.89E4 1 1 51 62 Deamidation (NQ); Acetylation (K)
K.NANDALK(+226.08).G Y 16.73 970.4542 7 -26.4 486.2216 2 23.78 1 6035 AEV 2_3_RA2_01_1224.d 1.54E4 1 1 56 62 Biotinylation
R.K(+14.02)WQTLIEANVTVK(+42.01).T Y 16.71 1584.8876 13 -44.8 397.2114 4 67.00 3 37857 AEV_3_3_RA3_01_1233.d 0 1 1 116 128 Methylation(KR); Acetylation (K)
R.EAGTR(-43.05).S N 16.47 489.2071 5 12.6 490.2205 1 55.07 1 23219 AEV 2_3_RA2_01_1224.d 2.47E5 1 1 175 179 Arginine oxidation to glutamic semialdehyde
R.T(+42.01)TGLKNANDALK.G Y 16.29 1286.6830 12 -29.7 644.3297 2 49.23 3 25235 AEV_3_3_RA3_01_1233.d 1.54E5 1 1 51 62 Acetylation (N-term)
K.FD(+43.99)LGALLALHGESSTDDKGQK.V Y 16.22 2245.0862 21 24.3 562.2925 4 80.32 2 40837 AEV_1_3_RA2_01_1232.d 0 1 1 222 242 Carboxylation (DKW)
K.GRIFEVSLADLQNDEDHAFRK(-.98).V Y 16.11 2458.2354 21 7.9 492.6582 5 78.16 2 39101 AEV_1_3_RA2_01_1232.d 0 1 1 63 83 Amidation
R.IFEVSLADLQNDEDHAFR(+14.02)KVK.L Y 15.93 2487.2756 21 15.3 622.8357 4 81.53 3 49236 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 65 85 Methylation(KR)
K.APSTFAIRDVGK(+114.04).T Y 15.92 1374.7255 12 -104.8 688.2980 2 67.84 1 32306 AEV 2_3_RA2_01_1224.d 0 1 1 34 45 Ubiquitin
K.KRTQDPFSR.K Y 15.84 1133.5941 9 -10.5 567.7984 2 20.72 3 8203 AEV_3_3_RA3_01_1233.d 3.29E4 1 1 18 26
R.TTGLKNANDALK(+43.01)GR(+14.02).I Y 15.51 1514.8165 14 0.4 505.9463 3 33.45 3 15408 AEV_3_3_RA3_01_1233.d 7.63E4 1 1 51 64 Carbamylation; Methylation(KR)
R.TTGLK.N Y 15.27 518.3064 5 -53.5 519.2859 1 67.15 3 37977 AEV_3_3_RA3_01_1233.d 0 1 1 51 55
R.IFEVS(-2.02)LADLQNDEDHAFR.K Y 15.21 2115.9861 18 59.3 706.3778 3 82.94 2 42831 AEV_1_3_RA2_01_1232.d 4.93E4 1 1 65 82 2-amino-3-oxo-butanoic_acid
total 152 peptides
C1G712
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.KPEVTSDGEQAGDEEAKSK.S Y 133.05 2003.9282 19 5.9 501.9923 4 24.47 2 8256 AEV_1_3_RA2_01_1232.d 2.39E6 15 15 480 498
K.KPEEALEASAVEANASPATK.D Y 131.14 2012.0061 20 2.8 671.6779 3 61.21 2 26694 AEV_1_3_RA2_01_1232.d 1.07E6 5 5 444 463
K.ANDKVEKKPEEALEASAVEANASPATK.D Y 131.12 2796.4141 27 6.7 560.2938 5 61.19 2 26723 AEV_1_3_RA2_01_1232.d 7.2E5 3 3 437 463
K.DKETAPAATPAESEPIPEGAEKPEPVSK.D Y 126.74 2874.4133 28 0.7 719.6111 4 61.32 3 33476 AEV_3_3_RA3_01_1233.d 5.18E5 3 3 522 549
K.EKKPEVTSDGEQAGDEEAKSK.S Y 124.68 2261.0659 21 0.7 566.2742 4 22.55 3 9235 AEV_3_3_RA3_01_1233.d 3.18E6 13 13 478 498
K.LSIAHPTAAWASQTGK.G Y 119.39 1637.8525 16 4.4 546.9605 3 66.38 2 30222 AEV_1_3_RA2_01_1232.d 6.87E5 4 4 113 128
R.EKETVTSSEGYKAELEK.L Y 116.88 1926.9421 17 3.6 482.7446 4 47.33 2 19108 AEV_1_3_RA2_01_1232.d 1.31E6 8 8 199 215
K.LTKPPVVAAAAPK.K Y 114.15 1261.7758 13 4.5 421.6011 3 55.44 2 23228 AEV_1_3_RA2_01_1232.d 2.47E6 10 10 216 228
K.KPEAKPESPTAGR.S Y 112.50 1366.7205 13 6.9 456.5839 3 15.46 2 4520 AEV_1_3_RA2_01_1232.d 1.76E6 8 8 326 338
K.KPEEALEASAVEANASPATKDK.R Y 111.08 2255.1279 22 3.4 564.7912 4 58.39 2 24870 AEV_1_3_RA2_01_1232.d 4.31E5 4 4 444 465
R.AEDKATPTGIVNLADISDIVKESGHEFQFK.V Y 108.16 3258.6406 30 -6.4 652.7312 5 85.26 3 51874 AEV_3_3_RA3_01_1233.d 9.43E4 1 1 137 166
K.RAEDKATPTGIVNLADISDIVK.E Y 106.04 2325.2539 22 2.5 582.3222 4 80.41 2 40889 AEV_1_3_RA2_01_1232.d 2.41E5 2 2 136 157
K.EKKPEVTSDGEQAGDEEAK.S Y 105.32 2045.9388 19 3.8 682.9895 3 24.10 3 10057 AEV_3_3_RA3_01_1233.d 8.61E5 6 6 478 496
K.ATPTGIVNLADISDIVK.E Y 105.22 1725.9512 17 -0.7 863.9822 2 85.73 3 52187 AEV_3_3_RA3_01_1233.d 6.65E5 5 5 141 157
K.ATPTGIVNLADISDIVKESGHEFQFK.V Y 103.63 2815.4392 26 1.3 704.8680 4 87.27 2 45783 AEV_1_3_RA2_01_1232.d 9.57E5 3 3 141 166
K.HVFQAGSDDERASWIAALEAK.A Y 102.26 2300.1184 21 12.7 576.0442 4 77.02 3 45743 AEV_3_3_RA3_01_1233.d 1.34E5 3 3 172 192
K.KPEVTSDGEQAGDEEAK.S Y 101.86 1788.8013 17 1.9 597.2755 3 25.30 3 10761 AEV_3_3_RA3_01_1233.d 7.61E5 9 9 480 496
K.EGEEPVASPTSAK.N Y 100.24 1300.6146 13 3.9 651.3171 2 34.85 2 13046 AEV_1_3_RA2_01_1232.d 9.16E5 5 5 407 419
R.AEDKATPTGIVNLADISDIVK.E Y 93.75 2169.1528 21 2.4 724.0599 3 82.99 2 42865 AEV_1_3_RA2_01_1232.d 1.04E5 2 2 137 157
K.VSNQDKVEKDSAVK.N Y 91.46 1545.7998 14 1.0 773.9080 2 15.94 3 5628 AEV_3_3_RA3_01_1233.d 1.84E6 9 9 352 365
K.DTPAEPTAAVNGSEAPEEIKDDAAAVPAASSSQPVQAAA Y 89.39 3732.7600 39 0.8 1245.2616 3 77.42 3 46038 AEV_3_3_RA3_01_1233.d 2.26E5 3 3 550 588
R.TSLFGTLGKK.E Y 89.23 1050.6073 10 1.7 526.3118 2 62.14 2 27283 AEV_1_3_RA2_01_1232.d 4.03E6 9 9 468 477
K.TEGKEEPEVAAPAVETSAPVAEAAETPVPTPAAEEPKAEEK.K Y 89.08 4156.0220 41 1.9 1040.0148 4 73.22 3 42756 AEV_3_3_RA3_01_1233.d 1.51E5 2 2 285 325
R.FFWFSDDAVEVK.Q Y 87.45 1488.6925 12 5.6 745.3577 2 85.60 3 52147 AEV_3_3_RA3_01_1233.d 1.36E5 2 2 91 102
K.HVFQAGSDDER.A Y 84.54 1259.5530 11 2.2 630.7852 2 26.36 3 11350 AEV_3_3_RA3_01_1233.d 3.94E5 4 4 172 182
K.KPEVTSDGEQAGDE(+14.02)EAKSK.S Y 83.57 2017.9440 19 1.6 505.4941 4 27.96 3 12232 AEV_3_3_RA3_01_1233.d 1.35E5 2 2 480 498 Methylation(others)
K.RASIFGNIFHK.V Y 81.35 1288.7040 11 1.3 430.5758 3 70.68 2 33355 AEV_1_3_RA2_01_1232.d 8.27E5 6 6 341 351
K.SKSSASSPLPK.L Y 81.21 1087.5873 11 2.7 544.8024 2 18.78 2 5898 AEV_1_3_RA2_01_1232.d 1.59E5 3 3 497 507
K.ESGHEFQFK.V Y 79.66 1107.4985 9 2.3 554.7578 2 39.63 3 19172 AEV_3_3_RA3_01_1233.d 4.69E5 4 4 158 166
K.RFFWFSDDAVEVK.Q Y 79.61 1644.7936 13 8.3 549.2764 3 82.06 2 42179 AEV_1_3_RA2_01_1232.d 1.98E4 1 1 90 102
R.ASWIAALEAK.A Y 79.44 1058.5760 10 0.2 530.2954 2 77.70 2 38727 AEV_1_3_RA2_01_1232.d 8.65E5 6 6 183 192
K.K(+14.02)PEVTSDGEQAGDEEAKSK.S Y 76.41 2017.9440 19 1.1 505.4938 4 25.10 3 10636 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 480 498 Methylation(KR)
K.K(+14.02)PEEALEASAVEANASPATK.D Y 74.69 2026.0217 20 -0.9 676.3472 3 63.64 3 35228 AEV_3_3_RA3_01_1233.d 3.03E5 3 3 444 463 Methylation(KR)
K.KPEVTSDGEQAGDEE(+14.02)AKSK.S Y 73.18 2017.9440 19 3.3 505.4949 4 33.66 2 12440 AEV_1_3_RA2_01_1232.d 9.12E4 1 1 480 498 Methylation(others)
K.EKKPEVTS(+79.97)DGEQAGDEEAKSK.S Y 70.66 2341.0322 21 0.8 781.3520 3 26.55 3 11445 AEV_3_3_RA3_01_1233.d 2.97E5 2 2 478 498 Phosphorylation (STY)
R.RTSLFGTLGKK.E Y 70.36 1206.7084 11 2.7 403.2445 3 56.87 2 24035 AEV_1_3_RA2_01_1232.d 5.86E5 6 6 467 477
K.ETVTSSEGYKAELEK.L Y 70.35 1669.8046 15 2.5 835.9116 2 51.49 3 26712 AEV_3_3_RA3_01_1233.d 2.77E5 2 2 201 215
R.ASIFGNIFHK.V Y 70.34 1132.6029 10 2.4 378.5425 3 75.87 2 37319 AEV_1_3_RA2_01_1232.d 4.37E6 8 8 342 351
R.ASIFGSFLGK.K Y 66.20 1025.5546 10 -3.1 513.7830 2 80.96 3 48808 AEV_3_3_RA3_01_1233.d 6.52E5 6 6 266 275
K.KPEVTSDGEQ(+.98)AGDEEAKSK.S Y 65.26 2004.9124 19 -3.1 669.3093 3 24.91 3 10519 AEV_3_3_RA3_01_1233.d 4.97E4 1 1 480 498 Deamidation (NQ)
K.KPEVT(+79.97)SDGEQAGDEEAKSK.S Y 65.21 2083.8945 19 4.9 695.6422 3 27.66 3 12050 AEV_3_3_RA3_01_1233.d 6.27E4 1 1 480 498 Phosphorylation (STY)
K.Q(-17.03)LAAYFQNEK.L Y 65.20 1193.5717 10 2.9 597.7949 2 79.81 2 40410 AEV_1_3_RA2_01_1232.d 5.28E5 3 3 103 112 Pyro-glu from Q
K.QLAAYFQNEK.L Y 64.74 1210.5981 10 4.1 606.3088 2 63.64 2 28313 AEV_1_3_RA2_01_1232.d 4.08E5 2 2 103 112
K.NSFLNFIK.K Y 64.39 981.5283 8 2.5 491.7726 2 79.67 2 40322 AEV_1_3_RA2_01_1232.d 2.71E6 6 6 420 427
K.SSASSPLPK.L Y 63.92 872.4603 9 -0.9 437.2371 2 25.64 3 10965 AEV_3_3_RA3_01_1233.d 6.2E6 11 11 499 507
K.N(+.98)SFLNFIK.K Y 62.11 982.5123 8 1.3 492.2641 2 84.83 3 51578 AEV_3_3_RA3_01_1233.d 4.09E5 4 4 420 427 Deamidation (NQ)
R.TSLFGTLGK.K Y 60.00 922.5123 9 0.3 462.2636 2 70.93 2 33540 AEV_1_3_RA2_01_1232.d 4.92E5 2 2 468 476
K.EKKPEVT(+79.97)SDGEQAGDEEAKSK.S Y 59.90 2341.0322 21 3.5 586.2674 4 27.72 2 9690 AEV_1_3_RA2_01_1232.d 5.96E5 2 2 478 498 Phosphorylation (STY)
K.NSFLNFIK(+14.02).K Y 59.48 995.5440 8 2.2 498.7804 2 82.06 2 42170 AEV_1_3_RA2_01_1232.d 8E4 1 1 420 427 Methylation(KR)
K.ANDKVEK(+14.02)KPEEALEASAVEANASPATK.D Y 57.58 2810.4297 27 4.4 563.0957 5 63.10 2 27950 AEV_1_3_RA2_01_1232.d 2.06E5 1 1 437 463 Methylation(KR)
K.ANDK(+14.02)VEKKPEEALEASAVEANASPATK.D Y 57.25 2810.4297 27 -4.1 563.0909 5 62.39 3 34268 AEV_3_3_RA3_01_1233.d 3.89E5 1 1 437 463 Methylation(KR)
K.NSFLNFIKK.H Y 56.80 1109.6233 9 2.0 370.8824 3 72.38 2 34673 AEV_1_3_RA2_01_1232.d 1.3E6 4 4 420 428
K.LGGVFHR.V Y 56.58 784.4344 7 -0.5 393.2243 2 36.54 3 17285 AEV_3_3_RA3_01_1233.d 3.42E6 11 11 508 514
K.EKKPEVT(+14.02)SDGEQAGDEEAKSK.S Y 55.90 2275.0815 21 0.1 456.0237 5 27.37 3 11877 AEV_3_3_RA3_01_1233.d 3.51E5 2 2 478 498 Methylation(others)
K.NTETHVSSTAPQLGDPVDVSTSEPTKPETVTAAAEPPQPAKEGEEPVASPTSAK.N Y 55.69 5466.6436 54 -1.7 1094.3341 5 72.06 2 34396 AEV_1_3_RA2_01_1232.d 5.11E5 2 2 366 419
K.KPEEALEASAVEANASPATKDK(+14.02).R Y 55.31 2269.1438 22 -2.0 568.2921 4 59.58 3 32102 AEV_3_3_RA3_01_1233.d 1.89E5 1 1 444 465 Methylation(KR)
K.KPEEALEASAVE(+14.02)ANASPATK.D Y 54.80 2026.0217 20 3.6 676.3503 3 64.79 2 29103 AEV_1_3_RA2_01_1232.d 1.71E5 2 2 444 463 Methylation(others)
R.ASIFGSFLGK(+14.02).K Y 52.08 1039.5702 10 3.0 520.7939 2 81.81 2 41985 AEV_1_3_RA2_01_1232.d 1.41E5 2 2 266 275 Methylation(KR)
R.ASIFGSFLGKK.E Y 50.52 1153.6495 11 2.0 385.5579 3 75.24 2 36795 AEV_1_3_RA2_01_1232.d 4.52E5 4 4 266 276
K.Q(-17.03)LAAYFQ(+.98)NEKLSIAHPTAAWASQTGK.G Y 49.98 2814.3977 26 -11.4 939.1292 3 82.58 2 42559 AEV_1_3_RA2_01_1232.d 2.14E4 1 1 103 128 Pyro-glu from Q; Deamidation (NQ)
K.GLLFYAK.R Y 49.60 810.4639 7 -14.0 811.4598 1 71.44 2 33928 AEV_1_3_RA2_01_1232.d 2.28E6 6 6 129 135
K.ANDKVEK(-1.03)KPEEALEASAVEANASPATKDK.R Y 49.36 3038.5044 29 27.8 608.7250 5 59.42 2 25502 AEV_1_3_RA2_01_1232.d 0 1 1 437 465 Lysine oxidation to aminoadipic semialdehyde
K.QLAAYFQNEKLSIAHPTAAWASQTGK.G Y 49.01 2830.4402 26 16.9 708.6293 4 77.45 2 38530 AEV_1_3_RA2_01_1232.d 0 1 1 103 128
K.KPEAKPESPT(-18.01)AGR.S Y 47.25 1348.7098 13 2.6 338.1856 4 14.43 3 4815 AEV_3_3_RA3_01_1233.d 2.17E6 3 3 326 338 Dehydration
K.TEGKEEPEVAAPAVETSAPVAEAAETPVPTPAAEEPK.A Y 47.04 3698.8049 37 4.7 1233.9480 3 76.19 2 37547 AEV_1_3_RA2_01_1232.d 3.3E4 1 1 285 321
K.Q(-17.03)LAAYFQ(+.98)NEK.L Y 46.18 1194.5557 10 -72.4 598.2419 2 82.73 1 43970 AEV 2_3_RA2_01_1224.d 0 1 1 103 112 Pyro-glu from Q; Deamidation (NQ)
K.EGEE(+14.02)PVASPTSAK.N Y 45.26 1314.6302 13 1.3 658.3232 2 43.88 3 21840 AEV_3_3_RA3_01_1233.d 1.08E5 2 2 407 419 Methylation(others)
K.SSASSPLP(+13.98)K.L Y 43.47 886.4396 9 -46.4 444.2065 2 55.16 1 23270 AEV 2_3_RA2_01_1224.d 3.23E5 1 1 499 507 Proline oxidation to pyroglutamic acid
K.L(+41.03)TKPPVVAAAAPK.K Y 42.24 1302.8022 13 -79.2 435.2403 3 52.74 3 27544 AEV_3_3_RA3_01_1233.d 0 1 1 216 228 Amidination of lysines or N-terminal amines with methyl acetimidate
K.E(-18.01)KK(+14.02)PEVTSDGEQAGDEEAKSK.S Y 42.01 2257.0708 21 84.9 565.3229 4 22.46 3 9132 AEV_3_3_RA3_01_1233.d 0 1 1 478 498 Pyro-glu from E; Methylation(KR)
K.DKETAPAATPAE(+14.02)SEPIPEGAEKPEPVSK.D Y 41.84 2888.4290 28 -0.4 723.1143 4 63.34 2 28109 AEV_1_3_RA2_01_1232.d 7.81E4 1 1 522 549 Methylation(others)
K.ETVTSSEGYK.A Y 41.69 1099.5033 10 -59.1 550.7264 2 35.01 1 11690 AEV 2_3_RA2_01_1224.d 0 1 1 201 210
K.EKKPEVTSDGE(+14.02)QAGDEEAK.S Y 41.38 2059.9546 19 2.1 515.9970 4 30.49 3 13677 AEV_3_3_RA3_01_1233.d 1.93E5 1 1 478 496 Methylation(others)
K.E(+14.02)GEEPVASPTSAK.N Y 41.23 1314.6302 13 10.9 658.3296 2 41.03 2 15966 AEV_1_3_RA2_01_1232.d 2.9E5 5 5 407 419 Methylation(others)
K.KPEAK(+14.02)PESPTAGR.S Y 38.86 1380.7361 13 3.5 461.2542 3 18.76 2 5886 AEV_1_3_RA2_01_1232.d 6.41E4 1 1 326 338 Methylation(KR)
K.N(+43.01)SFLNFIKK.H Y 38.85 1152.6292 9 22.6 385.2257 3 71.39 3 41322 AEV_3_3_RA3_01_1233.d 0 1 1 420 428 Carbamylation
K.AN(-17.03)DKVEKKPEEALEASAVEANASPATK.D Y 38.61 2779.3875 27 3.8 695.8568 4 65.21 2 29394 AEV_1_3_RA2_01_1232.d 4.44E4 1 1 437 463 Ammonia-loss (N)
R.TSLFGTLGK(+14.02)K.E Y 38.05 1064.6229 10 -6.9 355.8792 3 62.49 3 34344 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 468 477 Methylation(KR)
K.R(+88.00)RTSLFGTLGKK.E Y 37.96 1450.8079 12 2.2 363.7100 4 60.57 3 32844 AEV_3_3_RA3_01_1233.d 5.71E4 1 1 466 477 3-sulfanylpropanoyl
K.NSFLN(+.98)FIKK.H Y 37.75 1110.6073 9 0.4 556.3112 2 72.39 2 34645 AEV_1_3_RA2_01_1232.d 0 1 1 420 428 Deamidation (NQ)
R.ASWIAALEAK(+14.02).A Y 37.52 1072.5917 10 1.0 537.3036 2 81.22 2 41526 AEV_1_3_RA2_01_1232.d 8.98E4 3 3 183 192 Methylation(KR)
K.EKKPEVTSDGEQAGDEEAK(+14.02)SK.S Y 37.27 2275.0815 21 -1.8 569.7766 4 26.57 3 11484 AEV_3_3_RA3_01_1233.d 0 1 1 478 498 Methylation(KR)
R.FFWFSDDAVEVKQLAAYFQNEK.L Y 36.88 2681.2800 22 5.2 894.7720 3 91.64 3 55618 AEV_3_3_RA3_01_1233.d 5.42E4 1 1 91 112
K.KPEVTSDGE(+14.02)QAGDEEAKSK.S Y 36.82 2017.9440 19 2.3 505.4944 4 30.49 2 10927 AEV_1_3_RA2_01_1232.d 2.38E4 1 1 480 498 Methylation(others)
K.EGE(+14.02)EPVASPTSAK.N Y 35.67 1314.6302 13 2.5 658.3240 2 43.05 3 21321 AEV_3_3_RA3_01_1233.d 1.39E5 1 1 407 419 Methylation(others)
R.EK(+14.02)ETVTSSEGYKAELEK.L Y 35.66 1940.9578 17 2.0 647.9945 3 48.81 3 24963 AEV_3_3_RA3_01_1233.d 6.2E4 1 1 199 215 Methylation(KR)
K.KPEVTSDGEQAGD(-18.01)EEAK(+14.02)SK.S Y 34.65 1999.9333 19 41.4 501.0113 4 24.53 2 8284 AEV_1_3_RA2_01_1232.d 0 1 1 480 498 Dehydration; Methylation(KR)
K.LTKPPVVAAAAPKK.S Y 34.43 1389.8707 14 -61.1 464.2692 3 41.44 3 20324 AEV_3_3_RA3_01_1233.d 9.51E4 2 2 216 229
K.KPEVTSDGEQAGDEEAK(+14.02)SK(-.98).S Y 34.36 2016.9600 19 -7.5 505.2435 4 29.46 3 13079 AEV_3_3_RA3_01_1233.d 2.78E5 2 2 480 498 Methylation(KR); Amidation
K.EK(+14.02)KPEVTSDGEQAGDEEAKSK.S Y 33.69 2275.0815 21 -4.9 456.0214 5 23.63 3 9769 AEV_3_3_RA3_01_1233.d 7.41E4 1 1 478 498 Methylation(KR)
K.KPEVTSDGEQAGDEEAK(+14.02)SK.S Y 33.41 2017.9440 19 14.7 505.5007 4 31.33 2 11330 AEV_1_3_RA2_01_1232.d 6.08E4 1 1 480 498 Methylation(KR)
K.ANDKVEKK(+14.02)PEEALEAS(-18.01)AVEANASPATK.D Y 33.23 2792.4192 27 -8.4 699.1062 4 60.40 3 32714 AEV_3_3_RA3_01_1233.d 0 1 1 437 463 Methylation(KR); Dehydration
K.DKETAPAATPAESEPIPEGAEK(+14.02)PEPVSK.D Y 32.02 2888.4290 28 -4.6 723.1112 4 62.94 2 27845 AEV_1_3_RA2_01_1232.d 3.96E4 1 1 522 549 Methylation(KR)
K.K(+42.01)(+210.20)PEVTSDGEQAGDEEAKSK.S Y 30.03 2256.1372 19 -11.6 452.2295 5 23.99 2 8055 AEV_1_3_RA2_01_1232.d 0 1 1 480 498 Acetylation (N-term); Myristoylation
K.KPEEALEAS(-2.02)AVEANASPATKDK.R Y 29.09 2253.1123 22 -29.7 564.2686 4 57.45 3 30552 AEV_3_3_RA3_01_1233.d 1.76E4 1 1 444 465 2-amino-3-oxo-butanoic_acid
K.VSNQDK.V Y 28.72 689.3344 6 -94.2 690.2767 1 79.15 1 41165 AEV 2_3_RA2_01_1224.d 0 2 2 352 357
R.ASIFGN(+.98)IFHK.V Y 28.65 1133.5869 10 5.2 378.8716 3 77.89 2 38881 AEV_1_3_RA2_01_1232.d 7.11E4 2 2 342 351 Deamidation (NQ)
R.EKETVTSSEGY(+79.97)K.A Y 28.64 1436.6072 12 -66.8 719.2629 2 55.50 1 23493 AEV 2_3_RA2_01_1224.d 1.38E5 1 1 199 210 Phosphorylation (STY)
K.Q(-17.03)LAAYFQNEKLSIAHPTAAWASQTGK.G Y 28.15 2813.4136 26 3.0 704.3628 4 82.60 2 42581 AEV_1_3_RA2_01_1232.d 9.4E4 1 1 103 128 Pyro-glu from Q
K.GLLFYAK(+14.02).R Y 27.26 824.4796 7 -86.9 413.2112 2 82.45 1 43747 AEV 2_3_RA2_01_1224.d 1.74E5 2 2 129 135 Methylation(KR)
K.KPEAKPESPTAGR(+14.02).S Y 26.81 1380.7361 13 -24.2 461.2415 3 19.73 2 6291 AEV_1_3_RA2_01_1232.d 0 1 1 326 338 Methylation(KR)
R.TSLFGTLGKKEK.K Y 26.76 1307.7449 12 0.2 327.9436 4 51.17 3 26486 AEV_3_3_RA3_01_1233.d 2.97E5 1 1 468 479
K.SPGLVK.G Y 26.53 599.3643 6 0.7 300.6896 2 19.34 3 7479 AEV_3_3_RA3_01_1233.d 1.89E5 3 3 78 83
K.LT(-2.02)KPPVVAAAAPK.K Y 26.50 1259.7601 13 -80.1 420.8937 3 52.24 3 27209 AEV_3_3_RA3_01_1233.d 1E5 1 1 216 228 2-amino-3-oxo-butanoic_acid
R.EKETVT(-18.01)SSEGYK.A Y 26.47 1338.6302 12 -50.6 670.2885 2 54.29 1 22737 AEV 2_3_RA2_01_1224.d 1.14E5 1 1 199 210 Dehydration
R.ASIFGNIFHK(+14.02).V Y 25.64 1146.6185 10 -2.9 383.2123 3 73.96 3 43348 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 342 351 Methylation(KR)
K.AAEAK.R N 24.60 488.2594 5 -38.8 489.2478 1 57.21 3 30369 AEV_3_3_RA3_01_1233.d 0 1 1 193 197
K.V(+42.01)SN(+.98)QDK.V Y 24.54 732.3290 6 -49.3 733.3002 1 83.09 1 44276 AEV 2_3_RA2_01_1224.d 2.64E4 1 1 352 357 Acetylation (N-term); Deamidation (NQ)
K.E(+28.03)GEEPVASPTSAK.N Y 24.29 1328.6459 13 2.6 665.3319 2 49.11 3 25156 AEV_3_3_RA3_01_1233.d 4.46E4 1 1 407 419 Ethylation
K.K(+42.01)(+42.01)PEQK(+42.01)EKSR.S Y 24.15 1254.6567 9 -37.0 419.2107 3 20.76 3 8220 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 251 259 Acetylation (N-term); Acetylation (K)
K.V(+42.01)AGHK.H Y 23.89 552.3020 5 -161.3 553.2202 1 39.62 1 14191 AEV 2_3_RA2_01_1224.d 3.34E4 1 1 167 171 Acetylation (N-term)
K.LTKPPVVAAAAPK(+14.02).K Y 23.60 1275.7914 13 -30.0 426.2583 3 59.87 2 25791 AEV_1_3_RA2_01_1232.d 0 1 1 216 228 Methylation(KR)
K.KPEVTSDGEQAGDEEAK(+14.02).S Y 23.05 1802.8169 17 -85.0 601.8951 3 46.68 1 18284 AEV 2_3_RA2_01_1224.d 2.63E5 1 1 480 496 Methylation(KR)
K.KPEEALEASAVEAN(+.98)ASPATK.D Y 22.87 2012.9901 20 3.3 672.0062 3 63.06 2 27923 AEV_1_3_RA2_01_1232.d 2.46E4 1 1 444 463 Deamidation (NQ)
K.SSASSPLPK(+14.02)LGGVFHR.V Y 22.86 1652.8998 16 6.0 414.2347 4 39.61 2 15283 AEV_1_3_RA2_01_1232.d 2.29E5 1 1 499 514 Methylation(KR)
K.AEEKKPEAKPESPTAGR.S Y 21.99 1823.9376 17 -85.8 456.9526 4 33.86 1 11117 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 322 338
R.T(+42.01)SLFGTLGK(+42.01).K Y 21.23 1006.5335 9 -33.0 504.2574 2 22.35 2 7371 AEV_1_3_RA2_01_1232.d 1.19E4 1 1 468 476 Acetylation (N-term); Acetylation (K)
K.KPEAKPES(-18.01)PTAGR.S Y 21.17 1348.7098 13 5.6 338.1866 4 15.86 2 4688 AEV_1_3_RA2_01_1232.d 5.29E5 1 1 326 338 Dehydration
K.L(+42.01)GGVFHR.V Y 21.15 826.4449 7 -13.2 414.2243 2 37.16 3 17691 AEV_3_3_RA3_01_1233.d 0 1 1 508 514 Acetylation (N-term)
R.ASWIAALE(+43.99)AKAAEAK.R Y 21.14 1572.8147 15 -11.4 394.2065 4 45.66 3 22966 AEV_3_3_RA3_01_1233.d 8.79E4 1 1 183 197 Carboxylation (E)
K.R(+14.02)ASIFGNIFHK.V Y 21.01 1302.7196 11 -16.9 435.2398 3 61.24 3 33378 AEV_3_3_RA3_01_1233.d 0 1 1 341 351 Methylation(KR)
K.LT(-18.01)KPPVVAAAAPK.K Y 20.91 1243.7651 13 -12.2 1244.7572 1 100.96 3 59383 AEV_3_3_RA3_01_1233.d 5.59E4 1 1 216 228 Dehydration
K.KEPAK(+21.98).A Y 20.85 593.3149 5 -18.9 594.3109 1 17.19 3 6318 AEV_3_3_RA3_01_1233.d 0 1 1 234 238 Sodium adduct
R.EKETVTSSEGYKAELEK(+14.02).L Y 20.79 1940.9578 17 7.5 486.2504 4 53.71 2 22349 AEV_1_3_RA2_01_1232.d 0 1 1 199 215 Methylation(KR)
K.SS(+13.03)ASSPLPKLGGVFHR.V Y 20.52 1651.9158 16 -4.3 413.9844 4 39.82 2 15375 AEV_1_3_RA2_01_1232.d 2.79E5 1 1 499 514 Michael addition with methylamine
K.R(+14.02)RTS(+79.97)LFGT(+79.97)LGK.K Y 20.22 1408.6628 11 45.7 353.1891 4 44.34 2 17612 AEV_1_3_RA2_01_1232.d 1.58E5 1 1 466 476 Methylation(KR); Phosphorylation (STY)
K.R(+14.02)RT(+79.97)SLFGTLGKK(+42.01).E Y 19.99 1498.8021 12 30.8 375.7193 4 49.94 3 25697 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 466 477 Methylation(KR); Phosphorylation (STY); Acetylation (K)
K.V(+27.99)SNQDK.V Y 19.87 717.3293 6 -77.9 718.2808 1 112.00 1 59331 AEV 2_3_RA2_01_1224.d 1.33E5 1 1 352 357 Formylation
K.KP(+13.98)EEALEASAVEANASPATK.D Y 19.84 2025.9854 20 -69.8 676.2886 3 70.75 1 34533 AEV 2_3_RA2_01_1224.d 8.45E4 1 1 444 463 Proline oxidation to pyroglutamic acid
K.HVFQAGSDDERASWIAALEAK(+14.02).A Y 19.83 2314.1340 21 27.0 579.5564 4 79.40 3 47598 AEV_3_3_RA3_01_1233.d 8.77E4 2 2 172 192 Methylation(KR)
K.K(+226.08)PEVT(+79.97)SDGEQAGDEEAK.S Y 19.47 2094.8452 17 -24.5 524.7057 4 31.37 1 9731 AEV 2_3_RA2_01_1224.d 0 1 1 480 496 Biotinylation; Phosphorylation (STY)
K.N(+.98)SFLN(+.98)FIK.K Y 19.44 983.4963 8 -47.3 492.7322 2 85.73 1 46362 AEV 2_3_RA2_01_1224.d 2.31E4 1 1 420 427 Deamidation (NQ)
R.EKETVTSSEGYK(+226.08).A Y 19.32 1582.7185 12 -55.0 792.3230 2 71.84 1 35379 AEV 2_3_RA2_01_1224.d 4.26E4 1 1 199 210 Biotinylation
K.N(+.98)SFLNFIKK.H Y 19.23 1110.6073 9 -0.8 371.2094 3 77.85 3 46382 AEV_3_3_RA3_01_1233.d 3.11E4 1 1 420 428 Deamidation (NQ)
K.KE(+21.98)EKT(+79.97)EGK.E Y 19.01 1049.4406 8 -88.2 525.6813 2 53.58 1 22285 AEV 2_3_RA2_01_1224.d 1.15E6 1 1 281 288 Sodium adduct; Phosphorylation (STY)
K.AELEK(+14.02).L N 18.19 602.3275 5 1.4 302.1714 2 11.49 3 3242 AEV_3_3_RA3_01_1233.d 1.84E5 1 1 211 215 Methylation(KR)
K.K(+43.99)PEQKEK.S Y 18.11 929.4818 7 -0.9 930.4882 1 87.67 2 46010 AEV_1_3_RA2_01_1232.d 4.67E4 1 1 251 257 Carboxylation (DKW)
K.EGEEPVAS(-18.01)PT(+79.97)SAK.N Y 17.94 1362.5704 13 24.7 341.6583 4 35.46 1 11916 AEV 2_3_RA2_01_1224.d 1.72E5 1 1 407 419 Dehydration; Phosphorylation (STY)
K.REKETVTSS(-18.01)EGYK(+14.02).A Y 17.90 1508.7471 13 5.7 378.1962 4 49.53 2 20210 AEV_1_3_RA2_01_1232.d 0 1 1 198 210 Dehydration; Methylation(KR)
MSEVR.K N 17.85 620.2952 5 9.3 621.3082 1 99.03 3 58746 AEV_3_3_RA3_01_1233.d 0 1 1 1 5
K.K(+28.03)PEEALEASAVEANASPATK.D Y 17.71 2040.0375 20 -2.8 511.0152 4 56.33 3 29744 AEV_3_3_RA3_01_1233.d 0 1 1 444 463 Dimethylation(KR)
R.AEDKATPTGIVNLADIS(-18.01)DIVK.E Y 17.50 2151.1423 21 -8.4 538.7883 4 79.46 3 47648 AEV_3_3_RA3_01_1233.d 0 1 1 137 157 Dehydration
K.RASIFGS(+79.97)FLGK(+42.01).K Y 17.33 1303.6326 11 -5.0 652.8203 2 58.10 3 31017 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 265 275 Phosphorylation (STY); Acetylation (K)
K.RASIFGS(+79.97)FLGK(+14.02).K Y 17.30 1275.6376 11 13.3 426.2255 3 14.40 3 4781 AEV_3_3_RA3_01_1233.d 0 1 1 265 275 Phosphorylation (STY); Methylation(KR)
K.AAEAK(+21.98).R N 17.21 510.2414 5 -59.2 511.2184 1 58.58 1 25488 AEV 2_3_RA2_01_1224.d 1.92E6 1 1 193 197 Sodium adduct
R.EKETVTSSEGY(+79.97)KAELEK(+226.08).L Y 16.99 2232.9861 17 -6.6 559.2501 4 86.32 1 46817 AEV 2_3_RA2_01_1224.d 5.06E4 1 1 199 215 Phosphorylation (STY); Biotinylation
K.S(+42.01)PGLVK(+28.03).G Y 16.98 669.4061 6 -75.2 670.3630 1 111.60 1 59214 AEV 2_3_RA2_01_1224.d 6.09E5 1 1 78 83 Acetylation (N-term); Dimethylation(KR)
K.K(+14.02)PEVTSD(-18.01)GEQAGDEEAK.S Y 16.78 1784.8064 17 -93.7 595.8870 3 38.19 1 13390 AEV 2_3_RA2_01_1224.d 2.92E4 1 1 480 496 Methylation(KR); Dehydration
K.EIKAN(+.98)DK(+42.01)VEK.K Y 16.71 1215.6346 10 19.2 304.9218 4 12.19 3 3596 AEV_3_3_RA3_01_1233.d 4.42E5 1 1 434 443 Deamidation (NQ); Acetylation (K)
K.E(-18.01)K(+14.02)KPEVTSDGEQAGDEEAKSK.S Y 16.63 2257.0708 21 -12.6 565.2679 4 23.63 2 7896 AEV_1_3_RA2_01_1232.d 1.16E4 1 1 478 498 Pyro-glu from E; Methylation(KR)
R.ASIFGS(+79.97)FLGKK(+14.02)EEEK(+42.01).K Y 16.59 1804.8647 15 12.8 452.2292 4 60.55 2 26242 AEV_1_3_RA2_01_1232.d 6.07E4 1 1 266 280 Phosphorylation (STY); Methylation(KR); Acetylation (K)
K.K(+42.01)PEEALEASAVEAN(+.98)ASPAT(+79.97)KDK.R Y 16.51 2378.0889 22 -10.2 595.5234 4 17.54 3 6498 AEV_3_3_RA3_01_1233.d 5.52E4 1 1 444 465 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
R.ASWIAALEAK(+43.99)AAEAK.R Y 16.31 1572.8147 15 -96.7 394.1729 4 71.19 1 34874 AEV 2_3_RA2_01_1224.d 0 1 1 183 197 Carboxylation (DKW)
K.ANDKVEK(-1.03)KPEEALEASAVEANASPATK.D Y 16.12 2795.3823 27 -75.1 560.0417 5 68.61 1 32894 AEV 2_3_RA2_01_1224.d 0 1 1 437 463 Lysine oxidation to aminoadipic semialdehyde
K.DSAVK.N Y 16.12 518.2700 5 -136.0 519.2068 1 58.86 1 25676 AEV 2_3_RA2_01_1224.d 5.39E4 1 1 361 365
K.LTKPPVVAAAAPK(+345.05)K.S Y 16.08 1734.9181 14 -6.5 434.7340 4 55.59 2 23316 AEV_1_3_RA2_01_1232.d 0 1 1 216 229 Phospho-guanosine
K.DTPAEPTAAVNGSEAPEEIK(+14.02)DDAAAVPAASSSQPVQAAA Y 16.03 3746.7759 39 1.3 1249.9342 3 78.63 2 39468 AEV_1_3_RA2_01_1232.d 1.65E5 1 1 550 588 Methylation(KR)
K.AELEK.L N 16.00 588.3119 5 -113.2 589.2526 1 38.29 1 13440 AEV 2_3_RA2_01_1224.d 2.56E4 1 1 211 215
K.AEEGEEK.K Y 15.97 790.3344 7 16.3 396.1809 2 70.62 1 34438 AEV 2_3_RA2_01_1224.d 0 1 1 239 245
K.RASIFGN(+.98)IFHK.V Y 15.93 1289.6880 11 44.0 430.9222 3 71.55 2 34011 AEV_1_3_RA2_01_1232.d 0 1 1 341 351 Deamidation (NQ)
K.R(+42.01)(+14.02)AS(+79.97)IFGNIFHK.V Y 15.89 1424.6965 11 20.7 713.3703 2 95.22 2 49413 AEV_1_3_RA2_01_1232.d 0 1 1 341 351 Acetylation (N-term); Methylation(KR); Phosphorylation (STY)
K.VAGHK.H Y 15.81 510.2914 5 18.5 511.3081 1 99.69 2 50921 AEV_1_3_RA2_01_1232.d 0 1 1 167 171
R.A(+42.01)SIFGSFLGKK.E Y 15.77 1195.6600 11 29.5 299.9311 4 37.35 3 17800 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 266 276 Acetylation (N-term)
K.E(+43.99)GEEPVASPTSAK.N Y 15.77 1344.6045 13 -42.4 673.2810 2 42.58 1 15910 AEV 2_3_RA2_01_1224.d 2.01E4 1 1 407 419 Carboxylation (E)
R.E(+42.01)K(+14.02)ETVTSSEGY(+79.97)K.A Y 15.72 1492.6334 12 -72.6 747.2698 2 55.25 1 23325 AEV 2_3_RA2_01_1224.d 2.35E4 1 1 199 210 Acetylation (N-term); Methylation(KR); Phosphorylation (STY)
K.ETVTSS(-20.03)EGYK.A Y 15.65 1079.4771 10 -48.0 360.8157 3 30.45 1 9202 AEV 2_3_RA2_01_1224.d 0 1 1 201 210 Formation of five membered aromatic heterocycle
K.KPEQKEKSR.S Y 15.64 1128.6251 9 -4.4 377.2140 3 12.78 2 3515 AEV_1_3_RA2_01_1232.d 1.16E5 1 1 251 259
K.LSIAHPTAAWASQTGK(+226.08).G Y 15.63 1863.9302 16 -33.3 622.2966 3 71.60 3 41487 AEV_3_3_RA3_01_1233.d 3.7E4 1 1 113 128 Biotinylation
K.EEVK(+42.01)PATDGVLGHK(+42.01).S Y 15.59 1562.7939 14 -12.4 782.3946 2 86.05 3 52407 AEV_3_3_RA3_01_1233.d 0 1 1 64 77 Acetylation (K)
K.VSN(+.98)QDK.V Y 15.41 690.3184 6 -78.4 691.2715 1 87.79 1 47946 AEV 2_3_RA2_01_1224.d 5.91E4 1 1 352 357 Deamidation (NQ)
K.EEKTEGK(+21.98).E Y 15.29 841.3793 7 -74.4 842.3240 1 77.55 1 39893 AEV 2_3_RA2_01_1224.d 4.59E4 1 1 282 288 Sodium adduct
K.HVFQ(+.98)AGSDDER.A Y 15.22 1260.5371 11 15.6 631.2856 2 26.40 3 11361 AEV_3_3_RA3_01_1233.d 2.01E4 1 1 172 182 Deamidation (NQ)
K.R(+42.01)AEDKATPTGIVNLADISDIVK(+21.98).E Y 15.16 2389.2463 22 -13.1 598.3110 4 76.81 2 38031 AEV_1_3_RA2_01_1232.d 0 1 1 136 157 Acetylation (N-term); Sodium adduct
K.AAEAK(+14.02).R N 15.03 502.2751 5 -57.1 503.2537 1 13.53 3 4326 AEV_3_3_RA3_01_1233.d 0 1 1 193 197 Methylation(KR)
K.RRTSLFGTLGK.K Y 15.03 1234.7146 11 -34.9 309.6751 4 9.46 3 2336 AEV_3_3_RA3_01_1233.d 4.18E4 1 1 466 476
K.EEVKPATDGVLGHK(+43.99).S Y 15.03 1522.7627 14 10.8 762.3969 2 95.30 3 57357 AEV_3_3_RA3_01_1233.d 1.93E5 1 1 64 77 Carboxylation (DKW)
total 176 peptides
A0A0A0HT80
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AEAISEISKNDLPAGEAAAYR.R Y 154.44 2175.0806 21 2.3 726.0358 3 70.12 2 32932 AEV_1_3_RA2_01_1232.d 5.28E5 3 3 701 721
K.KLDSSADEIKAAQDSFSK.S Y 144.54 1938.9534 18 6.0 485.7485 4 64.23 2 28710 AEV_1_3_RA2_01_1232.d 3E6 8 8 670 687
R.AEAISEISKNDLPAGEAAAYRR.L Y 133.12 2331.1819 22 7.0 583.8068 4 66.72 2 30473 AEV_1_3_RA2_01_1232.d 2.68E6 6 6 701 722
R.VNASTESLTANVAR.L Y 128.74 1431.7317 14 2.1 716.8746 2 60.54 2 26231 AEV_1_3_RA2_01_1232.d 6.69E6 7 7 637 650
K.LDSSADEIKAAQDSFSK.S Y 127.47 1810.8584 17 5.8 604.6302 3 67.22 2 30830 AEV_1_3_RA2_01_1232.d 2.8E6 8 8 671 687
R.GFTLQELKEAGIPR.K Y 126.13 1557.8514 14 -0.4 779.9327 2 76.52 2 37805 AEV_1_3_RA2_01_1232.d 4.13E6 8 8 609 622
R.AGRGFTLQELKEAGIPR.K Y 124.11 1842.0111 17 6.5 461.5131 4 71.96 2 34358 AEV_1_3_RA2_01_1232.d 1.35E6 7 7 606 622
R.RVNASTESLTANVAR.L Y 111.55 1587.8329 15 0.8 530.2853 3 54.74 2 22936 AEV_1_3_RA2_01_1232.d 1.36E6 7 7 636 650
K.SIESLLPISNISR.A Y 105.64 1427.7983 13 2.0 714.9079 2 82.31 2 42380 AEV_1_3_RA2_01_1232.d 3.7E6 6 6 688 700
K.SIESLLPISNISRAEAISEISKNDLPAGEAAAYRR.L Y 104.75 3740.9695 35 -0.2 749.2010 5 82.49 3 49942 AEV_3_3_RA3_01_1233.d 2.9E5 3 3 688 722
R.KLAQTIGIAVDHR.R Y 95.96 1420.8151 13 0.1 474.6124 3 58.65 3 31397 AEV_3_3_RA3_01_1233.d 8.38E5 6 6 623 635
K.AAAVAPRPVDKLRPIVR.C Y 92.61 1828.1158 17 -4.5 458.0342 4 59.98 3 32406 AEV_3_3_RA3_01_1233.d 4.67E6 6 6 578 594
K.AAAVAPRPVDK.L Y 89.71 1093.6244 11 1.5 547.8203 2 23.46 3 9685 AEV_3_3_RA3_01_1233.d 7.82E6 12 12 578 588
K.KLDSSADEIKAAQDSFSKSIESLLPISNISR.A Y 85.45 3348.7412 31 -1.5 670.7545 5 87.43 3 53259 AEV_3_3_RA3_01_1233.d 3.84E5 3 3 670 700
R.AEAISEISKNDLPAGEAAAYR(+14.02)R.L Y 83.60 2345.1975 22 -1.1 587.3060 4 69.31 3 39693 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 701 722 Methylation(KR)
R.VNASTE(+14.02)SLTANVAR.L Y 82.91 1445.7474 14 2.7 723.8829 2 63.70 2 28394 AEV_1_3_RA2_01_1232.d 4.79E5 2 2 637 650 Methylation(others)
R.AEAISE(+14.02)ISKNDLPAGEAAAYRR.L Y 81.56 2345.1975 22 -7.6 587.3022 4 67.54 3 38286 AEV_3_3_RA3_01_1233.d 2.35E4 2 2 701 722 Methylation(others)
K.A(+42.01)AAVAPRPVDKLRPIVR.C Y 80.92 1870.1265 17 -0.3 375.0325 5 59.88 3 32336 AEV_3_3_RA3_01_1233.d 3.3E4 1 1 578 594 Acetylation (N-term)
K.KLDSSADE(+14.02)IKAAQDSFSK.S Y 80.62 1952.9690 18 -0.8 489.2491 4 68.30 3 38897 AEV_3_3_RA3_01_1233.d 4.58E5 3 3 670 687 Methylation(others)
R.KLAQTIGIAVDHRR.V Y 79.67 1576.9161 14 2.3 395.2372 4 51.72 3 26862 AEV_3_3_RA3_01_1233.d 2.15E6 8 8 623 636
R.VRVHFDQPGRK.H Y 77.29 1337.7316 11 6.8 446.9208 3 33.18 2 12204 AEV_1_3_RA2_01_1232.d 1.36E6 8 8 557 567
R.GFTLQELKEAGIPR(+14.02).K Y 76.16 1571.8671 14 2.5 524.9643 3 78.17 2 39105 AEV_1_3_RA2_01_1232.d 4E5 3 3 609 622 Methylation(KR)
R.VHFDQPGR.K Y 76.07 954.4672 8 0.5 478.2411 2 29.44 3 13065 AEV_3_3_RA3_01_1233.d 1.67E6 10 10 559 566
R.VNASTESLTAN(+.98)VAR.L Y 75.81 1432.7158 14 -1.6 717.3640 2 62.18 3 34130 AEV_3_3_RA3_01_1233.d 6.04E5 3 3 637 650 Deamidation (NQ)
K.KLDSSADEIK.A Y 75.37 1104.5662 10 3.6 553.2924 2 26.59 3 11515 AEV_3_3_RA3_01_1233.d 1.22E6 10 10 670 679
R.VN(+.98)ASTESLTANVAR.L Y 75.25 1432.7158 14 4.8 717.3686 2 62.76 2 27744 AEV_1_3_RA2_01_1232.d 6.3E5 4 4 637 650 Deamidation (NQ)
R.AE(+14.02)AISEISKNDLPAGEAAAYRR.L Y 74.76 2345.1975 22 -2.9 587.3049 4 67.97 3 38626 AEV_3_3_RA3_01_1233.d 7.27E4 2 2 701 722 Methylation(others)
R.VNASTES(+14.02)LTANVAR.L Y 74.44 1445.7474 14 -2.7 723.8790 2 62.97 3 34717 AEV_3_3_RA3_01_1233.d 4.58E5 1 1 637 650 Methylation(others)
R.AGRGFTLQELKEAGIPR(+14.02).K Y 73.90 1856.0267 17 -5.1 465.0116 4 73.36 3 42868 AEV_3_3_RA3_01_1233.d 2.8E5 2 2 606 622 Methylation(KR)
R.RVNASTE(+14.02)SLTANVAR.L Y 72.41 1601.8485 15 2.1 534.9579 3 59.18 2 25347 AEV_1_3_RA2_01_1232.d 1.75E5 2 2 636 650 Methylation(others)
R.VHFDQPGRK.H Y 70.14 1082.5621 9 2.0 542.2894 2 20.34 3 7985 AEV_3_3_RA3_01_1233.d 4.02E6 11 11 559 567
R.GFTLQELK(+14.02)EAGIPR.K Y 69.62 1571.8671 14 6.8 524.9666 3 77.62 2 38663 AEV_1_3_RA2_01_1232.d 6.43E5 4 4 609 622 Methylation(KR)
K.NDLPAGEAAAYRR.L Y 69.42 1402.6953 13 0.4 468.5726 3 46.64 3 23587 AEV_3_3_RA3_01_1233.d 3.89E5 3 3 710 722
R.VNASTESLTANVAR(+14.02).L Y 69.41 1445.7474 14 -2.4 482.9219 3 63.00 3 34740 AEV_3_3_RA3_01_1233.d 5.96E5 3 3 637 650 Methylation(KR)
R.RVNASTESLTANVAR(+14.02).L Y 69.35 1601.8485 15 2.3 534.9580 3 59.58 2 25611 AEV_1_3_RA2_01_1232.d 1.28E5 2 2 636 650 Methylation(KR)
R.AGRGFTLQ(+.98)ELKEAGIPR.K Y 68.77 1842.9951 17 9.6 461.7605 4 71.07 3 41071 AEV_3_3_RA3_01_1233.d 8.81E4 2 2 606 622 Deamidation (NQ)
R.AGRGFTLQELKE(+14.02)AGIPR.K Y 68.54 1856.0267 17 -5.7 465.0113 4 72.59 3 42256 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 606 622 Methylation(others)
K.LDSSADEIKAAQDSFSK(+14.02).S Y 68.24 1824.8740 17 5.8 609.3021 3 69.68 2 32686 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 671 687 Methylation(KR)
K.LDSSADEIK.A Y 67.59 976.4713 9 3.3 489.2445 2 33.71 2 12460 AEV_1_3_RA2_01_1232.d 8.31E5 4 4 671 679
K.NHFHKDWAR.R Y 66.36 1209.5791 9 0.5 605.7971 2 22.87 3 9372 AEV_3_3_RA3_01_1233.d 2.2E6 5 5 547 555
R.GFTLQELKEAGIPRK.L Y 65.72 1685.9464 15 6.8 422.4968 4 70.96 2 33564 AEV_1_3_RA2_01_1232.d 2.86E5 2 2 609 623
K.NDLPAGEAAAYR.R Y 64.85 1246.5941 12 1.5 624.3053 2 56.31 3 29796 AEV_3_3_RA3_01_1233.d 2.88E5 3 3 710 721
R.VRVHFDQPGR.K Y 64.57 1209.6366 10 4.3 404.2212 3 40.97 2 15924 AEV_1_3_RA2_01_1232.d 5.51E5 5 5 557 566
K.KLDSSADEIKAAQ(+.98)DSFSK.S Y 64.39 1939.9374 18 12.5 647.6611 3 64.25 2 28726 AEV_1_3_RA2_01_1232.d 9.19E4 1 1 670 687 Deamidation (NQ)
K.AAAVAPRPVDK(+14.02).L Y 62.85 1107.6400 11 -10.6 554.8214 2 30.44 3 13644 AEV_3_3_RA3_01_1233.d 1.6E5 3 3 578 588 Methylation(KR)
K.SIESLLPISNISR(+14.02).A Y 62.06 1441.8140 13 4.6 721.9175 2 82.81 2 42741 AEV_1_3_RA2_01_1232.d 2.65E5 2 2 688 700 Methylation(KR)
K.AAQDSFSK.S Y 61.84 852.3977 8 -83.0 427.1707 2 25.47 1 6764 AEV 2_3_RA2_01_1224.d 3.47E5 3 3 680 687
K.KLDSS(-2.02)ADEIKAAQDSFSK.S Y 58.20 1936.9377 18 51.7 485.2667 4 63.61 3 35208 AEV_3_3_RA3_01_1233.d 0 1 1 670 687 2-amino-3-oxo-butanoic_acid
R.GFTLQELK.E Y 56.01 934.5123 8 -0.6 468.2632 2 69.80 2 32699 AEV_1_3_RA2_01_1232.d 1.66E6 4 4 609 616
R.AEAISEISK.N Y 53.21 946.4971 9 3.4 474.2574 2 40.35 2 15630 AEV_1_3_RA2_01_1232.d 6.22E5 4 4 701 709
R.AEAISEIS(-18.01)K(+14.02)NDLPAGEAAAYRR.L Y 52.11 2327.1868 22 -21.7 582.7913 4 66.02 3 37082 AEV_3_3_RA3_01_1233.d 9.75E4 1 1 701 722 Dehydration; Methylation(KR)
R.VR(+31.99)AGRGFTLQELKEAGIPR.K Y 50.67 2129.1704 19 -35.5 533.2810 4 76.57 2 37916 AEV_1_3_RA2_01_1232.d 1.48E5 1 1 604 622 Dihydroxy
K.AAAVAPRPVDKLRPIVR(+14.02).C Y 49.29 1842.1315 17 -1.0 369.4332 5 62.52 3 34365 AEV_3_3_RA3_01_1233.d 2.58E5 2 2 578 594 Methylation(KR)
K.ARLILFPR.R Y 48.45 984.6232 8 -10.9 329.2114 3 69.12 3 39551 AEV_3_3_RA3_01_1233.d 3.8E4 1 1 656 663
R.GFTLQELK(+14.02).E Y 46.47 948.5280 8 0.7 475.2716 2 75.30 2 36837 AEV_1_3_RA2_01_1232.d 4.48E5 4 4 609 616 Methylation(KR)
R.KLAQT(-18.01)IGIAVDHR.R Y 45.93 1402.8044 13 0.9 351.7087 4 58.63 3 31418 AEV_3_3_RA3_01_1233.d 7.69E5 2 2 623 635 Dehydration
R.GFTLQE(+14.02)LK.E Y 45.71 948.5280 8 2.2 475.2723 2 73.82 2 35744 AEV_1_3_RA2_01_1232.d 5.82E5 3 3 609 616 Methylation(others)
K.LRPIVR.C Y 45.60 752.5021 6 -0.7 377.2581 2 30.48 2 10922 AEV_1_3_RA2_01_1232.d 1.07E6 5 5 589 594
K.LDSSADE(+14.02)IKAAQDSFSK.S Y 45.23 1824.8740 17 -1.9 913.4426 2 72.12 3 41890 AEV_3_3_RA3_01_1233.d 5.74E5 1 1 671 687 Methylation(others)
R.LILFPR.R Y 44.00 757.4850 6 1.7 379.7504 2 74.79 2 36458 AEV_1_3_RA2_01_1232.d 4.69E6 7 7 658 663
R.AGRGFTLQELK(+14.02)EAGIPR.K Y 43.47 1856.0267 17 1.2 465.0145 4 73.61 2 35579 AEV_1_3_RA2_01_1232.d 1E5 1 1 606 622 Methylation(KR)
K.A(+41.03)AAVAPRPVDK.L Y 42.09 1134.6509 11 -20.1 379.2166 3 23.69 3 9805 AEV_3_3_RA3_01_1233.d 3.49E4 1 1 578 588 Amidination of lysines or N-terminal amines with methyl acetimidate
R.AGRGFTLQELK.E Y 41.99 1218.6720 11 -2.2 407.2304 3 61.85 3 33856 AEV_3_3_RA3_01_1233.d 5.08E5 2 2 606 616
K.AAQDSFSKSIESLLPISNISR.A Y 41.82 2262.1855 21 -0.4 755.0688 3 85.83 2 44866 AEV_1_3_RA2_01_1232.d 3.81E4 1 1 680 700
R.C(+57.02)PTVKYNR.R Y 39.09 1036.5123 8 -8.9 519.2589 2 19.93 3 7795 AEV_3_3_RA3_01_1233.d 3.15E5 3 3 595 602 Carbamidomethylation
K.HNQTIPK.N Y 38.31 836.4504 7 4.1 419.2342 2 12.32 2 3342 AEV_1_3_RA2_01_1232.d 2.96E5 2 2 540 546
R.GFTLQELKEAGIP(+13.98)R.K Y 38.01 1571.8307 14 -62.5 524.9181 3 84.75 1 45574 AEV 2_3_RA2_01_1224.d 4.26E5 1 1 609 622 Proline oxidation to pyroglutamic acid
R.VHFDQPGRK(+14.02).H Y 38.01 1096.5778 9 -29.4 366.5225 3 24.61 3 10398 AEV_3_3_RA3_01_1233.d 0 1 1 559 567 Methylation(KR)
K.LAQTIGIAVDHRR.V Y 37.38 1448.8212 13 4.4 363.2142 4 55.56 2 23297 AEV_1_3_RA2_01_1232.d 5.25E5 2 2 624 636
R.SSQ(+.98)SS(+79.97)LGSPADIR.I Y 36.94 1384.5872 13 15.2 347.1593 4 77.60 1 39937 AEV 2_3_RA2_01_1224.d 6.8E4 1 1 10 22 Deamidation (NQ); Phosphorylation (STY)
R.AEAISEISK(+114.04).N Y 35.85 1060.5400 9 -86.9 531.2312 2 51.49 1 21029 AEV 2_3_RA2_01_1224.d 2.88E5 1 1 701 709 Ubiquitin
R.C(+42.01)PTVK.Y Y 35.33 588.2941 5 9.1 589.3068 1 66.19 2 30089 AEV_1_3_RA2_01_1232.d 0 1 1 595 599 Acetylation (N-term)
K.K(+14.02)LD(-18.01)SSADEIKAAQDSFSK.S Y 34.31 1934.9585 18 -15.8 645.9833 3 63.63 3 35226 AEV_3_3_RA3_01_1233.d 0 1 1 670 687 Methylation(KR); Dehydration
R.VHFDQPGR(+14.02)K.H Y 33.93 1096.5778 9 -58.7 549.2640 2 24.64 3 10423 AEV_3_3_RA3_01_1233.d 1.54E5 2 2 559 567 Methylation(KR)
R.RVN(+.98)ASTESLTANVAR.L Y 33.77 1588.8169 15 -74.5 530.5734 3 64.07 1 29610 AEV 2_3_RA2_01_1224.d 5.18E4 1 1 636 650 Deamidation (NQ)
R.VN(-17.03)ASTESLTANVAR.L Y 33.45 1414.7052 14 -6.1 708.3556 2 72.54 3 42220 AEV_3_3_RA3_01_1233.d 7.47E4 1 1 637 650 Ammonia-loss (N)
K.EAGIPR.K Y 32.54 641.3496 6 4.1 321.6834 2 22.18 2 7291 AEV_1_3_RA2_01_1232.d 1.26E6 8 8 617 622
K.ATSSAT(-18.01)R.Y Y 32.48 674.3347 7 3.4 675.3443 1 83.83 2 43496 AEV_1_3_RA2_01_1232.d 0 1 1 286 292 Dehydration
K.LAQTIGIAVDHR.R Y 32.27 1292.7201 12 36.2 431.9296 3 60.47 3 32764 AEV_3_3_RA3_01_1233.d 1.83E5 3 3 624 635
K.KLDSSADEIK(+71.04).A Y 32.02 1175.6034 10 -78.7 392.8442 3 56.55 1 24158 AEV 2_3_RA2_01_1224.d 2.94E5 2 2 670 679 Propionamide (K, X@N-term)
R.VHFD(-18.01)QPGR.K Y 31.23 936.4565 8 -63.7 313.1396 3 43.16 1 16239 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 559 566 Dehydration
R.LILFPR(+14.02).R Y 30.93 771.5007 6 2.7 386.7587 2 77.13 2 38308 AEV_1_3_RA2_01_1232.d 4.73E5 3 3 658 663 Methylation(KR)
R.GFTLQ(+.98)ELK.E Y 30.56 935.4963 8 -86.5 468.7150 2 78.38 1 40555 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 609 616 Deamidation (NQ)
K.SSSER(+14.02).S Y 29.51 578.2660 5 -37.0 579.2519 1 79.92 1 41782 AEV 2_3_RA2_01_1224.d 0 1 1 5 9 Methylation(KR)
K.AAQDS(+14.02)FSK.S Y 29.38 866.4134 8 4.0 434.2157 2 25.55 2 8782 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 680 687 Methylation(others)
K.AAQDSFSK(+14.02).S Y 29.32 866.4134 8 2.6 434.2151 2 26.06 2 8971 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 680 687 Methylation(KR)
K.R(+14.02)AEVEQQLARR.E Y 29.25 1368.7585 11 5.1 343.1987 4 62.56 3 34396 AEV_3_3_RA3_01_1233.d 0 1 1 165 175 Methylation(KR)
R.VHFDQ(+.98)PGRK.H Y 28.13 1083.5461 9 10.0 362.1929 3 26.02 2 8950 AEV_1_3_RA2_01_1232.d 3.15E5 1 1 559 567 Deamidation (NQ)
R.VNASTESLTANVAR(+28.03).L Y 27.98 1459.7631 14 3.4 730.8913 2 66.51 2 30317 AEV_1_3_RA2_01_1232.d 5.99E4 2 2 637 650 Dimethylation(KR)
K.KPGVDR.A Y 27.00 670.3762 6 -14.5 671.3738 1 100.67 1 55932 AEV 2_3_RA2_01_1224.d 1.5E4 1 1 475 480
R.GFTLQ(+.98)ELKEAGIPR.K Y 26.50 1558.8354 14 -75.8 520.5797 3 82.57 1 43843 AEV 2_3_RA2_01_1224.d 6.01E4 1 1 609 622 Deamidation (NQ)
K.N(+.98)HFHKDWARR.V Y 26.41 1366.6643 10 -81.6 342.6455 4 30.54 1 9249 AEV 2_3_RA2_01_1224.d 0 1 1 547 556 Deamidation (NQ)
R.L(+42.01)AK(+31.99)AAAVAPRPVDK.L Y 26.13 1479.8408 14 -20.8 494.2773 3 79.52 2 40176 AEV_1_3_RA2_01_1232.d 0 1 1 575 588 Acetylation (N-term); Dihydroxy
R.LKEYKAR.L Y 25.95 906.5287 7 0.0 454.2716 2 11.84 2 3160 AEV_1_3_RA2_01_1232.d 6.76E3 2 2 651 657
R.AEVEQ(+.98)QLAR.R Y 25.79 1043.5247 9 -4.2 522.7674 2 20.96 3 8348 AEV_3_3_RA3_01_1233.d 0 1 1 166 174 Deamidation (NQ)
K.LDSSAD(+14.02)EIK.A Y 25.67 990.4869 9 9.5 496.2554 2 42.42 3 20907 AEV_3_3_RA3_01_1233.d 6.75E4 1 1 671 679 Methylation(others)
K.S(+42.01)PELSPK.T Y 25.48 798.4123 7 3.0 799.4220 1 90.83 2 47635 AEV_1_3_RA2_01_1232.d 0 1 1 196 202 Acetylation (N-term)
R.T(+43.01)PDAR.H Y 25.28 601.2820 5 -82.1 602.2399 1 42.59 1 15914 AEV 2_3_RA2_01_1224.d 7.86E4 1 1 378 382 Carbamylation
K.SPELSPK(+42.01)TPPS(+79.97)DATLK.R Y 25.04 1788.8546 16 3.5 448.2225 4 41.56 3 20379 AEV_3_3_RA3_01_1233.d 0 1 1 196 211 Acetylation (K); Phosphorylation (STY)
K.SSSYGNDKEIAAK.K Y 24.69 1368.6521 13 69.0 343.1939 4 29.37 2 10422 AEV_1_3_RA2_01_1232.d 0 1 1 492 504
K.AAAVAPRP(+13.98)VDK.L Y 24.56 1107.6036 11 -58.0 554.7770 2 47.44 1 18745 AEV 2_3_RA2_01_1224.d 1.82E5 2 2 578 588 Proline oxidation to pyroglutamic acid
K.LDSSADEIK(+14.02).A Y 24.36 990.4869 9 6.1 496.2538 2 43.53 2 17251 AEV_1_3_RA2_01_1232.d 9.84E4 1 1 671 679 Methylation(KR)
K.SSS(-18.01)ILQSK.L Y 24.29 830.4498 8 -62.1 416.2064 2 29.21 1 8614 AEV 2_3_RA2_01_1224.d 0 2 2 461 468 Dehydration
R.AE(+14.02)AISEISKNDLPAGEAAAYR.R Y 23.45 2189.0964 21 -0.2 730.7059 3 72.14 2 34451 AEV_1_3_RA2_01_1232.d 7.94E4 1 1 701 721 Methylation(others)
K.EIAAK(+21.98).K Y 23.34 552.2883 5 -7.5 553.2914 1 42.94 2 16926 AEV_1_3_RA2_01_1232.d 3E4 1 1 500 504 Sodium adduct
K.KPGVDRAGGSDNLKK.R Y 22.83 1540.8320 15 29.2 309.1827 5 30.10 2 10751 AEV_1_3_RA2_01_1232.d 0 1 1 475 489
R.KLAQTIGIAVD(-18.01)HRR.V Y 22.79 1558.9055 14 2.8 312.7892 5 52.06 3 27093 AEV_3_3_RA3_01_1233.d 9.34E5 1 1 623 636 Dehydration
K.L(+42.01)QHSLLSLTS(-18.01)SEAVK.R Y 22.73 1635.8832 15 32.1 409.9912 4 63.84 2 28447 AEV_1_3_RA2_01_1232.d 5.24E4 1 1 150 164 Acetylation (N-term); Dehydration
K.E(+42.01)AGIPR.K Y 22.48 683.3602 6 -16.0 342.6819 2 28.23 3 12380 AEV_3_3_RA3_01_1233.d 8.59E4 1 1 617 622 Acetylation (N-term)
R.C(-17.03)PTVK.Y Y 22.45 529.2570 5 3.8 530.2663 1 49.08 2 19987 AEV_1_3_RA2_01_1232.d 3.44E4 1 1 595 599 Ammonia-loss (C@N-term)
K.LQHSLLSLTSSEAVK.R Y 22.22 1611.8832 15 -46.3 538.2768 3 70.34 2 33105 AEV_1_3_RA2_01_1232.d 0 1 1 150 164
K.I(+27.99)STSSR.T N 22.00 677.3344 6 5.7 678.3456 1 87.65 2 46002 AEV_1_3_RA2_01_1232.d 1.33E4 1 1 508 513 Formylation
R.SS(-18.01)QSSLGSPADIR.I Y 21.87 1285.6262 13 49.4 643.8521 2 71.54 2 33998 AEV_1_3_RA2_01_1232.d 1.04E4 1 1 10 22 Dehydration
K.SPELS(+77.99)PK.T Y 21.70 834.3888 7 -37.2 835.3650 1 96.03 1 53794 AEV 2_3_RA2_01_1224.d 4.1E3 1 1 196 202 Methylphosphonylation
K.AKADEAAAT(+79.97)K.K Y 21.66 1054.4696 10 11.6 352.5012 3 63.94 1 29568 AEV 2_3_RA2_01_1224.d 3.94E5 1 1 742 751 Phosphorylation (STY)
R.VNAST(+14.02)ESLTANVAR.L Y 21.58 1445.7474 14 -90.1 723.8159 2 69.13 1 33311 AEV 2_3_RA2_01_1224.d 4.21E5 1 1 637 650 Methylation(others)
R.A(+42.01)GQHK(+42.01).K N 21.58 623.3027 5 2.3 624.3115 1 71.45 3 41365 AEV_3_3_RA3_01_1233.d 8.15E4 1 1 665 669 Acetylation (N-term); Acetylation (K)
R.V(+233.05)RAGRGFTLQELKEAGIPR.K Y 21.50 2330.2317 19 -39.2 777.7207 3 76.70 2 37938 AEV_1_3_RA2_01_1232.d 9.07E4 1 1 604 622 5-dimethylaminonaphthalene-1-sulfonyl
K.KLDS(+79.96)SADEIK.A Y 21.43 1184.5231 10 70.9 395.8763 3 26.75 3 11557 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 670 679 Sulfation
R.K(+27.99)SSSYGNDK.E Y 21.33 1012.4461 9 -60.1 507.1999 2 53.44 1 22211 AEV 2_3_RA2_01_1224.d 3.82E4 1 1 491 499 Formylation
K.TPPSDAT(+79.97)LK(+14.02).R Y 20.97 1022.4685 9 -28.1 512.2272 2 80.54 1 42264 AEV 2_3_RA2_01_1224.d 9.1E4 1 1 203 211 Phosphorylation (STY); Methylation(KR)
K.NELLC(+57.02)EENSR.L Y 20.96 1262.5562 10 -98.7 632.2230 2 42.37 1 15792 AEV 2_3_RA2_01_1224.d 0 1 1 241 250 Carbamidomethylation
R.VHFDQPGR(+44.03).K Y 20.79 998.4933 8 6.0 500.2570 2 43.77 2 17323 AEV_1_3_RA2_01_1232.d 0 1 1 559 566 Ethanolation (KR)
R.VRAGRGFT(-18.01)LQELK.E Y 20.72 1455.8309 13 -75.2 364.9376 4 47.07 2 18971 AEV_1_3_RA2_01_1232.d 0 1 1 604 616 Dehydration
K.N(+.98)DLPAGEAAAYRR.L Y 20.41 1403.6793 13 12.7 468.9063 3 46.70 3 23621 AEV_3_3_RA3_01_1233.d 2.17E4 1 1 710 722 Deamidation (NQ)
R.YPDS(-18.01)AR.S Y 20.35 689.3132 6 -64.8 690.2758 1 112.99 1 59623 AEV 2_3_RA2_01_1224.d 1.35E5 1 1 293 298 Dehydration
K.EAGIPR(+31.99).K Y 20.32 673.3395 6 -9.2 674.3406 1 75.62 3 44617 AEV_3_3_RA3_01_1233.d 4.37E4 1 1 617 622 Dihydroxy
R.VHFDQPGR(+79.97).K Y 20.16 1034.4335 8 -73.2 345.7932 3 46.72 1 18306 AEV 2_3_RA2_01_1224.d 1.71E5 2 2 559 566 Phosphorylation (HCDR)
K.AAAVAPR(+14.02)PVDK(+14.02).L Y 19.96 1121.6556 11 -48.4 374.8744 3 59.86 2 25786 AEV_1_3_RA2_01_1232.d 4.06E4 1 1 578 588 Methylation(KR)
R.V(+42.01)NASTESLTANVAR.L Y 19.85 1473.7423 14 12.0 492.2606 3 59.85 3 32313 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 637 650 Acetylation (N-term)
K.NHFHK.D Y 19.83 681.3347 5 -10.1 682.3351 1 68.89 3 39369 AEV_3_3_RA3_01_1233.d 0 1 1 547 551
K.KLD(+43.99)SSADEIK.A Y 19.62 1148.5560 10 -60.2 575.2507 2 49.12 1 19732 AEV 2_3_RA2_01_1224.d 1.44E5 2 2 670 679 Carboxylation (DKW)
K.A(+42.01)TSSATR.Y Y 19.07 734.3559 7 -65.1 735.3154 1 36.12 1 12240 AEV 2_3_RA2_01_1224.d 0 1 1 286 292 Acetylation (N-term)
K.NELLC(+57.02)EENS(-18.01)R.L Y 18.98 1244.5455 10 -41.5 623.2542 2 46.58 1 18219 AEV 2_3_RA2_01_1224.d 0 1 1 241 250 Carbamidomethylation; Dehydration
K.NDLPAGE(+21.98)AAAYR.R Y 18.83 1268.5760 12 -83.3 635.2425 2 57.04 1 24442 AEV 2_3_RA2_01_1224.d 3.97E4 1 1 710 721 Sodium adduct
K.EAGIPRK(+226.08).L Y 18.78 995.5222 7 -14.5 996.5150 1 85.39 2 44579 AEV_1_3_RA2_01_1232.d 6.37E3 1 1 617 623 Biotinylation
K.K(+14.02)LDSS(-18.01)ADEIKAAQDSFSK.S Y 18.71 1934.9585 18 -6.3 645.9894 3 64.37 2 28816 AEV_1_3_RA2_01_1232.d 0 1 1 670 687 Methylation(KR); Dehydration
R.VHFDQ(+.98)PGR.K Y 18.31 955.4512 8 -62.9 478.7028 2 51.76 1 21207 AEV 2_3_RA2_01_1224.d 0 1 1 559 566 Deamidation (NQ)
K.DLLIFAQESRMSAAHFK(+42.01).L Y 18.19 2005.0090 17 18.0 502.2686 4 47.47 2 19178 AEV_1_3_RA2_01_1232.d 7.77E4 1 1 133 149 Acetylation (K)
K.S(+79.97)SSER(+14.02).S Y 18.14 658.2323 5 45.8 659.2697 1 42.01 1 15582 AEV 2_3_RA2_01_1224.d 6.16E4 1 1 5 9 Phosphorylation (STY); Methylation(KR)
R.GTHSLSS(+79.97)LPVTPQR(+14.02).S Y 18.12 1572.7661 14 38.7 394.2140 4 24.91 2 8469 AEV_1_3_RA2_01_1232.d 0 1 1 347 360 Phosphorylation (STY); Methylation(KR)
K.K(+87.07)LDSSADEIK.A Y 17.95 1191.6346 10 6.2 398.2213 3 38.84 2 14917 AEV_1_3_RA2_01_1232.d 0 1 1 670 679 Hypusine
R.REVEILQS(+79.97)VEYRHR(-.98).R Y 17.83 1891.9418 14 39.5 631.6794 3 83.58 3 50726 AEV_3_3_RA3_01_1233.d 0 1 1 175 188 Phosphorylation (STY); Amidation
R.A(+42.01)EVEQQLAR.R Y 17.82 1084.5513 9 -71.7 1085.4808 1 112.53 1 59492 AEV 2_3_RA2_01_1224.d 0 1 1 166 174 Acetylation (N-term)
R.GLSVEK(+31.99).S Y 17.78 663.3439 6 17.5 664.3627 1 81.37 2 41643 AEV_1_3_RA2_01_1232.d 4.86E4 1 1 190 195 Dihydroxy
K.AD(+21.98)EAAATK.K Y 17.52 797.3531 8 -40.6 798.3280 1 95.60 1 53523 AEV 2_3_RA2_01_1224.d 8.73E4 1 1 744 751 Sodium adduct
R.K(+42.01)(+14.02)ATS(+79.97)SATRYPDSAR.S Y 17.48 1645.7461 14 68.7 330.1791 5 19.73 3 7692 AEV_3_3_RA3_01_1233.d 0 1 1 285 298 Acetylation (N-term); Methylation(KR); Phosphorylation (STY)
R.V(+41.03)HFDQPGRK.H Y 17.43 1123.5886 9 -19.6 375.5295 3 20.40 3 8032 AEV_3_3_RA3_01_1233.d 6.23E4 1 1 559 567 Amidination of lysines or N-terminal amines with methyl acetimidate
K.SSS(-18.01)YGNDK.E Y 17.42 838.3457 8 15.3 839.3658 1 92.14 1 51161 AEV 2_3_RA2_01_1224.d 7.69E3 1 1 492 499 Dehydration
K.L(+42.01)AQTIGIAVDHR(+14.02)R.V Y 17.35 1504.8474 13 -25.3 377.2096 4 61.03 2 26544 AEV_1_3_RA2_01_1232.d 0 1 1 624 636 Acetylation (N-term); Methylation(KR)
K.K(+42.01)(+14.02)PGVDRAGGSDN(+.98)LK.K Y 17.31 1469.7473 14 27.9 490.9367 3 47.70 2 19285 AEV_1_3_RA2_01_1232.d 5.3E5 1 1 475 488 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
R.V(+27.99)HFDQPGR.K Y 17.30 982.4620 8 22.8 983.4918 1 112.54 2 54453 AEV_1_3_RA2_01_1232.d 2.35E4 1 1 559 566 Formylation
R.ASLSASPD(+43.99)R(+14.02)PAIDQNSSIPDK.L Y 17.26 2226.0764 21 -8.3 743.0266 3 92.00 3 55807 AEV_3_3_RA3_01_1233.d 4.68E4 1 1 32 52 Carboxylation (DKW); Methylation(KR)
K.S(+79.97)PELSPK(+42.01).T Y 17.19 878.3787 7 52.4 879.4319 1 94.55 3 57028 AEV_3_3_RA3_01_1233.d 7.18E4 2 2 196 202 Phosphorylation (STY); Acetylation (K)
K.L(+42.01)FGQVK(+42.01)K(+42.01)PGVDR.A Y 17.06 1468.8037 12 1.2 368.2086 4 40.06 2 15493 AEV_1_3_RA2_01_1232.d 0 1 1 469 480 Acetylation (N-term); Acetylation (K)
K.LAQ(+.98)TIGIAVDH(+15.99)R.R Y 17.04 1309.6990 12 -53.9 328.4144 4 84.17 1 45125 AEV 2_3_RA2_01_1224.d 4.34E4 1 1 624 635 Deamidation (NQ); Oxidation (HW)
K.S(+27.99)PELSPK.T Y 17.02 784.3967 7 -51.2 393.1855 2 19.01 1 4518 AEV 2_3_RA2_01_1224.d 0 1 1 196 202 Formylation
K.SIESLLPISNISRAEAISEIS(+79.97)K.N Y 16.94 2436.2512 22 -22.3 813.0729 3 83.09 2 42938 AEV_1_3_RA2_01_1232.d 5.76E4 1 1 688 709 Phosphorylation (STY)
K.ISTSSR.T N 16.79 649.3395 6 -85.8 650.2910 1 86.23 1 46746 AEV 2_3_RA2_01_1224.d 1.11E4 1 1 508 513
R.GFTLQELK(+14.02)EAGIPR(+14.02).K Y 16.70 1585.8827 14 7.9 529.6390 3 79.12 2 39857 AEV_1_3_RA2_01_1232.d 2.43E4 1 1 609 622 Methylation(KR)
K.HQGQGHS(+162.05)R.G Y 16.62 1067.4744 8 4.8 534.7470 2 33.47 2 12342 AEV_1_3_RA2_01_1232.d 1.45E5 1 1 339 346 Hexose (NSY)
R.C(+57.02)PTVK(+27.99).Y Y 16.62 631.2999 5 -58.9 632.2700 1 76.26 1 38868 AEV 2_3_RA2_01_1224.d 5.3E4 1 1 595 599 Carbamidomethylation; Formylation
K.KLDSSADEIKAAQDSFSK(+14.02).S Y 16.52 1952.9690 18 3.4 651.9991 3 66.57 2 30352 AEV_1_3_RA2_01_1232.d 1.25E5 1 1 670 687 Methylation(KR)
R.AEAISEISKNDLPAGEAAAYR(+14.02).R Y 16.50 2189.0964 21 -13.9 730.6959 3 67.33 3 38114 AEV_3_3_RA3_01_1233.d 9.06E4 1 1 701 721 Methylation(KR)
R.GLSVEK(+14.02)SPELSPK.T Y 16.34 1383.7609 13 -29.2 462.2474 3 59.19 2 25354 AEV_1_3_RA2_01_1232.d 0 1 1 190 202 Methylation(KR)
R.GLSVEKSPELSPK(+27.99).T Y 16.32 1397.7401 13 -25.1 699.8598 2 79.85 2 40440 AEV_1_3_RA2_01_1232.d 7.65E3 1 1 190 202 Formylation
R.KATSSAT(+79.97)R.Y Y 16.26 900.4066 8 16.2 451.2179 2 29.10 2 10301 AEV_1_3_RA2_01_1232.d 0 1 1 285 292 Phosphorylation (STY)
K.A(+42.01)DEAAAT(+79.97)K.K Y 16.17 897.3481 8 -71.2 449.6494 2 20.32 1 4866 AEV 2_3_RA2_01_1224.d 0 1 1 744 751 Acetylation (N-term); Phosphorylation (STY)
R.LKEYK.A Y 16.17 679.3904 5 -88.8 340.6723 2 25.06 1 6573 AEV 2_3_RA2_01_1224.d 1.43E5 1 1 651 655
K.SSSILQSKLFGQVKKPGVDR.A Y 16.08 2173.2219 20 29.3 544.3287 4 41.83 2 16372 AEV_1_3_RA2_01_1232.d 0 1 1 461 480
K.SPELSPK(+14.02).T Y 16.05 770.4174 7 23.3 386.2249 2 45.69 2 18282 AEV_1_3_RA2_01_1232.d 0 1 1 196 202 Methylation(KR)
M(+15.99)KPKSSSER.S Y 16.02 1064.5284 9 3.4 533.2733 2 62.51 2 27540 AEV_1_3_RA2_01_1232.d 0 1 1 1 9 Oxidation (M)
R.S(+127.06)SQSSLGSPADIR.I Y 15.92 1430.7001 13 -9.2 716.3507 2 78.62 3 46993 AEV_3_3_RA3_01_1233.d 3.29E4 1 1 10 22 N-Succinimidyl-2-morpholine acetate
K.LQ(+.98)HSLLS(+79.97)LTSSEAVK.R Y 15.81 1692.8335 15 -3.8 565.2830 3 76.74 2 37972 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 150 164 Deamidation (NQ); Phosphorylation (STY)
R.VH(+40.03)FDQPGRK.H Y 15.62 1122.5934 9 -20.7 375.1973 3 20.37 3 8012 AEV_3_3_RA3_01_1233.d 3.53E5 1 1 559 567 Propionaldehyde +40
K.ADEAAATK(-.98).K Y 15.60 774.3871 8 3.8 775.3974 1 95.82 3 57569 AEV_3_3_RA3_01_1233.d 2.45E5 1 1 744 751 Amidation
K.R(+31.99)AEVEQQLAR.R Y 15.57 1230.6316 10 9.8 616.3291 2 73.48 2 35485 AEV_1_3_RA2_01_1232.d 9.28E4 1 1 165 174 Dihydroxy
R.AEAISEIS(+79.97)KNDLPAGEAAAY(+79.97)R(+14.02).R Y 15.49 2349.0291 21 8.3 588.2694 4 94.22 1 52621 AEV 2_3_RA2_01_1224.d 0 1 1 701 721 Phosphorylation (STY); Methylation(KR)
R.L(+43.01)ILFPR.R Y 15.44 800.4908 6 3.2 401.2540 2 74.74 2 36427 AEV_1_3_RA2_01_1232.d 0 1 1 658 663 Carbamylation
R.VIEEETD(-18.01)K.N Y 15.41 943.4498 8 10.3 944.4668 1 91.28 3 55418 AEV_3_3_RA3_01_1233.d 6.41E3 1 1 233 240 Dehydration
R.IPST(+79.97)PILSR(+31.99).A Y 15.25 1094.5372 9 29.4 548.2920 2 66.49 2 30295 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 23 31 Phosphorylation (STY); Dihydroxy
K.KLDSSADEIKAAQDS(-18.01)FSK.S Y 15.24 1920.9429 18 -1.4 641.3207 3 66.20 3 37224 AEV_3_3_RA3_01_1233.d 1.93E5 1 1 670 687 Dehydration
R.AEVEQQLARREVEILQS(+79.97)VEYRHR.R Y 15.22 2917.4558 23 5.5 730.3752 4 86.32 3 52589 AEV_3_3_RA3_01_1233.d 0 1 1 166 188 Phosphorylation (STY)
R.AGQHK.K N 15.13 539.2816 5 131.2 540.3596 1 102.31 1 56485 AEV 2_3_RA2_01_1224.d 0 1 1 665 669
R.HHNH(+40.03)SVSLSNR.E Y 15.13 1326.6542 11 -49.0 332.6546 4 69.31 1 33425 AEV 2_3_RA2_01_1224.d 0 1 1 383 393 Propionaldehyde +40
K.LDSS(+79.97)ADEIK.A Y 15.05 1056.4376 9 159.9 1057.6138 1 105.50 1 57456 AEV 2_3_RA2_01_1224.d 0 1 1 671 679 Phosphorylation (STY)
total 186 peptides
C1GKC9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.NPADITQEEYASFYK.T Y 145.07 1774.8049 15 1.0 888.4106 2 75.89 2 37320 AEV_1_3_RA2_01_1232.d 1.46E6 6 6 275 289
K.SGDETTSLADYVTR.M Y 134.31 1513.6896 14 0.8 757.8527 2 70.75 2 33434 AEV_1_3_RA2_01_1232.d 3.04E6 8 8 445 458
K.TLTIQDTGIGMTKADLVNNLGTIAR.S Y 126.24 2615.3953 25 -3.4 872.8027 3 82.62 2 42594 AEV_1_3_RA2_01_1232.d 2.53E5 3 3 74 98
K.GVVDSEDLPLNLSR.E Y 123.98 1512.7783 14 1.0 757.3972 2 77.83 2 38852 AEV_1_3_RA2_01_1232.d 2.33E6 5 5 362 375
R.FNSTKSGDETTSLADYVTR.M Y 113.66 2090.9756 19 5.0 698.0026 3 68.59 2 31796 AEV_1_3_RA2_01_1232.d 3.46E5 2 2 440 458
R.VFITDDATDLIPEWLSFVK.G Y 110.77 2208.1353 19 5.0 1105.0804 2 97.49 2 50174 AEV_1_3_RA2_01_1232.d 3.16E5 5 5 343 361
K.TLTIQDTGIGMTK.A Y 104.69 1377.7174 13 2.7 689.8679 2 71.51 2 33981 AEV_1_3_RA2_01_1232.d 5.62E5 5 5 74 86
K.HNDDEQYIWESSAGGTFK.I Y 104.30 2082.8918 18 2.3 695.3062 3 72.44 3 42140 AEV_3_3_RA3_01_1233.d 2.37E5 3 3 140 157
K.TKPIWTRNPADITQEEYASFYK.T Y 103.83 2657.3125 22 1.0 665.3361 4 77.50 3 46124 AEV_3_3_RA3_01_1233.d 8.17E4 1 1 268 289
R.YEALSDPSKLDSNKDLR.I Y 102.51 1949.9694 17 2.4 488.5008 4 61.86 2 27094 AEV_1_3_RA2_01_1232.d 8.08E5 6 6 47 63
R.RVFITDDATDLIPEWLSFVK.G Y 101.67 2364.2366 20 3.9 789.0892 3 93.19 2 48661 AEV_1_3_RA2_01_1232.d 6.64E5 5 5 342 361
K.TLELFTEIAEDREQFDKFYSAFSK.N Y 100.59 2913.4072 24 0.7 729.3596 4 90.21 3 54814 AEV_3_3_RA3_01_1233.d 4.11E5 2 2 395 418
R.EAEEKEFEGLAK.A Y 100.08 1378.6615 12 0.0 690.3380 2 56.39 3 29825 AEV_3_3_RA3_01_1233.d 2.09E6 8 8 536 547
K.ITQDTDGESLGR.G Y 95.98 1290.6051 12 3.8 646.3123 2 38.74 2 14891 AEV_1_3_RA2_01_1232.d 2.6E6 13 13 158 169
R.TGQFGWSANMER.I Y 92.50 1382.6038 12 -0.2 692.3090 2 68.17 3 38814 AEV_3_3_RA3_01_1233.d 2.36E5 5 5 575 586
K.MILHLKDEQTEYLNESK.I Y 90.89 2090.0354 17 -7.6 697.6804 3 67.16 3 37986 AEV_3_3_RA3_01_1233.d 1.4E5 2 2 173 189
K.HFSVEGQLEFR.A Y 90.45 1347.6571 11 4.5 450.2283 3 70.42 2 33163 AEV_1_3_RA2_01_1232.d 3.35E5 4 4 303 313
K.LGIHEDAQNR.S Y 89.46 1151.5684 10 -1.0 576.7909 2 26.14 3 11241 AEV_3_3_RA3_01_1233.d 3.92E6 13 13 422 431
K.TLTIQDTGIGM(+15.99)TK.A Y 85.41 1393.7123 13 2.3 697.8650 2 66.19 2 30087 AEV_1_3_RA2_01_1232.d 4.05E5 4 4 74 86 Oxidation (M)
K.HSEFISYPIYLHVVK.E Y 85.29 1830.9668 15 3.3 611.3315 3 77.18 2 38317 AEV_1_3_RA2_01_1232.d 4.33E5 4 4 197 211
K.VEEVDDEEEEK.K Y 84.25 1348.5518 11 13.3 675.2921 2 28.22 3 12403 AEV_3_3_RA3_01_1233.d 2.17E5 5 5 236 246
K.ADLVNNLGTIAR.S Y 84.18 1255.6885 12 -2.7 628.8498 2 71.88 3 41709 AEV_3_3_RA3_01_1233.d 1.49E6 4 4 87 98
K.ITQDTDGESLGRGTK.M Y 83.27 1576.7693 15 2.3 526.5983 3 32.50 2 11889 AEV_1_3_RA2_01_1232.d 4.35E5 4 4 158 172
K.RAPFDLFETK.K Y 81.89 1222.6345 10 0.5 408.5523 3 75.07 2 36669 AEV_1_3_RA2_01_1232.d 6.94E5 5 5 321 330
R.TGQFGWSANM(+15.99)ER.I Y 80.71 1398.5986 12 0.3 700.3068 2 60.98 3 33167 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 575 586 Oxidation (M)
K.ESKIEEEELNK.T Y 78.58 1346.6565 11 0.3 674.3357 2 33.22 3 15273 AEV_3_3_RA3_01_1233.d 4.68E4 2 2 257 267
K.VEEVDDEEEEKKK.E Y 76.99 1604.7417 13 2.8 535.9227 3 16.48 2 4948 AEV_1_3_RA2_01_1232.d 1.64E5 2 2 236 248
K.GVVDSEDLPLNLSR(+14.02).E Y 76.37 1526.7939 14 0.1 764.4044 2 78.89 2 39675 AEV_1_3_RA2_01_1232.d 2.86E5 2 2 362 375 Methylation(KR)
K.TLSNDWEDHLAVK.H Y 75.79 1526.7365 13 -1.3 509.9188 3 69.31 3 39694 AEV_3_3_RA3_01_1233.d 2.21E5 3 3 290 302
K.ALKNVLGDKVEK.V Y 75.02 1312.7714 12 0.8 438.5981 3 44.01 3 21928 AEV_3_3_RA3_01_1233.d 9.3E5 7 7 548 559
K.SITQLLFETSLLVSGFTIEEPAGFAER.I Y 72.41 2954.5276 27 1.2 1478.2728 2 97.82 3 58349 AEV_3_3_RA3_01_1233.d 8.85E3 1 1 636 662
R.YEALSDPSK.L Y 70.59 1008.4763 9 3.6 505.2473 2 37.16 3 17686 AEV_3_3_RA3_01_1233.d 5.89E5 3 3 47 55
K.KVEADGENDRTVK.S Y 70.21 1459.7267 13 2.0 487.5838 3 13.32 3 4209 AEV_3_3_RA3_01_1233.d 4.04E4 2 2 623 635
K.QM(+15.99)YYITGESLK.A Y 69.42 1347.6381 11 0.5 674.8267 2 65.51 3 36683 AEV_3_3_RA3_01_1233.d 2.46E5 3 3 465 475 Oxidation (M)
R.NPADITQEE(+14.02)YASFYK.T Y 67.22 1788.8206 15 3.3 895.4205 2 80.26 2 40809 AEV_1_3_RA2_01_1232.d 1.57E5 2 2 275 289 Methylation(others)
R.IDIIPDKANK.T Y 66.84 1125.6393 10 0.4 563.8271 2 52.80 3 27576 AEV_3_3_RA3_01_1233.d 3.89E6 11 11 64 73
K.SGDETTSLADYVTR(+14.02).M Y 64.63 1527.7052 14 -0.3 764.8596 2 73.67 3 43097 AEV_3_3_RA3_01_1233.d 5.58E5 3 3 445 458 Methylation(KR)
K.ITQDTDGESLGR(+14.02).G Y 64.51 1304.6208 12 -1.5 653.3167 2 43.55 3 21637 AEV_3_3_RA3_01_1233.d 5.55E5 6 6 158 169 Methylation(KR)
K.IEEEELNK.T Y 63.57 1002.4869 8 -86.9 502.2072 2 41.00 1 14997 AEV 2_3_RA2_01_1224.d 7.48E5 4 4 260 267
K.LVDITKDFELEETDEEKKTR.E Y 63.45 2437.2224 20 -2.3 610.3115 4 71.02 3 41024 AEV_3_3_RA3_01_1233.d 3.96E5 3 3 516 535
K.GVVDSE(+14.02)DLPLNLSR.E Y 63.26 1526.7939 14 -2.7 764.4022 2 79.99 3 48094 AEV_3_3_RA3_01_1233.d 2.05E5 2 2 362 375 Methylation(others)
K.TFEISPR.S Y 62.98 848.4392 7 -88.5 425.1893 2 64.24 1 29739 AEV 2_3_RA2_01_1224.d 1.06E6 5 5 607 613
R.NPADITQE(+14.02)EYASFYK.T Y 62.12 1788.8206 15 4.2 895.4213 2 77.91 2 38896 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 275 289 Methylation(others)
K.LIGSPC(+57.02)AIR.T Y 61.97 985.5378 9 -1.2 493.7756 2 58.18 3 31104 AEV_3_3_RA3_01_1233.d 1.77E6 5 5 566 574 Carbamidomethylation
K.SGDETTSLADYVTR(+.98).M Y 61.86 1514.6736 14 8.5 758.3505 2 70.53 3 40650 AEV_3_3_RA3_01_1233.d 7.23E3 1 1 445 458 Deamidation (R)
K.QMYYITGESLK.A Y 61.26 1331.6431 11 7.9 666.8340 2 70.62 2 33377 AEV_1_3_RA2_01_1232.d 1.98E5 2 2 465 475
K.ITQDTDGE(+14.02)SLGR.G Y 60.96 1304.6208 12 0.3 653.3179 2 49.59 3 25521 AEV_3_3_RA3_01_1233.d 3.29E5 3 3 158 169 Methylation(others)
K.ADLVNNLGTIAR(+14.02).S Y 60.26 1269.7041 12 -2.6 635.8577 2 75.17 3 44254 AEV_3_3_RA3_01_1233.d 7.31E4 2 2 87 98 Methylation(KR)
K.EIEKEVVDEDAEEVKEDDEDKAPK.V Y 59.21 2787.2820 24 -3.0 697.8257 4 60.98 3 33173 AEV_3_3_RA3_01_1233.d 3.54E4 1 1 212 235
K.NIKLGIHEDAQNR.S Y 57.78 1506.7903 13 0.5 377.7050 4 42.44 3 20922 AEV_3_3_RA3_01_1233.d 3.95E5 2 2 419 431
K.KKVEADGENDRTVK.S Y 57.26 1587.8215 14 2.8 530.2826 3 11.54 3 3269 AEV_3_3_RA3_01_1233.d 2.18E4 2 2 622 635
R.ELISNC(+57.02)SDALDK.I Y 55.18 1363.6289 12 -0.3 682.8215 2 61.03 3 33211 AEV_3_3_RA3_01_1233.d 3.54E5 2 2 33 44 Carbamidomethylation
R.AILFVPK.R Y 54.60 786.5003 7 -4.1 394.2558 2 69.38 3 39798 AEV_3_3_RA3_01_1233.d 1.35E6 3 3 314 320
K.VEEVDDEEEEK(+14.02).K Y 53.49 1362.5674 11 21.6 682.3057 2 38.32 3 18388 AEV_3_3_RA3_01_1233.d 5.73E4 3 3 236 246 Methylation(KR)
R.ETLQQNKIM(+15.99)K.V Y 50.38 1247.6544 10 -12.0 624.8270 2 22.01 3 8902 AEV_3_3_RA3_01_1233.d 2.03E4 1 1 376 385 Oxidation (M)
K.KTLELFTEIAEDREQFDKFYSAFSK.N Y 50.18 3041.5022 25 0.0 609.3077 5 87.14 3 53080 AEV_3_3_RA3_01_1233.d 4.81E4 1 1 394 418
K.SPFLDTLKEK.N Y 49.68 1176.6390 10 -3.8 393.2188 3 63.36 3 35009 AEV_3_3_RA3_01_1233.d 9.48E5 5 5 480 489
K.ITQDTDGES(-18.01)LGR.G Y 47.81 1272.5946 12 2.3 637.3060 2 41.23 2 16060 AEV_1_3_RA2_01_1232.d 4.78E4 1 1 158 169 Dehydration
K.NFEVLFLVDPIDEYAMTQLKEFDGKK.L Y 47.61 3088.5466 26 17.1 1030.5404 3 92.80 3 56209 AEV_3_3_RA3_01_1233.d 0 1 1 490 515
K.ITQ(+.98)DTDGESLGR.G Y 47.51 1291.5891 12 2.6 646.8035 2 44.26 2 17570 AEV_1_3_RA2_01_1232.d 2.47E5 3 3 158 169 Deamidation (NQ)
K.Q(-17.03)MYYITGESLK.A Y 46.55 1314.6166 11 -2.6 658.3138 2 81.55 3 49255 AEV_3_3_RA3_01_1233.d 1.12E5 2 2 465 475 Pyro-glu from Q
K.ITQD(+14.02)TDGESLGR.G Y 45.98 1304.6208 12 2.7 653.3195 2 45.98 3 23219 AEV_3_3_RA3_01_1233.d 1.57E5 2 2 158 169 Methylation(others)
K.ITQDTD(+14.02)GESLGR.G Y 45.55 1304.6208 12 1.4 653.3186 2 47.01 3 23820 AEV_3_3_RA3_01_1233.d 3.02E5 3 3 158 169 Methylation(others)
R.VFITDDATDLIPE(+14.02)WLSFVK.G Y 45.15 2222.1511 19 0.7 1112.0836 2 97.64 3 58268 AEV_3_3_RA3_01_1233.d 6.58E4 2 2 343 361 Methylation(others)
R.YEALSDPSKLDSN(+.98)KDLR.I Y 43.96 1950.9534 17 6.5 488.7488 4 61.22 3 33360 AEV_3_3_RA3_01_1233.d 1.77E5 1 1 47 63 Deamidation (NQ)
K.IEEEELNKTKPIWTR.N Y 42.97 1884.9945 15 2.6 472.2571 4 63.93 3 35450 AEV_3_3_RA3_01_1233.d 3.56E5 2 2 260 274
R.IDIIPDKANK(+14.02).T Y 42.38 1139.6550 10 2.9 380.8934 3 57.75 3 30768 AEV_3_3_RA3_01_1233.d 1.26E5 1 1 64 73 Methylation(KR)
K.GVVDSEDLPLN(+.98)LSR.E Y 41.30 1513.7623 14 5.1 757.8923 2 78.66 3 47048 AEV_3_3_RA3_01_1233.d 5.89E4 1 1 362 375 Deamidation (NQ)
K.ADLVN(+.98)NLGTIAR.S Y 38.66 1256.6725 12 -0.8 629.3430 2 76.02 2 37408 AEV_1_3_RA2_01_1232.d 2.23E5 4 4 87 98 Deamidation (NQ)
K.HNDDEQYIWESSAGGTFK(+14.02).I Y 37.81 2096.9075 18 0.6 699.9769 3 74.58 3 43805 AEV_3_3_RA3_01_1233.d 1.76E4 1 1 140 157 Methylation(KR)
R.SPIIKELKK.K Y 36.87 1054.6749 9 -32.9 528.3274 2 33.04 3 15170 AEV_3_3_RA3_01_1233.d 0 1 1 614 622
K.LGIHE(+14.02)DAQNR.S Y 36.87 1165.5840 10 -2.2 583.7980 2 39.01 3 18808 AEV_3_3_RA3_01_1233.d 1.9E5 2 2 422 431 Methylation(others)
R.RVFITDDATD(+14.02)LIPEWLSFVK.G Y 36.84 2378.2522 20 12.1 793.7676 3 93.72 3 56665 AEV_3_3_RA3_01_1233.d 2.63E5 1 1 342 361 Methylation(others)
K.SGDETTSLAD(+14.02)YVTR.M Y 36.11 1527.7052 14 3.2 764.8623 2 70.71 2 33379 AEV_1_3_RA2_01_1232.d 1.45E5 2 2 445 458 Methylation(others)
K.GVVD(+14.02)SEDLPLNLSR.E Y 35.97 1526.7939 14 -7.1 764.3988 2 78.24 3 46688 AEV_3_3_RA3_01_1233.d 4.42E4 2 2 362 375 Methylation(others)
R.SPIIKELK.K Y 33.90 926.5800 8 -34.7 464.2812 2 46.64 2 18749 AEV_1_3_RA2_01_1232.d 2.39E5 3 3 614 621
K.ADLVN(+.98)NLGTIAR(+14.02).S Y 33.63 1270.6881 12 -21.0 636.3380 2 75.85 2 37273 AEV_1_3_RA2_01_1232.d 0 1 1 87 98 Deamidation (NQ); Methylation(KR)
R.SPIIK.E Y 33.49 556.3584 5 3.2 557.3674 1 20.63 2 6671 AEV_1_3_RA2_01_1232.d 2.09E4 1 1 614 618
K.TFEISPR(+14.02).S Y 33.37 862.4548 7 15.6 432.2414 2 15.95 3 5639 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 607 613 Methylation(KR)
R.ELISNC(+57.02)SDALDKIR.Y Y 32.60 1632.8141 14 -89.1 545.2302 3 75.04 1 37908 AEV 2_3_RA2_01_1224.d 1.74E5 1 1 33 46 Carbamidomethylation
K.RAPFDLFETKK.T Y 32.15 1350.7295 11 18.8 451.2589 3 67.87 2 31292 AEV_1_3_RA2_01_1232.d 2.49E5 4 4 321 331
K.IT(+79.96)QDTDGESLGR.G Y 29.73 1370.5620 12 -6.4 457.8583 3 55.57 1 23541 AEV 2_3_RA2_01_1224.d 0 1 1 158 169 Sulfation
R.E(+14.02)AEEKEFEGLAK.A Y 29.70 1392.6772 12 0.9 465.2334 3 62.57 3 34404 AEV_3_3_RA3_01_1233.d 1.4E5 2 2 536 547 Methylation(others)
K.LGIHEDAQNR(+14.02).S Y 29.43 1165.5840 10 4.6 389.5370 3 35.63 2 13364 AEV_1_3_RA2_01_1232.d 3.27E5 2 2 422 431 Methylation(KR)
K.KTFEISPR.S Y 29.07 976.5341 8 1.6 489.2751 2 42.54 2 16729 AEV_1_3_RA2_01_1232.d 2.53E5 2 2 606 613
R.NPADITQEEYASFYK(+14.02).T Y 29.05 1788.8206 15 -87.0 895.3398 2 81.32 1 42887 AEV 2_3_RA2_01_1224.d 1.57E5 1 1 275 289 Methylation(KR)
K.TFE(+14.02)ISPR.S Y 27.95 862.4548 7 -29.0 432.2222 2 59.24 3 31841 AEV_3_3_RA3_01_1233.d 0 2 2 607 613 Methylation(others)
K.ADLVNN(+.98)LGTIAR.S Y 27.32 1256.6725 12 -34.4 629.3219 2 75.83 3 44783 AEV_3_3_RA3_01_1233.d 0 1 1 87 98 Deamidation (NQ)
K.FYS(+79.97)AFSK(+27.99).N Y 27.05 956.3680 7 73.7 319.8201 3 45.39 1 17496 AEV 2_3_RA2_01_1224.d 3.64E5 1 1 412 418 Phosphorylation (STY); Formylation
K.RAPFDLFETK(+14.02).K Y 26.76 1236.6503 10 5.2 413.2262 3 76.22 2 37568 AEV_1_3_RA2_01_1232.d 2.3E5 2 2 321 330 Methylation(KR)
K.LDSNK.D Y 26.47 575.2915 5 -37.9 576.2770 1 51.91 2 21418 AEV_1_3_RA2_01_1232.d 0 1 1 56 60
K.LDSNKDLR.I Y 26.46 959.5036 8 -89.5 480.7161 2 29.11 1 8511 AEV 2_3_RA2_01_1224.d 5.93E4 2 2 56 63
R.APFDLFETK.K Y 26.35 1066.5334 9 -86.0 534.2281 2 83.56 1 44669 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 322 330
K.HFSVE(+14.02)GQLEFR.A Y 25.69 1361.6727 11 -98.5 454.8535 3 81.90 1 43323 AEV 2_3_RA2_01_1224.d 6.52E4 1 1 303 313 Methylation(others)
K.SGD(+14.02)ETTSLADYVTR.M Y 25.47 1527.7052 14 -88.8 764.7921 2 76.86 1 39406 AEV 2_3_RA2_01_1224.d 2.7E4 1 1 445 458 Methylation(others)
K.NVLGDK(-2.02).V Y 25.38 642.3337 6 -55.0 643.3056 1 72.38 1 35810 AEV 2_3_RA2_01_1224.d 0 1 1 551 556 2-amino-3-oxo-butanoic_acid
R.EAEEKE(+14.02)FEGLAK.A Y 25.06 1392.6772 12 -6.1 697.3417 2 60.11 3 32499 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 536 547 Methylation(others)
R.EAEEKEFEGLAK(+14.02).A Y 24.94 1392.6772 12 0.3 465.2332 3 61.63 3 33734 AEV_3_3_RA3_01_1233.d 2.81E5 1 1 536 547 Methylation(KR)
K.L(+43.01)GIHEDAQNR.S Y 24.92 1194.5741 10 1.3 399.1992 3 28.29 2 9942 AEV_1_3_RA2_01_1232.d 9.93E4 1 1 422 431 Carbamylation
R.M(+15.99)QEHQKQM(+15.99)YYITGESLK.A Y 24.06 2144.9871 17 21.6 537.2656 4 51.21 3 26516 AEV_3_3_RA3_01_1233.d 0 1 1 459 475 Oxidation (M)
K.SGD(-18.01)ETTSLADYVTR(+14.02).M Y 23.94 1509.6947 14 -40.4 755.8241 2 79.87 1 41742 AEV 2_3_RA2_01_1224.d 2.89E4 1 1 445 458 Dehydration; Methylation(KR)
K.ITQDTD(-18.01)GESLGR.G Y 23.30 1272.5946 12 -9.4 637.2986 2 40.10 3 19465 AEV_3_3_RA3_01_1233.d 5.94E4 1 1 158 169 Dehydration
K.LDSNK(-.98).D Y 23.10 574.3074 5 -10.6 575.3086 1 28.73 2 10140 AEV_1_3_RA2_01_1232.d 1E4 1 1 56 60 Amidation
K.TKPIWTR.N Y 22.62 900.5181 7 2.6 301.1808 3 35.60 3 16697 AEV_3_3_RA3_01_1233.d 2.73E5 1 1 268 274
K.T(+27.99)LELFTEIAEDR.E Y 22.62 1463.7144 12 37.6 732.8920 2 82.87 2 42786 AEV_1_3_RA2_01_1232.d 6.88E4 1 1 395 406 Formylation
R.T(+79.97)GQFGWSANM(+15.99)ER.I Y 22.43 1478.5649 12 29.5 740.3116 2 92.69 1 51552 AEV 2_3_RA2_01_1224.d 0 1 1 575 586 Phosphorylation (STY); Oxidation (M)
K.SPFLDTLK.E Y 22.23 919.5015 8 -6.4 460.7551 2 70.11 2 32965 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 480 487
R.SALAK(+42.01).L Y 22.21 530.3064 5 -66.2 531.2786 1 66.04 3 37101 AEV_3_3_RA3_01_1233.d 9.8E4 1 1 432 436 Acetylation (K)
K.SGDETTSLAD(+43.99)YVT(+79.97)R.M Y 21.98 1637.6458 14 37.7 546.9098 3 74.34 1 37341 AEV 2_3_RA2_01_1224.d 5.16E5 1 1 445 458 Carboxylation (DKW); Phosphorylation (STY)
K.LIGSP(+31.99)C(+57.02)AIR.T Y 21.94 1017.5277 9 7.0 340.1855 3 52.25 2 21600 AEV_1_3_RA2_01_1232.d 1.44E5 2 2 566 574 Dihydroxy; Carbamidomethylation
K.LDSNK(+21.98)(+42.01).D Y 21.67 639.2840 5 17.2 640.3022 1 48.17 2 19526 AEV_1_3_RA2_01_1232.d 0 1 1 56 60 Sodium adduct; Acetylation (K)
K.FYSAFSK(+226.08).N Y 21.30 1074.4844 7 -41.3 538.2273 2 78.64 1 40753 AEV 2_3_RA2_01_1224.d 1.24E5 1 1 412 418 Biotinylation
K.KHSEFISYPIYLHVVK.E Y 21.00 1959.0618 16 59.1 392.8428 5 72.47 3 42166 AEV_3_3_RA3_01_1233.d 0 1 1 196 211
K.LDSNK(+42.01).D Y 20.98 617.3021 5 -84.3 618.2573 1 54.02 1 22570 AEV 2_3_RA2_01_1224.d 0 1 1 56 60 Acetylation (K)
K.A(+42.01)LKN(+.98)VLGDK(+42.01).V Y 20.98 1041.5706 9 7.0 348.1999 3 57.74 2 24534 AEV_1_3_RA2_01_1232.d 0 1 1 548 556 Acetylation (N-term); Deamidation (NQ); Acetylation (K)
K.LGIHEDAQ(+.98)NR.S Y 20.92 1152.5524 10 25.1 577.2979 2 26.39 3 11360 AEV_3_3_RA3_01_1233.d 0 1 1 422 431 Deamidation (NQ)
K.VEADGEN(+.98)DRTVK(+14.02).S Y 20.68 1346.6313 12 -53.8 674.2867 2 52.79 1 21838 AEV 2_3_RA2_01_1224.d 0 1 1 624 635 Deamidation (NQ); Methylation(KR)
R.I(+41.03)DIIPDKANK.T Y 20.64 1166.6659 10 27.7 389.9067 3 52.98 3 27691 AEV_3_3_RA3_01_1233.d 0 1 1 64 73 Amidination of lysines or N-terminal amines with methyl acetimidate
R.DTSM(+15.99)SSYMSSK.K Y 20.40 1238.4795 11 -4.8 620.2440 2 54.85 1 23077 AEV 2_3_RA2_01_1224.d 2.34E4 1 1 595 605 Oxidation (M)
R.ID(+37.96)IIPDKANK.T Y 20.40 1163.5952 10 18.2 388.8794 3 55.06 2 23083 AEV_1_3_RA2_01_1232.d 8.93E5 1 1 64 73 Replacement of proton by potassium
K.TFEIS(+14.02)PR.S Y 20.28 862.4548 7 -84.8 432.1981 2 70.20 1 34108 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 607 613 Methylation(others)
R.ETLQQNK.I Y 19.99 859.4399 7 -91.4 430.6880 2 17.25 1 4079 AEV 2_3_RA2_01_1224.d 3.99E3 1 1 376 382
K.VEEVDDEEEEKK.K Y 19.80 1476.6467 12 -19.7 739.3161 2 84.52 1 45396 AEV 2_3_RA2_01_1224.d 0 1 1 236 247
R.AILFVPKR.A Y 19.76 942.6014 8 -116.4 315.1712 3 73.15 1 36467 AEV 2_3_RA2_01_1224.d 0 1 1 314 321
K.L(+43.01)IGSPC(+57.02)AIR(+14.02).T Y 19.58 1042.5593 9 -26.2 348.5179 3 53.57 3 28096 AEV_3_3_RA3_01_1233.d 8.29E3 1 1 566 574 Carbamylation; Carbamidomethylation; Methylation(KR)
R.APFDLFETKK.T Y 19.34 1194.6284 10 -3.5 399.2154 3 71.41 2 33907 AEV_1_3_RA2_01_1232.d 7.31E4 1 1 322 331
K.ITQDTDGESLGRGTK(+21.98).M Y 19.33 1598.7512 15 -17.7 800.3688 2 91.65 1 50814 AEV 2_3_RA2_01_1224.d 0 1 1 158 172 Sodium adduct
R.DTSM(-21.99)SSYMSSK.K Y 19.30 1200.4968 11 76.9 301.1546 4 59.53 1 26147 AEV 2_3_RA2_01_1224.d 0 1 1 595 605 Methionine replacement by homopropargylglycine
K.IRYEALSDPSK(+14.02)LDSN(+.98)K(+42.01).D Y 19.21 1891.9526 16 -12.0 946.9722 2 83.17 3 50428 AEV_3_3_RA3_01_1233.d 6.47E4 1 1 45 60 Methylation(KR); Deamidation (NQ); Acetylation (K)
K.LVDIT(+117.00)K.D Y 19.19 804.4146 6 -15.6 805.4093 1 83.87 2 43522 AEV_1_3_RA2_01_1232.d 7.18E4 1 1 516 521 Phospho-propargylamine
K.EIFLR.E N 18.69 676.3907 5 -3.6 339.2014 2 56.64 3 29962 AEV_3_3_RA3_01_1233.d 9.11E4 1 1 28 32
K.QM(+15.99)YYITGES(+79.97)LK.A Y 18.47 1427.6044 11 -20.8 357.9009 4 64.92 1 30119 AEV 2_3_RA2_01_1224.d 2.98E5 1 1 465 475 Oxidation (M); Phosphorylation (STY)
K.ITQDTDGESLGR(+28.03)GTK.M Y 18.43 1604.8005 15 29.3 402.2191 4 23.22 2 7738 AEV_1_3_RA2_01_1232.d 0 1 1 158 172 Dimethylation(KR)
K.T(+42.01)FEISPRSPIIK(+14.02)ELKK.K Y 18.38 1941.1299 16 -61.8 389.2093 5 51.18 3 26498 AEV_3_3_RA3_01_1233.d 0 1 1 607 622 Acetylation (N-term); Methylation(KR)
K.VEEVDDEEEEKKKEK.K Y 18.31 1861.8792 15 -85.1 466.4375 4 29.63 1 8783 AEV 2_3_RA2_01_1224.d 8.61E4 1 1 236 250
K.TLSNDWEDHLAVKHFSVEGQLEFR.A Y 18.26 2856.3831 24 8.2 572.2886 5 79.04 3 47319 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 290 313
K.LGIHEDAQNR(-.98).S Y 17.75 1150.5844 10 -9.9 576.2938 2 63.48 3 35111 AEV_3_3_RA3_01_1233.d 0 1 1 422 431 Amidation
K.AVQ(+.98)K(+28.03)SPFLDTLK.E Y 17.64 1374.7759 12 23.0 459.2765 3 69.84 2 32727 AEV_1_3_RA2_01_1232.d 0 1 1 476 487 Deamidation (NQ); Dimethylation(KR)
R.YEALSDPSK(+14.02).L Y 17.62 1022.4920 9 -61.6 512.2218 2 57.11 1 24493 AEV 2_3_RA2_01_1224.d 0 1 1 47 55 Methylation(KR)
K.EFD(-18.01)GK.K Y 17.50 576.2543 5 -31.8 577.2433 1 112.67 2 54485 AEV_1_3_RA2_01_1232.d 2.79E3 1 1 510 514 Dehydration
R.DTSM(+15.99)SSYMSSK(+42.01).K Y 17.49 1280.4901 11 -11.5 641.2450 2 57.64 1 24901 AEV 2_3_RA2_01_1224.d 9.51E4 1 1 595 605 Oxidation (M); Acetylation (K)
K.IEE(+14.02)EELNK.T Y 17.48 1016.5026 8 29.5 509.2735 2 39.95 3 19387 AEV_3_3_RA3_01_1233.d 0 1 1 260 267 Methylation(others)
R.DTSMSSYMSSK.K Y 17.33 1222.4846 11 15.7 408.5085 3 55.01 1 23183 AEV 2_3_RA2_01_1224.d 0 1 1 595 605
K.TFEISPR(+28.03)S(+79.97)PIIKELKK.K Y 17.32 1993.1012 16 -2.2 665.3729 3 82.40 2 42424 AEV_1_3_RA2_01_1232.d 5.21E4 1 1 607 622 Dimethylation(KR); Phosphorylation (STY)
K.IEEEELN(+.98)K(+14.02)TKPIWTR.N Y 17.29 1899.9941 15 -16.3 475.9980 4 66.17 3 37206 AEV_3_3_RA3_01_1233.d 0 1 1 260 274 Deamidation (NQ); Methylation(KR)
K.LIGSPCAIR.T Y 16.97 928.5164 9 -13.5 465.2592 2 58.72 3 31455 AEV_3_3_RA3_01_1233.d 0 1 1 566 574
K.LLRFNSTK.S Y 16.96 977.5658 8 -24.0 489.7784 2 38.74 3 18659 AEV_3_3_RA3_01_1233.d 0 1 1 437 444
R.RVFITDDATDLIPEWLS(-2.02)FVK.G Y 16.88 2362.2209 20 -2.3 788.4125 3 93.17 3 56396 AEV_3_3_RA3_01_1233.d 0 1 1 342 361 2-amino-3-oxo-butanoic_acid
K.SGDET(+13.03)TSLADYVTR.M Y 16.85 1526.7212 14 -0.4 764.3676 2 74.09 3 43418 AEV_3_3_RA3_01_1233.d 7.09E4 1 1 445 458 Michael addition with methylamine
R.EAEEK(+14.02)EFEGLAKALKNVLGD(-18.01)K.V Y 16.57 2313.2214 21 -11.9 579.3057 4 77.30 3 45936 AEV_3_3_RA3_01_1233.d 0 1 1 536 556 Methylation(KR); Dehydration
K.I(+42.01)TQDTDGES(+79.97)LGR.G Y 16.30 1412.5820 12 14.1 471.8746 3 72.44 1 35857 AEV 2_3_RA2_01_1224.d 0 1 1 158 169 Acetylation (N-term); Phosphorylation (STY)
K.KLVDITKDFELEETDEEK(+14.02)K.T Y 16.26 2322.1841 19 -2.0 581.5521 4 77.36 2 38460 AEV_1_3_RA2_01_1232.d 7.49E4 1 1 515 533 Methylation(KR)
K.NVLGDKVEK.V Y 16.25 1000.5553 9 -18.8 501.2755 2 54.84 3 28892 AEV_3_3_RA3_01_1233.d 0 1 1 551 559
R.FN(+.98)STK(-.98).S Y 15.88 595.2966 5 -28.9 596.2866 1 20.00 2 6404 AEV_1_3_RA2_01_1232.d 0 1 1 440 444 Deamidation (NQ); Amidation
R.IDIIPDK.A Y 15.87 812.4644 7 -91.0 407.2025 2 70.23 1 34131 AEV 2_3_RA2_01_1224.d 1.69E5 1 1 64 70
R.ETLQQ(+.98)NK.I Y 15.81 860.4240 7 -46.3 431.1993 2 60.67 1 26975 AEV 2_3_RA2_01_1224.d 0 1 1 376 382 Deamidation (NQ)
K.DLRIDIIPDK(+14.02)ANK(+42.01).T Y 15.74 1565.8777 13 30.8 314.1924 5 58.85 3 31561 AEV_3_3_RA3_01_1233.d 0 1 1 61 73 Methylation(KR); Acetylation (K)
R.TGQFGWS(+79.97)ANMER(+14.02)IMK.A Y 15.46 1848.8052 15 -37.7 463.1912 4 56.01 1 23839 AEV 2_3_RA2_01_1224.d 0 1 1 575 589 Phosphorylation (STY); Methylation(KR)
R.FNSTK.S Y 15.46 595.2966 5 -17.0 596.2937 1 28.77 2 10155 AEV_1_3_RA2_01_1232.d 1.96E4 1 1 440 444
K.NVLGDKVEK(+27.99).V Y 15.45 1028.5502 9 -4.0 343.8560 3 31.54 3 14290 AEV_3_3_RA3_01_1233.d 0 1 1 551 559 Formylation
K.EFD(+21.98)GK.K Y 15.41 616.2468 5 1.5 617.2550 1 72.79 1 36132 AEV 2_3_RA2_01_1224.d 3.3E4 1 1 510 514 Sodium adduct
K.IRY(-18.01)EALSDPSKLDSNK(+42.01).D Y 15.38 1858.9424 16 -9.7 465.7383 4 35.75 3 16787 AEV_3_3_RA3_01_1233.d 1.69E5 1 1 45 60 Dehydration; Acetylation (K)
R.IMK(+43.99)AQ(+.98)ALR.D Y 15.33 974.5219 8 -12.8 488.2620 2 46.85 3 23719 AEV_3_3_RA3_01_1233.d 0 1 1 587 594 Carboxylation (DKW); Deamidation (NQ)
R.IM(+15.99)KAQALR(+21.98).D Y 15.31 967.5249 8 -13.1 323.5114 3 33.76 2 12483 AEV_1_3_RA2_01_1232.d 9.49E4 1 1 587 594 Oxidation (M); Sodium adduct
K.HSEFISYPIYLHVVK(-.98).E Y 15.24 1829.9828 15 18.3 458.5114 4 77.17 2 38314 AEV_1_3_RA2_01_1232.d 3.43E4 1 1 197 211 Amidation
K.IT(+79.97)QDTD(+21.98)GESLGR.G Y 15.20 1392.5535 12 14.6 465.1985 3 68.05 1 32471 AEV 2_3_RA2_01_1224.d 1.54E5 1 1 158 169 Phosphorylation (STY); Sodium adduct
K.ITQDTDGESLGRGT(+79.97)K(+42.01).M Y 15.18 1698.7461 15 -41.0 425.6764 4 63.90 1 29486 AEV 2_3_RA2_01_1224.d 5.16E5 1 1 158 172 Phosphorylation (STY); Acetylation (K)
K.A(+27.99)Q(+.98)ALRDTSMSSYMSSK.K Y 15.13 1790.7815 16 -35.5 448.6867 4 73.54 1 36715 AEV 2_3_RA2_01_1224.d 0 1 1 590 605 Formylation; Deamidation (NQ)
K.I(+27.99)T(+79.97)QDTDGESLGR.G Y 15.10 1398.5664 12 33.1 467.2115 3 84.98 1 45772 AEV 2_3_RA2_01_1224.d 4.19E5 1 1 158 169 Formylation; Phosphorylation (STY)
K.A(+42.01)NK(+42.01)TLTIQDTGIGMT(+79.97)K.A Y 15.08 1854.8799 16 37.4 619.3237 3 77.27 2 38388 AEV_1_3_RA2_01_1232.d 3.14E4 1 1 71 86 Acetylation (N-term); Acetylation (K); Phosphorylation (STY)
K.NFEVLFLVDPIDEYAM(+15.99)TQLKEFDGKK.L Y 15.01 3104.5415 26 -0.9 777.1420 4 91.67 2 48025 AEV_1_3_RA2_01_1232.d 8.39E4 1 1 490 515 Oxidation (M)
total 171 peptides
C1G391
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.FKFPENSVSLYAAK.V Y 153.15 1599.8296 14 3.4 534.2856 3 74.19 2 36038 AEV_1_3_RA2_01_1232.d 4.84E6 11 11 80 93
K.SLPDSVTIIDPKEEEPVLHPISQDYGAK.A Y 151.96 3076.5603 28 0.7 1026.5281 3 79.13 2 39882 AEV_1_3_RA2_01_1232.d 3.72E6 9 9 206 233
K.ALAAQQLAEQQR.L Y 126.05 1325.7051 12 -0.1 663.8597 2 56.17 2 23670 AEV_1_3_RA2_01_1232.d 6.09E6 14 14 234 245
K.ALAAQQLAEQQRLAEQQEAEAAGQGVGPDGQVVEGQE Y 126.01 3802.8357 37 2.5 1268.6223 3 78.00 2 39000 AEV_1_3_RA2_01_1232.d 6.8E5 3 3 234 270
R.LAEQQEAEAAGQGVGPDGQVVEGQE Y 124.03 2495.1411 25 2.4 1248.5808 2 69.57 2 32552 AEV_1_3_RA2_01_1232.d 2.15E6 9 9 246 270
R.ELAEEGYSGVEVR.V Y 117.61 1436.6782 13 2.5 719.3482 2 64.50 2 28899 AEV_1_3_RA2_01_1232.d 1.93E6 6 6 31 43
K.FVADGVFYAELNEFFQR.E Y 115.96 2050.9788 17 1.9 684.6682 3 93.16 3 56410 AEV_3_3_RA3_01_1233.d 2.96E5 4 4 14 30
K.FTDGFMIHSGQPVRDFIDSATR.H Y 115.83 2496.1855 22 -7.6 625.0490 4 81.08 2 41416 AEV_1_3_RA2_01_1232.d 1.49E6 6 6 155 176
R.ATHTQEVLGEQGRR.I Y 109.19 1580.8019 14 4.8 527.9438 3 26.14 2 9033 AEV_1_3_RA2_01_1232.d 6.59E6 13 13 55 68
R.ATHTQEVLGEQGR.R Y 102.16 1424.7008 13 4.0 475.9094 3 30.58 2 10965 AEV_1_3_RA2_01_1232.d 3.56E6 12 12 55 67
K.EEEPVLHPISQDYGAK.A Y 100.71 1810.8737 16 -1.9 604.6307 3 64.21 3 35666 AEV_3_3_RA3_01_1233.d 4.69E5 3 3 218 233
R.FKFPEN(+.98)SVSLYAAK.V Y 99.75 1600.8136 14 1.8 534.6128 3 76.08 2 37525 AEV_1_3_RA2_01_1232.d 4.95E5 3 3 80 93 Deamidation (NQ)
R.GLSAVAQC(+57.02)ESLR.Y Y 99.05 1289.6398 12 0.5 645.8275 2 62.58 2 27596 AEV_1_3_RA2_01_1232.d 3.67E6 7 7 98 109 Carbamidomethylation
R.FIMESGAKGC(+57.02)EVVVSGK.L Y 98.79 1796.8800 17 3.3 599.9692 3 64.38 3 35809 AEV_3_3_RA3_01_1233.d 2.14E5 2 2 128 144 Carbamidomethylation
R.FKFPENSVSLYAAK(+14.02).V Y 95.05 1613.8453 14 5.8 538.9589 3 75.83 2 37256 AEV_1_3_RA2_01_1232.d 2.4E5 3 3 80 93 Methylation(KR)
K.ALAAQQLAEQQRLAEQQE(+14.02)AEAAGQGVGPDGQVVEGQE Y 93.74 3816.8513 37 -0.8 1273.2900 3 80.39 3 48370 AEV_3_3_RA3_01_1233.d 1.84E5 2 2 234 270 Methylation(others)
K.SLPDSVTIIDPKEE(+14.02)EPVLHPISQDYGAK.A Y 92.92 3090.5759 28 1.9 773.6527 4 80.71 3 48617 AEV_3_3_RA3_01_1233.d 1.03E6 2 2 206 233 Methylation(others)
K.SLPDSVTIIDPK(+14.02)EEEPVLHPISQDYGAK.A Y 92.39 3090.5759 28 -1.2 1031.1980 3 79.76 3 47886 AEV_3_3_RA3_01_1233.d 1.29E6 4 4 206 233 Methylation(KR)
K.ALAAQQLAEQQ(+.98)RLAEQQEAEAAGQGVGPDGQVVEGQE Y 90.42 3803.8198 37 4.5 1268.9529 3 79.37 3 47580 AEV_3_3_RA3_01_1233.d 1.27E5 2 2 234 270 Deamidation (NQ)
K.SLPDSVTIIDPKEEE(+14.02)PVLHPISQDYGAK.A Y 89.81 3090.5759 28 0.0 1031.1992 3 80.17 3 48201 AEV_3_3_RA3_01_1233.d 6.2E5 3 3 206 233 Methylation(others)
R.IRELTSLIQKR.F Y 89.49 1355.8248 11 6.5 452.9518 3 62.89 2 27807 AEV_1_3_RA2_01_1232.d 2.39E6 8 8 69 79
K.ALAAQQLAEQQRLAEQQEAEAAGQGVGPDGQVVE(+14.02)GQE Y 88.87 3816.8513 37 0.9 1273.2922 3 78.77 3 47111 AEV_3_3_RA3_01_1233.d 8.1E4 1 1 234 270 Methylation(others)
K.GC(+57.02)EVVVSGK.L Y 87.33 933.4589 9 -0.5 467.7365 2 25.66 3 10943 AEV_3_3_RA3_01_1233.d 1.76E6 7 7 136 144 Carbamidomethylation
K.FTDGFM(+15.99)IHSGQPVRDFIDSATR.H Y 87.08 2512.1804 22 -1.4 629.0515 4 78.72 3 47066 AEV_3_3_RA3_01_1233.d 2.41E5 2 2 155 176 Oxidation (M)
R.VTPTVTDIIIR.A Y 85.59 1226.7234 11 -9.1 614.3634 2 76.86 2 38117 AEV_1_3_RA2_01_1232.d 4.54E6 8 8 44 54
K.ALAAQQLAEQQRLAE(+14.02)QQEAEAAGQGVGPDGQVVEGQE Y 84.91 3816.8513 37 1.4 1273.2928 3 79.42 3 47618 AEV_3_3_RA3_01_1233.d 8.49E4 2 2 234 270 Methylation(others)
R.FKFPE(+14.02)NSVSLYAAK.V Y 83.82 1613.8453 14 1.3 538.9564 3 76.63 2 37886 AEV_1_3_RA2_01_1232.d 7.95E5 4 4 80 93 Methylation(others)
R.GLSAVAQC(+57.02)ESLRYK.L Y 82.68 1580.7981 14 2.3 527.9412 3 62.33 3 34275 AEV_3_3_RA3_01_1233.d 5.84E5 4 4 98 111 Carbamidomethylation
K.SLPDSVTIIDPKEEEPVLHPISQDYGAK(+14.02).A Y 82.63 3090.5759 28 6.2 773.6561 4 79.07 3 47339 AEV_3_3_RA3_01_1233.d 6.61E5 3 3 206 233 Methylation(KR)
K.VQNRGLSAVAQC(+57.02)ESLR.Y Y 80.53 1786.9108 16 7.2 596.6485 3 60.15 3 32523 AEV_3_3_RA3_01_1233.d 8.05E4 1 1 94 109 Carbamidomethylation
K.ALAAQQLAEQQ(+.98)R.L Y 79.93 1326.6891 12 2.2 664.3533 2 59.11 2 25331 AEV_1_3_RA2_01_1232.d 7.68E5 3 3 234 245 Deamidation (NQ)
R.ATHTQEVLGEQ(+.98)GR.R Y 79.34 1425.6848 13 -1.7 713.8484 2 32.22 3 14759 AEV_3_3_RA3_01_1233.d 6.68E4 1 1 55 67 Deamidation (NQ)
K.ALAAQQLAE(+14.02)QQR.L Y 77.49 1339.7208 12 -5.9 670.8637 2 59.36 3 31970 AEV_3_3_RA3_01_1233.d 5.57E5 4 4 234 245 Methylation(others)
R.LAEQ(+.98)QEAEAAGQGVGPDGQVVEGQE Y 76.41 2496.1252 25 -1.4 1249.0681 2 70.82 3 40873 AEV_3_3_RA3_01_1233.d 2.44E5 1 1 246 270 Deamidation (NQ)
R.LAEQQEAEAAGQGVGPDGQ(+.98)VVEGQE Y 76.10 2496.1252 25 0.1 1249.0701 2 70.39 3 40560 AEV_3_3_RA3_01_1233.d 7.83E5 3 3 246 270 Deamidation (NQ)
R.ATHTQEVLGEQGR(+14.02)R.I Y 76.03 1594.8175 14 1.0 532.6136 3 31.21 3 14145 AEV_3_3_RA3_01_1233.d 1.04E6 6 6 55 68 Methylation(KR)
K.FVADGVFYAELNEFFQRELAEEGYSGVEVR.V Y 74.26 3469.6465 30 5.4 1157.5624 3 94.15 3 56851 AEV_3_3_RA3_01_1233.d 8.56E4 1 1 14 43
R.KFVADGVFYAELNEFFQR.E Y 72.31 2179.0737 18 4.1 727.3682 3 89.21 2 46839 AEV_1_3_RA2_01_1232.d 4.14E4 1 1 13 30
R.ATHTQ(+.98)EVLGEQGR.R Y 71.12 1425.6848 13 -2.8 713.8477 2 32.73 3 15005 AEV_3_3_RA3_01_1233.d 2.5E5 4 4 55 67 Deamidation (NQ)
K.SLPDSVTIIDPK.E Y 70.88 1283.6973 12 5.6 642.8595 2 74.17 2 36000 AEV_1_3_RA2_01_1232.d 5.46E5 4 4 206 217
R.IRELTSLIQK.R Y 70.39 1199.7238 10 -4.1 400.9136 3 65.32 3 36566 AEV_3_3_RA3_01_1233.d 4.24E5 3 3 69 78
K.ALAAQ(+.98)QLAEQQR.L Y 70.34 1326.6891 12 -0.8 664.3513 2 59.24 3 31844 AEV_3_3_RA3_01_1233.d 2.05E5 3 3 234 245 Deamidation (NQ)
R.LAEQQEAEAAGQGVGPDGQVVE(+14.02)GQE Y 70.32 2509.1567 25 0.1 1255.5858 2 72.12 3 41886 AEV_3_3_RA3_01_1233.d 7.04E5 6 6 246 270 Methylation(others)
K.ALAAQQLAEQ(+.98)QR.L Y 70.19 1326.6891 12 -3.1 664.3497 2 57.65 3 30692 AEV_3_3_RA3_01_1233.d 7.21E4 2 2 234 245 Deamidation (NQ)
R.LAEQQEAE(+14.02)AAGQGVGPDGQVVEGQE Y 69.12 2509.1567 25 -0.1 1255.5856 2 71.24 3 41202 AEV_3_3_RA3_01_1233.d 4.63E5 4 4 246 270 Methylation(others)
R.ATHTQEVLGEQGR(+14.02).R Y 68.25 1438.7164 13 1.9 720.3669 2 40.22 2 15573 AEV_1_3_RA2_01_1232.d 7.87E5 10 10 55 67 Methylation(KR)
R.LAEQQEAEAAGQGVGPDGQVVEGQE(+14.02) Y 67.59 2509.1567 25 -0.1 1255.5856 2 72.51 3 42195 AEV_3_3_RA3_01_1233.d 7.25E5 4 4 246 270 Methylation(others)
R.GLSAVAQC(+57.02)ESLR(+14.02).Y Y 67.55 1303.6554 12 5.2 652.8384 2 66.93 2 30602 AEV_1_3_RA2_01_1232.d 5.62E5 4 4 98 109 Carbamidomethylation; Methylation(KR)
R.YKLLNGLAVR.R Y 67.40 1145.6920 10 -3.4 382.9033 3 67.91 3 38580 AEV_3_3_RA3_01_1233.d 6.17E5 3 3 110 119
K.FTDGFMIHSGQPVR.D Y 67.08 1590.7612 14 7.5 531.2650 3 68.06 2 31400 AEV_1_3_RA2_01_1232.d 7.2E4 2 2 155 168
R.VTPTVTDIIIR(+14.02).A Y 66.52 1240.7390 11 -27.5 621.3597 2 79.14 2 39904 AEV_1_3_RA2_01_1232.d 0 1 1 44 54 Methylation(KR)
R.AC(+57.02)YGVLR.F Y 63.97 837.4167 7 -0.2 419.7155 2 45.95 3 23186 AEV_3_3_RA3_01_1233.d 3.1E6 8 8 121 127 Carbamidomethylation
K.GC(+57.02)E(+14.02)VVVSGK.L Y 63.41 947.4746 9 -87.2 474.7032 2 47.43 1 18737 AEV 2_3_RA2_01_1224.d 6.72E5 5 5 136 144 Carbamidomethylation; Methylation(others)
R.GLSAVAQ(+.98)C(+57.02)ESLR.Y Y 62.96 1290.6238 12 -1.1 646.3185 2 63.71 3 35285 AEV_3_3_RA3_01_1233.d 6.12E5 7 7 98 109 Deamidation (NQ); Carbamidomethylation
R.ELAEE(+14.02)GYSGVEVR.V Y 62.29 1450.6940 13 -0.5 726.3539 2 67.93 3 38602 AEV_3_3_RA3_01_1233.d 2.82E5 2 2 31 43 Methylation(others)
R.LAEQQ(+.98)EAEAAGQGVGPDGQVVEGQE Y 61.93 2496.1252 25 -0.7 833.0485 3 70.82 3 40870 AEV_3_3_RA3_01_1233.d 3.86E5 1 1 246 270 Deamidation (NQ)
K.ALAAQQLAEQQRLAEQQEAEAAGQ(+.98)GVGPDGQVVEGQE Y 61.02 3803.8198 37 2.3 1268.9502 3 78.44 2 39320 AEV_1_3_RA2_01_1232.d 2.25E4 2 2 234 270 Deamidation (NQ)
R.VTPTVTD(+14.02)IIIR.A Y 60.52 1240.7390 11 -19.2 621.3649 2 77.19 3 45867 AEV_3_3_RA3_01_1233.d 0 1 1 44 54 Methylation(others)
R.ATHTQE(+14.02)VLGEQGR.R Y 59.63 1438.7164 13 -0.4 720.3652 2 34.45 3 15999 AEV_3_3_RA3_01_1233.d 1.83E5 3 3 55 67 Methylation(others)
R.HVLLR.Q N 59.45 636.4071 5 0.6 319.2110 2 24.61 3 10355 AEV_3_3_RA3_01_1233.d 2.9E6 4 4 177 181
R.ELAEEGYSGVEVR(+14.02).V Y 59.40 1450.6940 13 -4.0 726.3514 2 66.32 3 37326 AEV_3_3_RA3_01_1233.d 5.21E5 4 4 31 43 Methylation(KR)
R.YKLLN(+.98)GLAVR.R Y 56.79 1146.6760 10 3.9 383.2341 3 69.68 2 32636 AEV_1_3_RA2_01_1232.d 4.35E5 4 4 110 119 Deamidation (NQ)
R.DFIDSATR.H Y 56.75 923.4348 8 0.4 462.7249 2 57.75 3 30769 AEV_3_3_RA3_01_1233.d 6.6E5 3 3 169 176
R.ATHTQEVLGE(+14.02)QGR.R Y 56.68 1438.7164 13 3.3 480.5810 3 40.17 2 15546 AEV_1_3_RA2_01_1232.d 4.6E5 3 3 55 67 Methylation(others)
R.Q(-17.03)GVLGIKVK.I Y 56.43 923.5804 9 -1.8 462.7966 2 69.47 2 32449 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 182 190 Pyro-glu from Q
K.IMRGSDPEGK.S Y 56.38 1088.5284 10 11.1 545.2775 2 17.20 2 5243 AEV_1_3_RA2_01_1232.d 1.96E5 6 6 191 200
R.IR(+14.02)ELT(+79.96)SLIQKR.F Y 55.93 1449.7974 11 -24.6 363.4477 4 65.75 2 29773 AEV_1_3_RA2_01_1232.d 7E4 1 1 69 79 Methylation(KR); Sulfation
K.ALAAQQLAEQ(+.98)QR(+14.02).L Y 55.19 1340.7048 12 -2.1 671.3583 2 61.23 3 33366 AEV_3_3_RA3_01_1233.d 5.26E4 2 2 234 245 Deamidation (NQ); Methylation(KR)
R.ATHTQEVLGEQ(+.98)GRR.I Y 54.39 1581.7859 14 1.4 528.2700 3 27.48 3 11952 AEV_3_3_RA3_01_1233.d 7.16E5 4 4 55 68 Deamidation (NQ)
R.ELAE(+14.02)EGYSGVEVR.V Y 54.02 1450.6940 13 -0.3 726.3541 2 68.33 3 38917 AEV_3_3_RA3_01_1233.d 3.02E5 2 2 31 43 Methylation(others)
R.ELTSLIQKR.F Y 54.01 1086.6396 9 -6.4 544.3236 2 57.73 2 24488 AEV_1_3_RA2_01_1232.d 1.45E6 8 8 71 79
M.A(+42.01)AVQGVISKR.R Y 53.57 1069.6244 10 -0.6 535.8192 2 61.89 2 27134 AEV_1_3_RA2_01_1232.d 2.64E6 3 3 2 11 Acetylation (Protein N-term)
R.AC(+57.02)YGVLR(+14.02).F Y 52.33 851.4323 7 -0.4 426.7233 2 55.69 3 29343 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 121 127 Carbamidomethylation; Methylation(KR)
K.ALAAQQLAEQQRLAEQQEAEAAGQGVGPDGQVVEGQE(+14.02) Y 52.11 3816.8513 37 1.7 1273.2932 3 79.11 2 39852 AEV_1_3_RA2_01_1232.d 6.03E4 1 1 234 270 Methylation(others)
K.SLPDSVTIIDPKEEEPVLHPIS(+14.02)QDYGAK.A Y 51.73 3090.5759 28 -1.2 1031.1980 3 79.54 3 47712 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 206 233 Methylation(others)
R.LAEQQE(+14.02)AEAAGQGVGPDGQVVEGQE Y 51.62 2509.1567 25 0.6 837.3934 3 72.91 3 42512 AEV_3_3_RA3_01_1233.d 8.84E5 2 2 246 270 Methylation(others)
K.GC(+57.02)EVVVSGK(+14.02).L Y 50.95 947.4746 9 3.3 474.7461 2 35.55 3 16658 AEV_3_3_RA3_01_1233.d 1.92E5 2 2 136 144 Carbamidomethylation; Methylation(KR)
R.FIMESGAK.G Y 49.42 881.4316 8 4.7 441.7252 2 45.64 2 18253 AEV_1_3_RA2_01_1232.d 3.05E5 3 3 128 135
M.A(+42.01)AVQGVISK.R Y 49.30 913.5233 9 0.1 914.5306 1 67.00 2 30652 AEV_1_3_RA2_01_1232.d 1.69E6 5 5 2 10 Acetylation (Protein N-term)
R.GLS(-2.02)AVAQC(+57.02)ESLRYK.L Y 48.50 1578.7823 14 24.3 527.2808 3 62.37 3 34247 AEV_3_3_RA3_01_1233.d 0 1 1 98 111 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.LAEQQEAEAAGQ(+.98)GVGPDGQVVEGQE Y 47.44 2496.1252 25 2.4 833.0510 3 70.84 2 33479 AEV_1_3_RA2_01_1232.d 3.09E5 1 1 246 270 Deamidation (NQ)
K.ALAAQQLAEQ(+.98)Q(+.98)R.L Y 47.12 1327.6731 12 -27.4 664.8256 2 61.05 2 26565 AEV_1_3_RA2_01_1232.d 0 1 1 234 245 Deamidation (NQ)
K.ALAAQQ(+.98)LAEQQR.L Y 46.29 1326.6891 12 1.5 664.3528 2 60.07 2 25931 AEV_1_3_RA2_01_1232.d 4.99E4 1 1 234 245 Deamidation (NQ)
R.GLSAVAQ(+.98)C(+57.02)ESLR(+14.02).Y Y 46.06 1304.6394 12 11.4 653.3344 2 67.60 3 38334 AEV_3_3_RA3_01_1233.d 2.73E5 1 1 98 109 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
K.ALAAQQLAEQQ(+.98)R(+14.02).L Y 45.78 1340.7048 12 -4.3 671.3568 2 62.66 3 34475 AEV_3_3_RA3_01_1233.d 8.11E4 1 1 234 245 Deamidation (NQ); Methylation(KR)
R.ELTSLIQK.R Y 44.48 930.5386 8 -23.0 466.2659 2 62.49 3 34337 AEV_3_3_RA3_01_1233.d 2.4E5 3 3 71 78
K.ALAAQQLAEQQR(+14.02).L Y 44.18 1339.7208 12 2.5 447.5820 3 60.28 3 32616 AEV_3_3_RA3_01_1233.d 1.15E5 1 1 234 245 Methylation(KR)
R.IR(+14.02)ELTSLIQKR.F Y 44.12 1369.8405 11 8.6 343.4703 4 65.65 2 29698 AEV_1_3_RA2_01_1232.d 7.89E4 1 1 69 79 Methylation(KR)
R.QGVLGIK.V Y 42.98 713.4435 7 -87.9 357.6977 2 63.76 1 29363 AEV 2_3_RA2_01_1224.d 1.39E6 5 5 182 188
K.SLPDSVTIIDPKEEEPVLHPISQ(+.98)DYGAK.A Y 42.87 3077.5444 28 4.2 1026.8597 3 79.64 2 40275 AEV_1_3_RA2_01_1232.d 3.06E5 1 1 206 233 Deamidation (NQ)
K.ALAAQ(+.98)QLAEQ(+.98)QR.L Y 41.94 1327.6731 12 -7.8 664.8386 2 61.52 3 33652 AEV_3_3_RA3_01_1233.d 1.48E5 1 1 234 245 Deamidation (NQ)
K.GC(+57.02)EVVVSGKLR.A Y 41.89 1202.6442 11 2.1 401.8895 3 44.74 3 22388 AEV_3_3_RA3_01_1233.d 5.27E5 3 3 136 146 Carbamidomethylation
R.HVLLR(+14.02).Q N 41.67 650.4228 5 -18.3 326.2127 2 39.64 2 15297 AEV_1_3_RA2_01_1232.d 0 2 2 177 181 Methylation(KR)
R.ATHTQEVLGEQGRR(+14.02).I Y 41.59 1594.8175 14 -3.8 798.4130 2 30.23 3 13520 AEV_3_3_RA3_01_1233.d 6.34E4 3 3 55 68 Methylation(KR)
R.RAC(+57.02)YGVLR.F Y 41.42 993.5178 8 0.2 497.7663 2 34.54 3 16089 AEV_3_3_RA3_01_1233.d 6.48E5 5 5 120 127 Carbamidomethylation
K.LLNGLAVR.R Y 38.01 854.5338 8 -112.0 428.2263 2 73.74 1 36880 AEV 2_3_RA2_01_1224.d 1.68E5 4 4 112 119
K.E(+225.09)EEPVLHPISQDYGAK.A Y 37.63 2035.9673 16 29.5 510.0141 4 60.84 2 26422 AEV_1_3_RA2_01_1232.d 2.27E5 2 2 218 233 Iminobiotinylation
R.GSDPEGKSGPQK.S Y 35.94 1185.5625 12 17.1 396.2015 3 9.36 3 2293 AEV_3_3_RA3_01_1233.d 3.22E4 1 1 194 205
R.FIM(+15.99)ESGAK.G Y 35.33 897.4266 8 -42.4 449.7015 2 36.88 1 12646 AEV 2_3_RA2_01_1224.d 3.61E5 3 3 128 135 Oxidation (M)
K.SLPDS(+14.02)VTIIDPKEEEPVLHPISQDYGAK.A Y 35.22 3090.5759 28 1.2 1031.2004 3 80.01 2 40572 AEV_1_3_RA2_01_1232.d 1.36E5 1 1 206 233 Methylation(others)
K.SLPDSVTIIDPK(+14.96)EEEPVLHPISQDYGAK.A Y 35.19 3091.5237 28 29.9 1031.5460 3 80.87 3 48745 AEV_3_3_RA3_01_1233.d 6.92E4 1 1 206 233 Alpha-amino adipic acid
MAAVQGVISK.R Y 34.50 1002.5532 10 -4.9 335.1900 3 10.85 3 2921 AEV_3_3_RA3_01_1233.d 1.01E5 2 2 1 10
R.ELTSLIQ(+.98)KR.F Y 32.87 1087.6237 9 -106.2 363.5100 3 67.51 1 32034 AEV 2_3_RA2_01_1224.d 0 1 1 71 79 Deamidation (NQ)
R.GLSAVAQC(+57.02)ESLR(+28.03).Y Y 32.52 1317.6710 12 -4.7 659.8397 2 71.31 3 41252 AEV_3_3_RA3_01_1233.d 4.83E4 1 1 98 109 Carbamidomethylation; Dimethylation(KR)
K.ALAAQ(+.98)QLAEQ(+.98)Q(+.98)R.L Y 31.72 1328.6572 12 8.7 665.3417 2 60.27 3 32611 AEV_3_3_RA3_01_1233.d 1.05E4 1 1 234 245 Deamidation (NQ)
K.SLPDSVTIIDPK(+28.03)EEEPVLHPISQDYGAK.A Y 31.40 3104.5916 28 -0.8 777.1545 4 81.86 3 49488 AEV_3_3_RA3_01_1233.d 1.87E5 1 1 206 233 Dimethylation(KR)
K.LLNGLAVRR.A Y 30.23 1010.6349 9 1.8 337.8862 3 56.58 3 29949 AEV_3_3_RA3_01_1233.d 3.22E5 2 2 112 120
K.FPENSVSLYAAK.V Y 29.57 1324.6663 12 0.0 663.3404 2 69.33 2 32352 AEV_1_3_RA2_01_1232.d 1.99E5 2 2 82 93
R.FIM(-48.00)ESGAK.G Y 29.57 833.4283 8 1.9 417.7222 2 16.05 3 5697 AEV_3_3_RA3_01_1233.d 5.38E5 2 2 128 135 Dethiomethyl
R.FKFPENSVSLYAAK(+88.00)VQNR.G Y 29.55 2185.0989 18 4.2 547.2843 4 73.52 3 42994 AEV_3_3_RA3_01_1233.d 0 1 1 80 97 3-sulfanylpropanoyl
R.IRELTS(+86.00)LIQKR.F Y 28.64 1441.8252 11 -88.7 361.4316 4 75.16 1 38006 AEV 2_3_RA2_01_1224.d 1.12E5 1 1 69 79 Malonylation
R.ATHT(+42.01)QEVLGEQGR.R Y 28.39 1466.7113 13 4.1 489.9130 3 30.52 2 10941 AEV_1_3_RA2_01_1232.d 1.45E5 1 1 55 67 Acetylation (TSCYH)
K.SMKFTDGFMIHSGQPVRDFIDSATR.H Y 28.03 2842.3530 25 24.0 569.4915 5 81.20 2 41512 AEV_1_3_RA2_01_1232.d 0 1 1 152 176
R.YKLLN(+.98)GLAVRR.A Y 27.81 1302.7771 11 -6.6 326.6994 4 63.53 3 35160 AEV_3_3_RA3_01_1233.d 8.6E4 1 1 110 120 Deamidation (NQ)
R.Q(+.98)GVLGIK.V Y 26.11 714.4276 7 -8.8 358.2179 2 50.51 2 20701 AEV_1_3_RA2_01_1232.d 0 1 1 182 188 Deamidation (NQ)
K.SGPQK(+145.02)SLPDSVTIIDPK.E Y 25.96 1925.9768 17 29.4 643.0184 3 74.42 2 36188 AEV_1_3_RA2_01_1232.d 0 1 1 201 217 3-(carbamidomethylthio)propanoyl
R.IRE(+14.02)LTSLIQKR.F Y 25.31 1369.8405 11 -1.7 343.4668 4 63.77 3 35331 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 69 79 Methylation(others)
K.SLPDSVT(+13.03)IIDPKEEEPVLHPISQDYGAK.A Y 24.84 3089.5920 28 -47.6 1030.8223 3 79.82 3 47926 AEV_3_3_RA3_01_1233.d 2.25E4 1 1 206 233 Michael addition with methylamine
R.Q(-17.03)GVLGIK.V Y 23.67 696.4170 7 -15.9 697.4132 1 70.32 2 33102 AEV_1_3_RA2_01_1232.d 0 1 1 182 188 Pyro-glu from Q
K.S(-18.01)GPQ(+.98)K.S N 22.72 498.2438 5 -74.7 499.2139 1 50.50 1 20494 AEV 2_3_RA2_01_1224.d 7.5E4 1 1 201 205 Dehydration; Deamidation (NQ)
R.IR(+14.02)ELTSLIQK.R Y 22.72 1213.7394 10 -5.7 405.5848 3 68.28 3 38883 AEV_3_3_RA3_01_1233.d 4.58E4 1 1 69 78 Methylation(KR)
R.AC(+57.02)YGVLRFIMES(+126.10)GAKGC(+57.02)EVVVSGKLR.A Y 22.07 3011.5759 26 8.8 603.3278 5 44.62 3 22314 AEV_3_3_RA3_01_1233.d 0 1 1 121 146 Carbamidomethylation; Octanoyl
R.AT(+14.02)HTQEVLGEQGRR.I Y 21.89 1594.8175 14 -0.4 399.7115 4 30.74 2 11052 AEV_1_3_RA2_01_1232.d 2.61E5 1 1 55 68 Methylation(others)
R.LAEQQEAEAAGQGVGPDGQ(+15.00)VVEGQE Y 21.51 2510.1409 25 0.5 1256.0784 2 73.53 3 43005 AEV_3_3_RA3_01_1233.d 1.67E5 1 1 246 270 Deamidation followed by a methylation
R.ELTSLIQKR(+79.97)FK.F Y 20.30 1441.7694 11 -58.6 721.8497 2 89.67 1 49374 AEV 2_3_RA2_01_1224.d 2.7E5 1 1 71 81 Phosphorylation (HCDR)
R.GLS(+291.10)AVAQC(+57.02)ESLR.Y Y 20.27 1580.7352 12 -40.5 527.8977 3 71.32 1 34968 AEV 2_3_RA2_01_1224.d 1.78E5 1 1 98 109 N-acetyl neuraminic acid; Carbamidomethylation
R.V(+42.01)TPTVTDIIIR.A Y 20.00 1268.7340 11 -4.2 318.1895 4 43.79 3 21772 AEV_3_3_RA3_01_1233.d 0 1 1 44 54 Acetylation (N-term)
R.FKFPENSVSLYAAKVQNR.G Y 19.63 2097.1006 18 25.0 525.2955 4 73.67 2 35675 AEV_1_3_RA2_01_1232.d 0 1 1 80 97
R.GLS(-2.02)AVAQC(+57.02)ESLRYKLLNGLAVRR.A Y 19.34 2571.4067 23 -16.8 515.2800 5 76.55 3 45352 AEV_3_3_RA3_01_1233.d 0 1 1 98 120 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.LAEQQEAE(+28.03)AAGQGVGPDGQVVEGQE Y 18.54 2523.1724 25 2.0 842.0664 3 74.35 3 43623 AEV_3_3_RA3_01_1233.d 2.13E4 1 1 246 270 Ethylation
R.FKFP(+13.98)ENSVSLYAAK.V Y 18.48 1613.8088 14 -62.8 538.9098 3 82.87 1 44082 AEV 2_3_RA2_01_1224.d 1.94E5 1 1 80 93 Proline oxidation to pyroglutamic acid
R.ATHT(-2.02)QEVLGEQGR.R Y 18.43 1422.6852 13 8.0 475.2394 3 31.07 2 11207 AEV_1_3_RA2_01_1232.d 0 1 1 55 67 2-amino-3-oxo-butanoic_acid
K.FPENSVSLYAAK(+43.99).V Y 18.37 1368.6561 12 -4.4 343.1698 4 45.39 1 17498 AEV 2_3_RA2_01_1224.d 0 1 1 82 93 Carboxylation (DKW)
K.VKIMRGSDPEGKSGPQK.S Y 18.37 1812.9515 17 -6.4 454.2423 4 67.36 2 30903 AEV_1_3_RA2_01_1232.d 0 1 1 189 205
K.I(+43.01)MR(+14.02)GSDPEGK.S Y 18.19 1145.5499 10 -89.7 573.7308 2 25.21 1 6632 AEV 2_3_RA2_01_1224.d 4.45E4 1 1 191 200 Carbamylation; Methylation(KR)
R.ATHTQE(+6.01)VLGEQGR.R Y 18.17 1430.7090 13 -120.7 477.8527 3 46.31 1 18060 AEV 2_3_RA2_01_1224.d 4.66E4 1 1 55 67 Replacement of proton by lithium
R.ELTS(+79.97)LIQ(+.98)KRFK.F Y 17.93 1442.7534 11 10.6 722.3916 2 84.43 2 43978 AEV_1_3_RA2_01_1232.d 0 1 1 71 81 Phosphorylation (STY); Deamidation (NQ)
R.FK(+14.02)FPEN(+.98)SVSLYAAK.V Y 17.51 1614.8293 14 12.2 539.2903 3 77.97 2 38951 AEV_1_3_RA2_01_1232.d 2.55E5 1 1 80 93 Methylation(KR); Deamidation (NQ)
R.GLSAVAQC(+57.02)ESLR(+14.02)YK.L Y 17.33 1594.8137 14 -15.7 532.6035 3 66.86 3 37747 AEV_3_3_RA3_01_1233.d 0 1 1 98 111 Carbamidomethylation; Methylation(KR)
R.ELT(+79.97)SLIQK(+27.99).R Y 17.00 1038.4999 8 17.6 347.1800 3 40.32 2 15620 AEV_1_3_RA2_01_1232.d 0 1 1 71 78 Phosphorylation (STY); Formylation
K.FPENSVS(+79.97)LYAAK.V Y 16.93 1404.6326 12 -41.4 469.1987 3 85.09 1 45862 AEV 2_3_RA2_01_1224.d 3.81E4 1 1 82 93 Phosphorylation (STY)
R.FK(+14.02)FPENSVSLYAAK(+14.02).V Y 16.30 1627.8610 14 9.4 543.6327 3 77.67 2 38708 AEV_1_3_RA2_01_1232.d 6.22E4 1 1 80 93 Methylation(KR)
R.VTPTVTDIIIRATHTQEVLGEQGR.R Y 15.96 2633.4136 24 -35.1 659.3376 4 93.00 2 48586 AEV_1_3_RA2_01_1232.d 4.47E4 1 1 44 67
R.GSDPE(+21.98)GK(+14.02).S Y 15.53 724.3004 7 -33.4 725.2834 1 57.84 1 24984 AEV 2_3_RA2_01_1224.d 3.04E4 1 1 194 200 Sodium adduct; Methylation(KR)
K.IMR(+14.02)GSDPEGK(+14.02).S Y 15.46 1116.5597 10 -128.3 559.2155 2 31.46 1 9784 AEV 2_3_RA2_01_1224.d 0 1 1 191 200 Methylation(KR)
K.FTDGFMIHS(+79.97)GQ(+.98)PVR.D Y 15.43 1671.7117 14 52.3 418.9571 4 78.35 1 40530 AEV 2_3_RA2_01_1224.d 0 1 1 155 168 Phosphorylation (STY); Deamidation (NQ)
MAAVQGVISK(+31.99).R Y 15.36 1034.5430 10 -10.6 518.2733 2 40.13 3 19486 AEV_3_3_RA3_01_1233.d 9.83E4 1 1 1 10 Dihydroxy
R.GLSAVAQC(+57.02)E(+14.02)SLR.Y Y 15.27 1303.6554 12 -90.1 652.7762 2 74.81 1 37720 AEV 2_3_RA2_01_1224.d 3.9E5 1 1 98 109 Carbamidomethylation; Methylation(others)
R.R(+42.01)ACYGVLR.F Y 15.17 978.5069 8 -18.0 327.1704 3 19.21 3 7412 AEV_3_3_RA3_01_1233.d 0 1 1 120 127 Acetylation (N-term)
total 149 peptides
C1GBJ2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AGKDLISALVSGLLTIGSR.F Y 151.56 1870.0887 19 3.6 624.3724 3 95.93 2 49667 AEV_1_3_RA2_01_1232.d 9.24E5 6 6 462 480
R.ESGIHVPDTFEELPR.V Y 145.55 1724.8369 15 3.4 575.9549 3 76.51 2 37824 AEV_1_3_RA2_01_1232.d 1.41E6 8 8 327 341
M.PSAAPLSSTANGNLSANDNIR.R Y 135.92 2069.0137 21 4.7 690.6818 3 65.70 2 29761 AEV_1_3_RA2_01_1232.d 6.55E5 6 6 2 22
K.IGNTGGMMDNIVASK.L Y 132.56 1506.7170 15 2.5 754.3677 2 69.71 2 32658 AEV_1_3_RA2_01_1232.d 2.41E5 2 2 182 196
K.GITIIGPATVGGIKPGAFK.I Y 121.01 1796.0559 19 -9.7 599.6868 3 78.76 2 39567 AEV_1_3_RA2_01_1232.d 8.86E5 4 4 163 181
R.STPSVAGIIYTFGGQFVSK.M Y 116.74 1958.0149 19 2.3 653.6804 3 90.28 2 47359 AEV_1_3_RA2_01_1232.d 1.41E6 5 5 68 86
R.FGGALDGAAEEFTK.A Y 116.59 1411.6619 14 2.8 706.8402 2 75.55 2 37110 AEV_1_3_RA2_01_1232.d 7.01E5 6 6 481 494
K.EKGITIIGPATVGGIKPGAFK.I Y 109.55 2053.1934 21 -8.2 514.3014 4 75.71 2 37194 AEV_1_3_RA2_01_1232.d 4.52E5 5 5 161 181
K.IPIDYAWAQELGLIR.K Y 105.08 1756.9512 15 1.3 586.6584 3 90.32 2 47384 AEV_1_3_RA2_01_1232.d 2.56E5 5 5 367 381
M.PSAAPLSSTANGNLSANDNIRR.F Y 103.72 2225.1147 22 1.7 742.7134 3 61.38 2 26798 AEV_1_3_RA2_01_1232.d 5.75E5 3 3 2 23
K.LIAIIAEGVPERR.A Y 102.46 1435.8511 13 1.6 479.6251 3 72.05 2 34381 AEV_1_3_RA2_01_1232.d 6.47E5 4 4 139 151
K.AMSKHPDVDTVVNFASSR.S Y 97.74 1959.9473 18 -12.9 490.9878 4 68.14 2 31462 AEV_1_3_RA2_01_1232.d 2.74E5 3 3 105 122
K.HPDVDTVVNFASSR.S Y 91.25 1542.7427 14 14.1 772.3895 2 70.27 2 33110 AEV_1_3_RA2_01_1232.d 7.38E5 4 4 109 122
R.FSAPSRPLTPLEHTLFHDKTR.C Y 87.39 2449.2866 21 1.0 490.8651 5 70.06 3 40311 AEV_3_3_RA3_01_1233.d 4.35E5 2 2 24 44
K.LIAIIAEGVPER.R Y 86.38 1279.7499 12 -3.4 640.8801 2 77.06 3 45741 AEV_3_3_RA3_01_1233.d 3.51E5 3 3 139 150
R.AGKDLISALVSGLLTIGSR(+14.02).F Y 81.01 1884.1044 19 2.0 629.0433 3 96.60 3 57878 AEV_3_3_RA3_01_1233.d 6.32E4 1 1 462 480 Methylation(KR)
R.ESGIHVPDTFE(+14.02)ELPR.V Y 80.18 1738.8525 15 0.8 580.6252 3 78.26 2 39228 AEV_1_3_RA2_01_1232.d 2.86E5 2 2 327 341 Methylation(others)
R.AVQGMLDFDFIC(+57.02)KR.S Y 78.63 1698.8221 14 0.5 567.2816 3 80.97 2 41351 AEV_1_3_RA2_01_1232.d 5.53E5 5 5 54 67 Carbamidomethylation
M.PSAAPLSSTAN(+.98)GNLSANDNIR.R Y 78.51 2069.9978 21 1.3 691.0074 3 65.99 3 37053 AEV_3_3_RA3_01_1233.d 5.36E5 6 6 2 22 Deamidation (NQ)
M.PSAAPLSSTAN(+.98)GNLSANDNIRR.F Y 76.19 2226.0989 22 0.1 743.0403 3 61.51 3 33605 AEV_3_3_RA3_01_1233.d 1.26E6 8 8 2 23 Deamidation (NQ)
K.ILLLLGEVGGVEEYR.V Y 75.79 1658.9243 15 2.0 830.4711 2 86.31 2 45226 AEV_1_3_RA2_01_1232.d 4.95E2 1 1 258 272
K.MYWGTSETLLPVYQEVEK.A Y 75.10 2172.0449 18 -1.9 1087.0277 2 85.17 3 51811 AEV_3_3_RA3_01_1233.d 2.55E5 3 3 87 104
R.C(+57.02)FVYGMQPR.A Y 75.03 1156.5157 9 5.7 579.2684 2 65.56 2 29638 AEV_1_3_RA2_01_1232.d 3.56E4 3 3 45 53 Carbamidomethylation
R.FGGALDGAAEEFTKAFDR.G Y 72.65 1900.8955 18 -7.6 634.6343 3 83.40 3 50595 AEV_3_3_RA3_01_1233.d 3.1E4 1 1 481 498
R.ESGIH(+14.02)VPDTFEELPR.V Y 72.03 1738.8525 15 -1.1 580.6241 3 77.17 2 38336 AEV_1_3_RA2_01_1232.d 1.5E5 1 1 327 341 Methylation(others)
R.SVYSSTMELMQYPQIK.L Y 70.61 1903.9060 16 2.4 952.9626 2 82.32 2 42362 AEV_1_3_RA2_01_1232.d 5.79E4 1 1 123 138
K.SGGM(+15.99)SNELNNIISQNTDGVYEGVAIGGDRYPGTTFIDHLLR.Y Y 69.46 4396.1030 41 0.5 1100.0336 4 87.84 3 53499 AEV_3_3_RA3_01_1233.d 8.58E4 1 1 209 249 Oxidation (M)
K.IGNTGGM(+15.99)M(+15.99)DNIVASK.L Y 68.04 1538.7069 15 -0.7 770.3602 2 45.00 3 22560 AEV_3_3_RA3_01_1233.d 1.06E5 2 2 182 196 Oxidation (M)
R.STPSVAGIIYTFGGQ(+.98)FVSK.M Y 62.34 1958.9989 19 -1.0 980.5057 2 90.93 3 55241 AEV_3_3_RA3_01_1233.d 1.1E5 2 2 68 86 Deamidation (NQ)
R.ESGIHVPDTFEE(+14.02)LPR.V Y 61.96 1738.8525 15 4.6 580.6274 3 77.74 3 46332 AEV_3_3_RA3_01_1233.d 0 1 1 327 341 Methylation(others)
R.ESGIHVPDTFEELPR(+14.02).V Y 57.88 1738.8525 15 -1.4 580.6240 3 78.71 2 39530 AEV_1_3_RA2_01_1232.d 9.8E4 1 1 327 341 Methylation(KR)
R.SIGLIAHFLDQKR.L Y 56.24 1496.8463 13 2.9 375.2199 4 76.90 3 45650 AEV_3_3_RA3_01_1233.d 4.88E5 4 4 612 624
K.IGNTGGMMDNIVASKLYR.K Y 53.76 1938.9656 18 -0.6 647.3287 3 76.31 3 45191 AEV_3_3_RA3_01_1233.d 0 1 1 182 199
K.GIT(-2.02)IIGPATVGGIKPGAFK.I Y 53.37 1794.0403 19 -97.9 598.9622 3 78.40 3 46825 AEV_3_3_RA3_01_1233.d 2.17E4 1 1 163 181 2-amino-3-oxo-butanoic_acid
K.IGNTGGM(+15.99)MDNIVASK.L Y 52.36 1522.7119 15 1.1 762.3641 2 61.01 3 33194 AEV_3_3_RA3_01_1233.d 4.51E4 2 2 182 196 Oxidation (M)
R.FGGALDGAAEEFTK(+14.02).A Y 52.19 1425.6775 14 3.0 713.8481 2 78.37 2 39304 AEV_1_3_RA2_01_1232.d 6.11E4 1 1 481 494 Methylation(KR)
R.ESGIHVPDT(-2.02)FEELPR.V Y 51.80 1722.8213 15 19.9 575.2925 3 76.27 3 45121 AEV_3_3_RA3_01_1233.d 1.19E5 3 3 327 341 2-amino-3-oxo-butanoic_acid
R.S(+42.01)TPSVAGIIYTFGGQFVSK.M Y 50.61 2000.0254 19 18.1 667.6945 3 90.12 3 54784 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 68 86 Acetylation (N-term)
K.GAPGAEGRVEVSM(+15.99) Y 50.01 1274.5924 13 2.4 638.3050 2 40.84 3 19900 AEV_3_3_RA3_01_1233.d 7.41E4 1 1 647 659 Oxidation (M)
R.KPAAFISTISDDR.G Y 47.74 1419.7357 13 2.4 710.8768 2 63.25 3 34959 AEV_3_3_RA3_01_1233.d 3.06E5 3 3 382 394
R.VLADVYKK.L Y 47.46 934.5487 8 -5.0 468.2793 2 36.61 2 13824 AEV_1_3_RA2_01_1232.d 1.05E6 6 6 342 349
K.Q(-17.03)GTIKPEPEPVPPK.I Y 46.76 1498.8031 14 2.6 750.4108 2 61.46 2 26832 AEV_1_3_RA2_01_1232.d 1.02E5 3 3 353 366 Pyro-glu from Q
R.FSAPSRPLTPLEHTLFHDK.T Y 44.21 2192.1377 19 10.8 439.4395 5 74.54 2 36283 AEV_1_3_RA2_01_1232.d 7.86E4 1 1 24 42
K.HPDVDTVVN(+.98)FASSR.S Y 41.45 1543.7267 14 44.0 515.6055 3 70.37 2 33128 AEV_1_3_RA2_01_1232.d 0 1 1 109 122 Deamidation (NQ)
R.KGSVGYVSK.S Y 41.24 923.5076 9 2.8 462.7624 2 14.13 3 4648 AEV_3_3_RA3_01_1233.d 1.62E5 3 3 200 208
K.IGNTGGMM(+15.99)DNIVASK.L Y 40.99 1522.7119 15 1.7 762.3645 2 60.37 2 26120 AEV_1_3_RA2_01_1232.d 3.17E4 1 1 182 196 Oxidation (M)
K.RSTPSVAGIIYTFGGQFVSK.M Y 40.34 2114.1160 20 34.2 705.7367 3 85.96 2 44950 AEV_1_3_RA2_01_1232.d 0 1 1 67 86
M.PSAAPLSSTANGNLSANDNIR(+14.02)R.F Y 37.05 2239.1304 22 -0.6 747.3836 3 62.12 3 34062 AEV_3_3_RA3_01_1233.d 8.17E3 1 1 2 23 Methylation(KR)
K.IPIDYAWAQE(+14.02)LGLIR.K Y 36.04 1770.9668 15 3.6 591.3317 3 92.86 2 48526 AEV_1_3_RA2_01_1232.d 2.8E4 1 1 367 381 Methylation(others)
R.VLADVYK.K Y 36.03 806.4538 7 -90.0 404.1979 2 61.54 1 27639 AEV 2_3_RA2_01_1224.d 1.53E5 4 4 342 348
K.LIAIIAEGVPER(+14.02)R.A Y 34.42 1449.8667 13 -41.7 484.2760 3 74.88 2 36587 AEV_1_3_RA2_01_1232.d 1.01E5 2 2 139 151 Methylation(KR)
R.LPIYASK.F Y 32.57 790.4589 7 -91.8 396.2004 2 60.38 1 26763 AEV 2_3_RA2_01_1224.d 6.04E4 1 1 428 434
K.AFDRGLSPR.D Y 32.50 1017.5355 9 1.6 340.1863 3 38.25 3 18343 AEV_3_3_RA3_01_1233.d 2.72E5 1 1 495 503
K.TEVQFGHAGASANSELETAVMK.N Y 32.16 2276.0742 22 -92.1 759.6288 3 78.10 1 40335 AEV 2_3_RA2_01_1224.d 9.51E4 1 1 300 321
K.NFPSHK.L Y 28.85 728.3605 6 -86.8 365.1559 2 24.29 1 6242 AEV 2_3_RA2_01_1224.d 2E5 2 2 543 548
K.T(-2.02)EVQFGHAGASANSELETAVMK.N Y 28.44 2274.0586 22 -3.4 759.0242 3 71.31 3 41258 AEV_3_3_RA3_01_1233.d 7.94E3 1 1 300 321 2-amino-3-oxo-butanoic_acid
M(+15.99)PSAAPLSSTANGNLSANDNIR.R Y 26.24 2216.0491 22 -8.2 555.0150 4 26.52 2 9167 AEV_1_3_RA2_01_1232.d 3.62E5 2 2 1 22 Oxidation (M)
K.GAPGAEGR.V Y 24.58 713.3456 8 -105.5 714.2776 1 51.67 1 21151 AEV 2_3_RA2_01_1224.d 4.03E5 1 1 647 654
R.A(+42.01)REIMVAAK(+42.01).E Y 24.50 1071.5746 9 9.7 536.7997 2 84.05 2 43643 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 152 160 Acetylation (N-term); Acetylation (K)
K.L(+42.01)IAIIAEGVPER(+14.02)R.A Y 24.37 1491.8772 13 -44.0 498.2778 3 75.02 2 36633 AEV_1_3_RA2_01_1232.d 5E4 2 2 139 151 Acetylation (N-term); Methylation(KR)
K.TEVQFGHAGAS(-2.02)ANSELETAVMK.N Y 24.11 2274.0586 22 5.6 759.0311 3 71.86 2 34239 AEV_1_3_RA2_01_1232.d 1.98E4 1 1 300 321 2-amino-3-oxo-butanoic_acid
R.SIGLIAHFLDQK.R Y 23.73 1340.7452 12 -89.5 447.8824 3 89.58 1 49312 AEV 2_3_RA2_01_1224.d 1.59E5 2 2 612 623
K.LLDY(+79.97)AIAVETVTT(+79.97)SKK.D Y 23.42 1910.9043 16 -46.6 478.7111 4 79.60 1 41519 AEV 2_3_RA2_01_1224.d 4.34E5 1 1 549 564 Phosphorylation (STY)
R.C(+31.99)FVYGMQPR.A Y 23.17 1131.4841 9 -26.5 566.7344 2 45.55 1 17577 AEV 2_3_RA2_01_1224.d 0 1 1 45 53 Dihydroxy
K.RSTPSVAGIIYTFGGQFVSK(-.98).M Y 23.11 2113.1321 20 -24.3 705.3676 3 86.03 2 44998 AEV_1_3_RA2_01_1232.d 0 1 1 67 86 Amidation
K.GSVGYVS(+79.97)K.S Y 22.71 875.3790 8 -35.7 876.3550 1 84.70 1 45543 AEV 2_3_RA2_01_1224.d 7.38E4 1 1 201 208 Phosphorylation (STY)
R.GLSPR.D N 22.65 528.3020 5 -50.0 529.2828 1 52.11 1 21430 AEV 2_3_RA2_01_1224.d 0 1 1 499 503
M.PSAAPLSST(-18.01)AN(+.98)GNLSANDNIRR.F Y 22.37 2208.0884 22 2.0 737.0382 3 62.23 3 34144 AEV_3_3_RA3_01_1233.d 5.31E4 1 1 2 23 Dehydration; Deamidation (NQ)
R.VLADVY(+31.99)K.K Y 22.19 838.4436 7 2.5 839.4530 1 97.31 3 58113 AEV_3_3_RA3_01_1233.d 2.65E5 1 1 342 348 Dihydroxy
K.YMR(+28.03)ES(+79.97)GIHVPDTFEELPR.V Y 21.65 2283.0396 18 73.9 571.8093 4 76.64 2 37894 AEV_1_3_RA2_01_1232.d 0 1 1 324 341 Dimethylation(KR); Phosphorylation (STY)
R.A(+42.01)NPD(+21.98)LR.V Y 21.62 748.3480 6 26.6 375.1912 2 44.11 1 16746 AEV 2_3_RA2_01_1224.d 2.69E5 1 1 527 532 Acetylation (N-term); Sodium adduct
R.GQELLYAGM(+15.99)PISDVFR.E Y 21.59 1810.8923 16 19.2 453.7390 4 50.53 2 20715 AEV_1_3_RA2_01_1232.d 0 1 1 395 410 Oxidation (M)
R.VEVS(+13.03)M Y 21.16 576.2941 5 27.3 577.3171 1 63.76 2 28402 AEV_1_3_RA2_01_1232.d 0 1 1 655 659 Michael addition with methylamine
R.ESGIHVPD(+14.02)TFEELPR.V Y 21.14 1738.8525 15 -2.5 870.4313 2 78.01 3 46512 AEV_3_3_RA3_01_1233.d 6.95E4 1 1 327 341 Methylation(others)
R.FSAPSRPLT(+79.97)PLEHTLFHDK.T Y 20.87 2272.1040 19 -1.7 758.3740 3 87.08 2 45671 AEV_1_3_RA2_01_1232.d 0 1 1 24 42 Phosphorylation (STY)
K.DLISALVSGLLT(+79.97)IGS(+79.97)R.F Y 20.62 1773.8678 16 25.9 592.3118 3 75.13 3 44225 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 465 480 Phosphorylation (STY)
R.GLS(+79.97)PR.D N 20.55 608.2683 5 35.0 609.2969 1 58.13 3 31038 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 499 503 Phosphorylation (STY)
K.TRC(+57.02)FVYGM(+15.99)QPR.A Y 20.46 1429.6594 11 -57.6 715.7958 2 82.56 1 43834 AEV 2_3_RA2_01_1224.d 6.8E5 1 1 43 53 Carbamidomethylation; Oxidation (M)
R.ENKLIP(+31.99)GIGHK(+14.02).V Y 20.42 1250.6982 11 30.1 626.3752 2 80.47 3 48430 AEV_3_3_RA3_01_1233.d 0 1 1 512 522 Dihydroxy; Methylation(KR)
R.VEVSM Y 19.87 563.2625 5 15.3 564.2784 1 18.33 2 5710 AEV_1_3_RA2_01_1232.d 2.23E4 2 2 655 659
R.V(-15.01)EVSM Y 19.65 548.2516 5 20.8 549.2703 1 26.24 2 9050 AEV_1_3_RA2_01_1232.d 0 1 1 655 659 ISD (z+2)-series
R.VEVSM(+15.99) Y 19.57 579.2574 5 2.3 580.2660 1 88.48 1 48487 AEV 2_3_RA2_01_1224.d 0 1 1 655 659 Oxidation (M)
R.ENKLIP(+31.99)GIGHK.V Y 19.18 1236.6826 11 -2.0 413.2340 3 47.56 3 24175 AEV_3_3_RA3_01_1233.d 0 1 1 512 522 Dihydroxy
K.GSVGYVSK.S Y 18.97 795.4127 8 -67.9 398.6866 2 36.30 2 13678 AEV_1_3_RA2_01_1232.d 1.9E5 1 1 201 208
R.YPGTTFIDHLLRY(+79.97)Q(+.98)ADPK.C Y 18.84 2215.0349 18 -49.0 554.7389 4 80.91 1 42545 AEV 2_3_RA2_01_1224.d 0 1 1 238 255 Phosphorylation (STY); Deamidation (NQ)
K.QGTIKPEPEPVPPK.I Y 18.62 1515.8296 14 -28.7 506.2693 3 72.59 3 42261 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 353 366
R.VEVS(+14.02)M Y 18.42 577.2781 5 -68.7 578.2457 1 70.02 1 33976 AEV 2_3_RA2_01_1224.d 4.28E4 1 1 655 659 Methylation(others)
R.GLSPR(+31.99).D N 18.37 560.2918 5 -5.5 561.2960 1 70.79 3 40850 AEV_3_3_RA3_01_1233.d 0 1 1 499 503 Dihydroxy
R.VLADVYK(+27.99).K Y 18.34 834.4487 7 -30.0 835.4309 1 83.61 2 43332 AEV_1_3_RA2_01_1232.d 0 1 1 342 348 Formylation
K.MYWGTSETLLPVYQEVEK(+14.02).A Y 18.26 2186.0605 18 1.0 1094.0387 2 86.87 2 45536 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 87 104 Methylation(KR)
K.LIP(+31.99)GIGHK.V Y 17.80 865.5021 8 -10.5 866.5004 1 70.29 3 40457 AEV_3_3_RA3_01_1233.d 6.93E4 1 1 515 522 Dihydroxy
R.YQADPKC(+57.02)K.I Y 17.52 1008.4698 8 -19.9 505.2322 2 11.07 2 2871 AEV_1_3_RA2_01_1232.d 0 1 1 250 257 Carbamidomethylation
K.LLDYAIAVETVTTS(+162.05)K.K Y 17.46 1784.9294 15 -12.9 595.9761 3 78.49 2 39359 AEV_1_3_RA2_01_1232.d 0 1 1 549 563 Hexose (NSY)
K.LLDYAIAVETVTTSK.K Y 17.43 1622.8767 15 -98.6 812.3657 2 86.37 1 46854 AEV 2_3_RA2_01_1224.d 3.83E4 1 1 549 563
R.YQADPK.C Y 17.25 720.3442 6 41.0 721.3810 1 80.54 2 40989 AEV_1_3_RA2_01_1232.d 2.32E5 3 3 250 255
R.A(+42.01)REIMVAAK(+226.08).E Y 17.05 1255.6416 9 -1.2 419.5540 3 26.93 3 11659 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 152 160 Acetylation (N-term); Biotinylation
R.G(+42.01)LSPR(+21.98).D N 17.04 592.2945 5 -5.5 593.2985 1 73.28 2 35328 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 499 503 Acetylation (N-term); Sodium adduct
R.NC(+57.02)GAFSPEEAEDYLSM(+15.99)GVLNGLFVLGR.S Y 17.02 2960.3684 27 4.0 987.8007 3 96.41 3 57812 AEV_3_3_RA3_01_1233.d 3.1E4 1 1 585 611 Carbamidomethylation; Oxidation (M)
R.ANPDLR.V Y 17.00 684.3555 6 -84.6 343.1561 2 25.14 1 6603 AEV 2_3_RA2_01_1224.d 3.24E4 1 1 527 532
R.ESGIHVPDTFEELP(+13.98)R.V Y 16.89 1738.8162 15 -67.8 580.5734 3 83.16 1 44362 AEV 2_3_RA2_01_1224.d 2.21E5 1 1 327 341 Proline oxidation to pyroglutamic acid
R.EIMVAAK(+43.99).E Y 16.85 804.4052 7 -6.9 805.4069 1 111.94 3 62512 AEV_3_3_RA3_01_1233.d 2.19E4 1 1 154 160 Carboxylation (DKW)
K.DLIS(+79.97)ALVSGLLTIGSR.F Y 16.82 1693.9015 16 26.2 339.7964 5 29.43 2 10467 AEV_1_3_RA2_01_1232.d 9.84E4 1 1 465 480 Phosphorylation (STY)
K.L(+42.01)IPGIGHK(+28.03).V Y 16.81 903.5541 8 15.7 302.1967 3 20.67 2 6689 AEV_1_3_RA2_01_1232.d 0 1 1 515 522 Acetylation (N-term); Dimethylation(KR)
K.TRCFVY(+79.97)GMQPR.A Y 16.71 1436.6094 11 57.9 360.1804 4 73.96 1 37055 AEV 2_3_RA2_01_1224.d 0 1 1 43 53 Phosphorylation (STY)
R.T(+42.01)GLYR.H Y 15.89 650.3387 5 9.7 326.1798 2 14.45 2 4132 AEV_1_3_RA2_01_1232.d 0 1 1 627 631 Acetylation (N-term)
K.GSVGYVSK(+21.98).S Y 15.88 817.3946 8 16.9 818.4156 1 83.15 3 50421 AEV_3_3_RA3_01_1233.d 5E4 1 1 201 208 Sodium adduct
R.TGLYRHPWDDITYLLPTLQK.G Y 15.77 2429.2742 20 -29.0 608.3082 4 109.96 3 61967 AEV_3_3_RA3_01_1233.d 0 1 1 627 646
R.EDIGIGGVM(+15.99)SLLWFRR.R Y 15.41 1863.9666 16 10.0 622.3357 3 84.95 3 51660 AEV_3_3_RA3_01_1233.d 0 1 1 411 426 Oxidation (M)
R.EIM(+15.99)VAAK(+21.98).E Y 15.37 798.3922 7 2.3 799.4012 1 87.70 2 46027 AEV_1_3_RA2_01_1232.d 0 1 1 154 160 Oxidation (M); Sodium adduct
R.RFSAPS(+162.05)RPLTPLEHTLFHDK(+42.01).T Y 15.37 2552.3022 20 -17.8 639.0715 4 91.07 3 55288 AEV_3_3_RA3_01_1233.d 4.83E4 1 1 23 42 Hexose (NSY); Acetylation (K)
K.G(+42.01)APGAEGR(+14.02)VEVSM Y 15.34 1314.6238 13 10.8 658.3262 2 54.50 3 28676 AEV_3_3_RA3_01_1233.d 1.63E5 1 1 647 659 Acetylation (N-term); Methylation(KR)
R.E(+42.01)IMVAAK.E Y 15.01 802.4258 7 -12.0 402.2154 2 35.76 2 13430 AEV_1_3_RA2_01_1232.d 0 1 1 154 160 Acetylation (N-term)
total 112 peptides
C1G0E5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.VERPATENISLGPLAGDGKLVFGVAR.I Y 156.93 2665.4551 26 2.2 667.3725 4 80.55 2 40995 AEV_1_3_RA2_01_1232.d 7.94E5 5 5 7 32
K.ADRDESSPYAAMLAAQDVAAR.C Y 154.93 2207.0276 21 1.5 736.6843 3 76.26 2 37593 AEV_1_3_RA2_01_1232.d 1.78E6 8 8 64 84
K.KVERPATENISLGPLAGDGKLVFGVAR.I Y 150.49 2793.5500 27 -0.7 559.7169 5 78.41 2 39295 AEV_1_3_RA2_01_1232.d 9.51E5 5 5 6 32
K.VKADRDESSPYAAMLAAQDVAAR.C Y 144.51 2434.1909 23 15.7 609.5646 4 72.44 2 34715 AEV_1_3_RA2_01_1232.d 1.18E6 4 4 62 84
R.ATGGNGTKTPGPGAQSALR.A Y 124.05 1739.8914 19 2.2 580.9724 3 34.10 3 15816 AEV_3_3_RA3_01_1233.d 2.44E6 13 13 99 117
K.VKADRDESSPYAAM(+15.99)LAAQDVAAR.C Y 122.64 2450.1858 23 3.2 613.5557 4 64.41 2 28837 AEV_1_3_RA2_01_1232.d 3.16E5 3 3 62 84 Oxidation (M)
K.ADRDESSPYAAM(+15.99)LAAQDVAAR.C Y 120.92 2223.0225 21 9.2 742.0216 3 67.34 2 30890 AEV_1_3_RA2_01_1232.d 4.76E5 4 4 64 84 Oxidation (M)
R.ATGGN(+.98)GTKTPGPGAQSALR.A Y 117.68 1740.8755 19 2.8 581.3007 3 42.43 2 16674 AEV_1_3_RA2_01_1232.d 6.42E6 29 29 99 117 Deamidation (NQ)
R.IFASFNDTFVHVTDLSGRETIC(+57.02)R.V Y 116.39 2684.3018 23 -3.4 672.0804 4 81.27 2 41561 AEV_1_3_RA2_01_1232.d 6.77E5 3 3 33 55 Carbamidomethylation
K.TPGPGAQSALR.A Y 108.69 1053.5566 11 5.7 527.7886 2 38.57 2 14786 AEV_1_3_RA2_01_1232.d 8.8E6 10 10 107 117
R.IGRIEDVTPTPSDSTRR.K Y 106.54 1898.9810 17 4.4 475.7546 4 57.42 2 24321 AEV_1_3_RA2_01_1232.d 6.68E6 10 10 126 142
R.IGRIEDVTPTPSDSTR.R Y 106.29 1742.8799 16 -2.2 872.4453 2 59.81 3 32302 AEV_3_3_RA3_01_1233.d 7.12E6 10 10 126 141
R.IFASFNDTFVHVTDLSGR.E Y 105.47 2024.9956 18 -0.6 1013.5045 2 82.44 3 49908 AEV_3_3_RA3_01_1233.d 5.11E5 4 4 33 50
K.KKVERPATENISLGPLAGDGKLVFGVAR.I Y 103.61 2921.6450 28 1.1 585.3369 5 75.69 3 44671 AEV_3_3_RA3_01_1233.d 1.82E5 1 1 5 32
R.IEDVTPTPSDSTR.R Y 102.98 1416.6732 13 3.1 709.3461 2 49.17 2 20057 AEV_1_3_RA2_01_1232.d 1.93E6 9 9 129 141
R.IEDVTPTPSDSTRR.K Y 102.18 1572.7743 14 2.3 525.2666 3 43.69 2 17327 AEV_1_3_RA2_01_1232.d 1.12E6 7 7 129 142
K.VERPATENISLGPLAGDGK.L Y 101.23 1923.0061 19 -1.9 642.0081 3 69.47 3 39821 AEV_3_3_RA3_01_1233.d 6.51E5 4 4 7 25
K.KVERPATENISLGPLAGDGK.L Y 100.16 2051.1011 20 5.9 513.7856 4 66.15 2 30056 AEV_1_3_RA2_01_1232.d 5.93E5 3 3 6 25
K.IRATGGNGTKTPGPGAQSALR.A Y 99.30 2009.0765 21 5.1 503.2790 4 42.95 2 16933 AEV_1_3_RA2_01_1232.d 4.91E5 5 5 97 117
R.ATGGN(+.98)GTKTPGPGAQ(+.98)SALR.A Y 94.46 1741.8595 19 -0.1 581.6271 3 45.35 3 22808 AEV_3_3_RA3_01_1233.d 2.16E6 6 6 99 117 Deamidation (NQ)
K.IRATGGN(+.98)GTKTPGPGAQSALR.A Y 90.90 2010.0605 21 4.3 503.5246 4 46.01 3 23189 AEV_3_3_RA3_01_1233.d 5.66E5 5 5 97 117 Deamidation (NQ)
R.ATGGN(+.98)GTKTPGPGAQSALR(+14.02).A Y 87.39 1754.8911 19 3.2 585.9728 3 49.31 3 25288 AEV_3_3_RA3_01_1233.d 6.33E5 4 4 99 117 Deamidation (NQ); Methylation(KR)
R.DESSPYAAMLAAQDVAAR.C Y 86.09 1864.8624 18 3.7 933.4420 2 80.54 3 48484 AEV_3_3_RA3_01_1233.d 2.18E5 3 3 67 84
K.KKVERPATENISLGPLAGDGK.L Y 85.88 2179.1960 21 5.6 436.8489 5 61.13 3 33290 AEV_3_3_RA3_01_1233.d 5.36E5 2 2 5 25
R.ATGGNGTKTPGPGAQ(+.98)SALR.A Y 82.08 1740.8755 19 1.7 581.3001 3 38.19 3 18316 AEV_3_3_RA3_01_1233.d 1.48E6 3 3 99 117 Deamidation (NQ)
K.TPGPGAQSALR(+14.02).A Y 77.66 1067.5723 11 5.5 534.7963 2 49.49 2 20184 AEV_1_3_RA2_01_1232.d 1.04E6 8 8 107 117 Methylation(KR)
K.ELGINALHIK.I Y 76.88 1106.6448 10 -3.1 554.3279 2 68.52 3 39065 AEV_3_3_RA3_01_1233.d 3.21E5 2 2 87 96
R.IGR(+14.02)IEDVTPTPSDSTR.R Y 74.88 1756.8955 16 -2.5 586.6376 3 61.47 3 33561 AEV_3_3_RA3_01_1233.d 1.39E6 4 4 126 141 Methylation(KR)
R.IGRIEDVTPTPSDSTR(+14.02)R.K Y 73.94 1912.9966 17 0.7 479.2567 4 56.00 3 29530 AEV_3_3_RA3_01_1233.d 2.81E5 2 2 126 142 Methylation(KR)
K.VK(+14.02)ADRDESSPYAAMLAAQDVAAR.C Y 73.85 2448.2065 23 -3.8 613.0566 4 73.70 3 43117 AEV_3_3_RA3_01_1233.d 2.23E5 1 1 62 84 Methylation(KR)
R.IGRIEDVTPTPSDSTRR(+14.02).K Y 73.59 1912.9966 17 5.5 479.2590 4 60.18 2 26001 AEV_1_3_RA2_01_1232.d 4.41E5 1 1 126 142 Methylation(KR)
K.KVERPATENIS(-2.02)LGPLAGDGKLVFGVAR.I Y 71.40 2791.5344 27 -13.0 559.3069 5 77.90 3 46424 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 6 32 2-amino-3-oxo-butanoic_acid
R.ATGGN(+.98)GT(-18.01)KTPGPGAQSALR.A Y 70.72 1722.8649 19 -1.5 575.2947 3 36.96 3 17563 AEV_3_3_RA3_01_1233.d 2.69E5 2 2 99 117 Deamidation (NQ); Dehydration
R.ATGGN(+.98)GTK(+14.02)TPGPGAQSALR.A Y 70.57 1754.8911 19 3.7 585.9731 3 38.78 3 18685 AEV_3_3_RA3_01_1233.d 3.72E5 3 3 99 117 Deamidation (NQ); Methylation(KR)
K.VKADR(+14.02)DESSPYAAMLAAQDVAAR.C Y 69.86 2448.2065 23 0.7 817.0767 3 73.75 3 43160 AEV_3_3_RA3_01_1233.d 8.6E4 1 1 62 84 Methylation(KR)
R.IGRIEDVTPTPSDSTR(+14.02).R Y 68.30 1756.8955 16 -0.2 586.6390 3 60.84 3 33062 AEV_3_3_RA3_01_1233.d 1.44E6 4 4 126 141 Methylation(KR)
R.ATGGN(-17.03)GTKTPGPGAQSALR.A Y 67.85 1722.8649 19 1.5 575.2964 3 38.71 2 14852 AEV_1_3_RA2_01_1232.d 9.47E4 1 1 99 117 Ammonia-loss (N)
K.VKADRDESSPYAAM(-4.99)LAAQDVAAR.C Y 66.48 2429.2046 23 17.8 608.3192 4 71.76 3 41614 AEV_3_3_RA3_01_1233.d 0 1 1 62 84 Methionine replacement by azido homoalanine
K.ADRDESSPYAAM(-4.99)LAAQDVAAR.C Y 66.26 2202.0413 21 33.4 735.0455 3 75.96 3 44890 AEV_3_3_RA3_01_1233.d 1.05E5 1 1 64 84 Methionine replacement by azido homoalanine
K.VKADRDESSPYAAMLAAQ(+.98)DVAAR.C Y 65.38 2435.1750 23 8.4 609.8062 4 72.42 2 34671 AEV_1_3_RA2_01_1232.d 4.45E5 2 2 62 84 Deamidation (NQ)
R.IGR(+14.02)IEDVTPTPSDSTRR.K Y 62.42 1912.9966 17 -4.9 479.2541 4 59.40 3 32057 AEV_3_3_RA3_01_1233.d 1.3E6 4 4 126 142 Methylation(KR)
K.IR(+.98)ATGGNGTKTPGPGAQSALR.A Y 62.03 2010.0605 21 19.0 503.5320 4 42.87 3 21198 AEV_3_3_RA3_01_1233.d 0 1 1 97 117 Deamidation (R)
K.KVERPATENIS(+13.03)LGPLAGDGKLVFGVAR.I Y 61.65 2806.5815 27 -11.3 562.3173 5 79.05 3 47326 AEV_3_3_RA3_01_1233.d 1.12E5 2 2 6 32 Michael addition with methylamine
R.AT(-2.02)GGNGTKTPGPGAQSALR.A Y 59.11 1737.8757 19 -2.3 580.2979 3 37.65 3 17982 AEV_3_3_RA3_01_1233.d 8.59E4 2 2 99 117 2-amino-3-oxo-butanoic_acid
K.VK(+14.02)ADRDESSPYAAMLAAQ(+.98)DVAAR.C Y 57.69 2449.1907 23 8.9 613.3104 4 73.75 3 43158 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 62 84 Methylation(KR); Deamidation (NQ)
R.IGRIE(+14.02)DVTPTPSDSTR.R Y 56.37 1756.8955 16 -2.4 879.4529 2 62.50 3 34347 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 126 141 Methylation(others)
R.C(+58.01)KELGINALHIK.I Y 55.58 1395.7544 12 4.3 466.2607 3 66.72 2 30454 AEV_1_3_RA2_01_1232.d 1.07E6 7 7 85 96 Carboxymethyl
R.I(+27.99)GRIEDVTPTPSDSTR.R Y 51.21 1770.8748 16 12.6 591.3063 3 63.74 3 35308 AEV_3_3_RA3_01_1233.d 4.83E4 1 1 126 141 Formylation
K.VER(+14.02)PATENISLGPLAGDGK.L Y 50.54 1937.0217 19 -2.4 646.6796 3 71.50 2 33967 AEV_1_3_RA2_01_1232.d 1.82E5 2 2 7 25 Methylation(KR)
K.ADRDESSPYAAMLAAQDVAAR(+14.02).C Y 50.03 2221.0432 21 5.7 741.3593 3 77.84 2 38837 AEV_1_3_RA2_01_1232.d 2.31E5 2 2 64 84 Methylation(KR)
R.IE(+14.02)DVTPTPSDSTR.R Y 48.81 1430.6888 13 -0.6 716.3513 2 57.00 3 30223 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 129 141 Methylation(others)
K.TPGPGAQ(+.98)SALR.A Y 47.44 1054.5406 11 -18.1 528.2681 2 42.96 2 16973 AEV_1_3_RA2_01_1232.d 8.6E5 5 5 107 117 Deamidation (NQ)
K.LVFGVAR.I Y 47.25 760.4595 7 -5.1 381.2351 2 63.01 3 34778 AEV_3_3_RA3_01_1233.d 1.25E6 3 3 26 32
K.ADRDESSPYAAMLAAQD(-18.01)VAAR(+14.02).C Y 47.16 2203.0327 21 30.4 735.3738 3 76.35 2 37669 AEV_1_3_RA2_01_1232.d 3.77E4 1 1 64 84 Dehydration; Methylation(KR)
R.I(+43.01)GR(+14.02)IEDVTPTPSDSTR.R Y 46.99 1799.9014 16 0.3 600.9745 3 60.63 3 32890 AEV_3_3_RA3_01_1233.d 2.26E5 1 1 126 141 Carbamylation; Methylation(KR)
K.KVERPATE(+14.02)NISLGPLAGDGK.L Y 45.71 2065.1167 20 -6.5 517.2831 4 68.33 3 38919 AEV_3_3_RA3_01_1233.d 1.52E5 1 1 6 25 Methylation(others)
K.KVERPATENIS(-2.02)LGPLAGDGK.L Y 43.88 2049.0854 20 -32.9 513.2618 4 66.24 2 30126 AEV_1_3_RA2_01_1232.d 2.07E5 1 1 6 25 2-amino-3-oxo-butanoic_acid
K.VKADRDES(+14.02)SPYAAMLAAQDVAAR.C Y 42.44 2448.2065 23 -7.7 613.0542 4 72.28 3 42008 AEV_3_3_RA3_01_1233.d 0 1 1 62 84 Methylation(others)
R.ATGGNGTK(+58.01)TPGPGAQSALR.A Y 39.80 1797.8969 19 8.8 600.3115 3 40.90 3 19943 AEV_3_3_RA3_01_1233.d 1.68E5 2 2 99 117 Carboxymethyl (KW, X@N-term)
R.IED(+14.02)VTPTPSDSTR.R Y 37.70 1430.6888 13 4.0 716.3546 2 57.85 2 24554 AEV_1_3_RA2_01_1232.d 8.44E4 1 1 129 141 Methylation(others)
K.VER(+14.02)PAT(-18.01)ENISLGPLAGDGK.L Y 36.02 1919.0112 19 -22.8 640.6631 3 70.15 2 32962 AEV_1_3_RA2_01_1232.d 8.53E4 1 1 7 25 Methylation(KR); Dehydration
R.AT(+79.97)GGNGT(+79.97)K.T Y 35.99 864.2780 8 -39.2 865.2513 1 112.82 1 59577 AEV 2_3_RA2_01_1224.d 2.21E4 1 1 99 106 Phosphorylation (STY)
K.A(+43.01)DR(+14.02)DESSPYAAMLAAQDVAAR.C Y 35.99 2264.0491 21 1.7 567.0205 4 60.61 2 26280 AEV_1_3_RA2_01_1232.d 1.88E5 1 1 64 84 Carbamylation; Methylation(KR)
K.TPGPGAQ(+.98)SALR(+14.02).A Y 35.91 1068.5564 11 15.2 535.2936 2 47.45 3 24107 AEV_3_3_RA3_01_1233.d 1.77E5 2 2 107 117 Deamidation (NQ); Methylation(KR)
R.IGR(+14.02)IEDVTPTPSDSTR(+14.02).R Y 35.17 1770.9111 16 1.1 591.3116 3 65.72 2 29752 AEV_1_3_RA2_01_1232.d 2.79E4 1 1 126 141 Methylation(KR)
R.I(+43.01)GR(+14.02)IEDVTPTPSDSTRR.K Y 34.48 1956.0024 17 6.1 490.0109 4 58.13 2 24719 AEV_1_3_RA2_01_1232.d 5.38E4 1 1 126 142 Carbamylation; Methylation(KR)
K.VKADRDESSPYAAM(+15.99)LAAQDVAAR(+14.02).C Y 33.58 2464.2017 23 -2.3 617.0563 4 65.98 3 37050 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 62 84 Oxidation (M); Methylation(KR)
K.VKADRDESSPYAAMLAAQDVAAR(-.98).C Y 33.13 2433.2070 23 -4.3 609.3064 4 75.50 2 36992 AEV_1_3_RA2_01_1232.d 0 1 1 62 84 Amidation
K.VKADRDESSPYAAMLAAQ(+.98)DVAAR(+14.02).C Y 32.67 2449.1907 23 13.7 613.3134 4 74.64 2 36347 AEV_1_3_RA2_01_1232.d 8.64E4 1 1 62 84 Deamidation (NQ); Methylation(KR)
K.ADRDESS(+238.23)PYAAMLAAQDVAAR.C Y 31.76 2445.2573 21 1.3 612.3224 4 72.56 2 34854 AEV_1_3_RA2_01_1232.d 0 2 2 64 84 Palmitoylation
R.ATGGN(+15.00)GTKTPGPGAQSALR.A Y 31.36 1754.8911 19 2.0 878.4546 2 38.90 3 18750 AEV_3_3_RA3_01_1233.d 2.57E4 1 1 99 117 Deamidation followed by a methylation
R.C(+57.02)KELGIN(-17.03)ALHIK.I Y 31.15 1377.7438 12 1.4 460.2559 3 72.70 2 34946 AEV_1_3_RA2_01_1232.d 1.27E6 3 3 85 96 Carbamidomethylation; Ammonia-loss (N)
R.VTGGMK.V Y 30.97 591.3051 6 -37.7 592.2900 1 68.18 1 32569 AEV 2_3_RA2_01_1224.d 0 1 1 56 61
R.C(+57.02)KE(+21.98)LGINALHIK.I Y 28.81 1416.7523 12 20.4 473.2677 3 72.83 2 34993 AEV_1_3_RA2_01_1232.d 1.24E5 1 1 85 96 Carbamidomethylation; Sodium adduct
K.E(+14.02)LGINALHIK.I Y 28.81 1120.6604 10 -0.7 374.5605 3 70.17 3 40356 AEV_3_3_RA3_01_1233.d 6.86E4 1 1 87 96 Methylation(others)
K.ADR(+14.02)DESSPYAAMLAAQDVAAR.C Y 28.14 2221.0432 21 2.2 741.3566 3 77.42 2 38504 AEV_1_3_RA2_01_1232.d 2.31E5 2 2 64 84 Methylation(KR)
R.IGRIEDVT(+79.96)PT(+79.97)PSDSTR.R Y 27.70 1902.8030 16 99.3 476.7553 4 56.01 3 29536 AEV_3_3_RA3_01_1233.d 9.43E4 1 1 126 141 Sulfation; Phosphorylation (STY)
R.ATGGNGT(-2.02)KTPGPGAQSALR.A Y 27.24 1737.8757 19 0.9 580.2997 3 36.59 2 13815 AEV_1_3_RA2_01_1232.d 2.7E5 1 1 99 117 2-amino-3-oxo-butanoic_acid
K.VK(+43.01)ADR(+14.02)DESSPYAAMLAAQDVAAR.C Y 26.60 2491.2124 23 5.1 623.8135 4 57.24 3 30393 AEV_3_3_RA3_01_1233.d 0 1 1 62 84 Carbamylation; Methylation(KR)
R.IGRIED(+6.01)VTPTPSDSTRR.K Y 26.10 1904.9891 17 -7.1 477.2512 4 56.42 3 29807 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 126 142 Replacement of proton by lithium
R.IEDVTP(+13.98)TPSDSTR.R Y 25.69 1430.6525 13 -61.3 716.2897 2 62.28 1 28253 AEV 2_3_RA2_01_1224.d 1.93E5 1 1 129 141 Proline oxidation to pyroglutamic acid
K.TPGPGAQSALRALAR.S Y 25.21 1464.8160 15 9.8 489.2841 3 64.64 3 35989 AEV_3_3_RA3_01_1233.d 0 1 1 107 121
K.TPGP(+31.99)GAQSALR.A Y 25.14 1085.5465 11 -9.9 362.8525 3 17.42 3 6434 AEV_3_3_RA3_01_1233.d 0 1 1 107 117 Dihydroxy
R.IEDVTPTPSDSTR(+14.02).R Y 25.05 1430.6888 13 -1.4 716.3507 2 52.18 3 27171 AEV_3_3_RA3_01_1233.d 7.7E4 1 1 129 141 Methylation(KR)
R.C(+57.02)KELGINALHIKIR.A Y 24.20 1663.9556 14 -2.8 333.7975 5 66.39 3 37380 AEV_3_3_RA3_01_1233.d 3.83E4 1 1 85 98 Carbamidomethylation
R.IGRIEDVTPT(-2.02)PSDSTR.R Y 23.15 1740.8643 16 -0.3 581.2952 3 61.17 2 26644 AEV_1_3_RA2_01_1232.d 2.97E5 1 1 126 141 2-amino-3-oxo-butanoic_acid
R.I(+164.06)GRIEDVTPTPSDSTR.R Y 23.09 1906.9401 16 8.8 636.6595 3 58.18 2 24749 AEV_1_3_RA2_01_1232.d 7.05E4 1 1 126 141 O-Diisopropylphosphorylation
K.K(+14.02)VERPATENISLGPLAGDGK(+28.03).L Y 22.74 2093.1479 20 -4.2 698.7203 3 76.93 3 45641 AEV_3_3_RA3_01_1233.d 7.97E4 1 1 6 25 Methylation(KR); Dimethylation(KR)
K.IRATGGNGT(+79.97)K(+42.01).T Y 22.55 1095.5073 10 94.0 366.2107 3 54.24 1 22704 AEV 2_3_RA2_01_1224.d 0 1 1 97 106 Phosphorylation (STY); Acetylation (K)
K.LVFGVAR(+14.02).I Y 22.33 774.4752 7 -21.1 388.2367 2 67.50 2 31011 AEV_1_3_RA2_01_1232.d 0 1 1 26 32 Methylation(KR)
R.IED(+14.02)VTPTPSDSTRR.K Y 21.93 1586.7900 14 -4.6 794.3987 2 50.00 3 25741 AEV_3_3_RA3_01_1233.d 5.77E4 1 1 129 142 Methylation(others)
R.VTGGMKVK.A Y 21.80 818.4684 8 -22.3 410.2323 2 13.83 3 4488 AEV_3_3_RA3_01_1233.d 9.08E3 1 1 56 63
R.A(+42.01)TGGNGTK(+226.08)TPGPGAQSALR.A Y 21.72 2007.9796 19 19.2 670.3467 3 45.61 3 22941 AEV_3_3_RA3_01_1233.d 0 1 1 99 117 Acetylation (N-term); Biotinylation
R.VTGGM(+15.99)K.V Y 21.22 607.2999 6 -12.4 608.2997 1 56.17 3 29646 AEV_3_3_RA3_01_1233.d 3.59E4 2 2 56 61 Oxidation (M)
K.KKVERPATENISLGPLAGDGK(+162.08).L Y 21.18 2341.2769 21 -7.0 586.3224 4 75.65 3 44637 AEV_3_3_RA3_01_1233.d 1.6E5 1 1 5 25 O-Pinacolylmethylphosphonylation
K.VK(+42.01)ADR(+14.02)DESSPYAAMLAAQ(+.98)DVAAR.C Y 20.69 2491.2012 23 -79.7 499.2078 5 67.34 1 31906 AEV 2_3_RA2_01_1224.d 0 1 1 62 84 Acetylation (K); Methylation(KR); Deamidation (NQ)
R.A(+42.01)TGGNGTK(+43.99).T Y 20.62 790.3457 8 -27.4 791.3313 1 92.78 1 51613 AEV 2_3_RA2_01_1224.d 0 1 1 99 106 Acetylation (N-term); Carboxylation (DKW)
R.V(+42.01)TGGMK(+14.02).V Y 20.32 647.3312 6 -90.7 648.2798 1 96.89 1 54316 AEV 2_3_RA2_01_1224.d 9.2E4 1 1 56 61 Acetylation (N-term); Methylation(KR)
R.ALAR(+14.02)SGMRIGR.I Y 20.29 1200.6873 11 -4.0 401.2347 3 71.16 3 41136 AEV_3_3_RA3_01_1233.d 0 1 1 118 128 Methylation(KR)
R.A(+42.01)TGGNGT(-18.01)K.T Y 20.23 728.3453 8 -29.8 365.1691 2 35.49 1 11939 AEV 2_3_RA2_01_1224.d 1.58E5 3 3 99 106 Acetylation (N-term); Dehydration
K.TPGPGAQS(+164.06)ALR.A Y 19.75 1217.6169 11 -18.2 609.8047 2 34.52 3 16039 AEV_3_3_RA3_01_1233.d 0 1 1 107 117 O-Diisopropylphosphorylation
K.ADRDESSPYAAMLAAQ(+.98)DVAAR.C Y 19.63 2208.0117 21 29.8 553.0267 4 76.25 2 37586 AEV_1_3_RA2_01_1232.d 0 1 1 64 84 Deamidation (NQ)
K.KVER(+14.02)PATENISLGPLAGDGK(+42.01).L Y 19.62 2107.1272 20 8.9 703.3893 3 79.03 2 39790 AEV_1_3_RA2_01_1232.d 2.34E4 1 1 6 25 Methylation(KR); Acetylation (K)
K.KVER(+14.02)PATENISLGPLAGDGK.L Y 19.62 2065.1167 20 1.2 517.2870 4 66.17 3 37201 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 6 25 Methylation(KR)
K.T(+117.00)PGPGAQSALR.A Y 19.10 1170.5547 11 43.6 586.3101 2 39.11 3 18908 AEV_3_3_RA3_01_1233.d 8.14E4 1 1 107 117 Phospho-propargylamine
K.L(+42.01)VFGVAR.I Y 19.04 802.4701 7 19.7 402.2502 2 74.66 2 36369 AEV_1_3_RA2_01_1232.d 0 1 1 26 32 Acetylation (N-term)
R.VTGGMKVK(+43.99).A Y 18.96 862.4583 8 -8.7 432.2327 2 28.93 3 12760 AEV_3_3_RA3_01_1233.d 8.58E4 1 1 56 63 Carboxylation (DKW)
R.IGRIEDVTPTPSDSTRRK.G Y 18.64 2027.0759 18 7.9 507.7802 4 50.27 2 20576 AEV_1_3_RA2_01_1232.d 0 1 1 126 143
K.LVF(+31.99)GVAR.I Y 18.39 792.4493 7 -6.7 397.2293 2 28.93 2 10221 AEV_1_3_RA2_01_1232.d 0 1 1 26 32 Dihydroxy
R.C(+57.02)K(+14.02)ELGINALHIK.I Y 18.11 1408.7860 12 -2.3 353.2030 4 64.41 3 35808 AEV_3_3_RA3_01_1233.d 1.84E5 1 1 85 96 Carbamidomethylation; Methylation(KR)
R.IEDVTPTPSD(-18.01)STRR.K Y 17.97 1554.7638 14 6.9 519.2654 3 35.52 2 13313 AEV_1_3_RA2_01_1232.d 0 1 1 129 142 Dehydration
R.C(+57.02)KELGINALHIK.I Y 17.94 1394.7704 12 -79.4 465.8938 3 74.76 1 37681 AEV 2_3_RA2_01_1224.d 6.57E5 2 2 85 96 Carbamidomethylation
K.TPGPGAQS(-18.01)ALR.A Y 17.15 1035.5461 11 15.6 346.1947 3 25.13 2 8550 AEV_1_3_RA2_01_1232.d 2.91E5 1 1 107 117 Dehydration
K.IR(+14.02)ATGGNGT(-18.01)K.T Y 17.14 969.5356 10 13.4 324.1901 3 54.19 3 28485 AEV_3_3_RA3_01_1233.d 0 1 1 97 106 Methylation(KR); Dehydration
K.VERPATENISLGPLAGDGK(+70.01).L Y 17.05 1993.0116 19 -5.9 665.3406 3 80.61 2 41049 AEV_1_3_RA2_01_1232.d 0 1 1 7 25 N-pyruvic acid 2-iminyl
R.A(+43.01)TGGN(+.98)GTK.T Y 16.98 748.3351 8 -19.0 749.3282 1 36.48 1 12445 AEV 2_3_RA2_01_1224.d 1.58E4 1 1 99 106 Carbamylation; Deamidation (NQ)
R.IEDVTPT(+79.97)PSDSTRR(+21.98).K Y 16.95 1674.7227 14 5.1 419.6901 4 73.07 1 36346 AEV 2_3_RA2_01_1224.d 9.58E4 1 1 129 142 Phosphorylation (STY); Sodium adduct
R.VTGGMK(+71.04).V Y 16.77 662.3422 6 -32.4 663.3280 1 70.82 2 33466 AEV_1_3_RA2_01_1232.d 0 1 1 56 61 Propionamide (K, X@N-term)
R.IEDVTPTPS(+79.97)DST(+79.97)R.R Y 16.63 1576.6058 13 8.9 395.1622 4 35.83 1 12099 AEV 2_3_RA2_01_1224.d 3.49E5 1 1 129 141 Phosphorylation (STY)
K.K(+14.02)VERPATENISLGPLAGDGK(+27.99).L Y 16.20 2093.1116 20 9.2 698.7175 3 77.41 2 38500 AEV_1_3_RA2_01_1232.d 9.92E4 1 1 6 25 Methylation(KR); Formylation
R.VTGGM(+15.99)KVKADR.D Y 16.08 1176.6284 11 26.0 589.3368 2 98.92 2 50663 AEV_1_3_RA2_01_1232.d 0 1 1 56 66 Oxidation (M)
K.V(+43.01)K(+14.02)ADRDESSPYAAMLAAQDVAAR.C Y 15.92 2491.2124 23 8.7 499.2541 5 58.71 2 25078 AEV_1_3_RA2_01_1232.d 1.88E5 1 1 62 84 Carbamylation; Methylation(KR)
R.V(+43.01)TGGMK(+14.02).V Y 15.87 648.3265 6 -115.2 649.2590 1 52.60 1 21713 AEV 2_3_RA2_01_1224.d 8.47E4 1 1 56 61 Carbamylation; Methylation(KR)
R.V(+42.01)TGGMK(+31.99).V Y 15.85 665.3054 6 -0.8 666.3122 1 21.50 3 8652 AEV_3_3_RA3_01_1233.d 3.09E4 1 1 56 61 Acetylation (N-term); Dihydroxy
R.IEDVTPT(+79.97)PSDSTR.R Y 15.75 1496.6395 13 -26.9 749.3069 2 94.09 1 52534 AEV 2_3_RA2_01_1224.d 2.15E3 1 1 129 141 Phosphorylation (STY)
R.IEDVTPTP(+13.98)SDSTR.R Y 15.73 1430.6525 13 -62.1 716.2891 2 60.50 1 26858 AEV 2_3_RA2_01_1224.d 3.44E4 1 1 129 141 Proline oxidation to pyroglutamic acid
K.V(+42.01)K(+14.02)ADRDESSPYAAMLAAQDVAAR.C Y 15.67 2490.2173 23 -1.3 499.0501 5 57.65 3 30689 AEV_3_3_RA3_01_1233.d 5.38E4 1 1 62 84 Acetylation (N-term); Methylation(KR)
R.IEDVTPTPSDSTRRK.G Y 15.44 1700.8693 15 -3.6 851.4388 2 86.74 3 52835 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 129 143
K.V(+42.01)K(+14.02)ADRDESSPYAAMLAAQ(+.98)DVAAR.C Y 15.15 2491.2012 23 4.1 499.2496 5 57.50 3 30584 AEV_3_3_RA3_01_1233.d 4.82E5 1 1 62 84 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
R.A(+42.01)TGGNGTK(-.98).T Y 15.14 745.3719 8 125.4 746.4727 1 103.19 1 56787 AEV 2_3_RA2_01_1224.d 0 1 1 99 106 Acetylation (N-term); Amidation
R.VTGGMK(+21.98).V Y 15.06 613.2870 6 -4.7 614.2914 1 23.14 3 9513 AEV_3_3_RA3_01_1233.d 4.66E4 1 1 56 61 Sodium adduct
total 131 peptides
C1G9P8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.GRPIVIC(+57.02)NTGDEEFPASETER.I Y 134.03 2376.1016 21 4.6 793.0448 3 68.34 2 31614 AEV_1_3_RA2_01_1232.d 8.77E5 6 6 616 636 Carbamidomethylation
K.YLYDQHPDIDFTVLAK.A Y 129.16 1936.9570 16 1.0 646.6603 3 80.84 2 41227 AEV_1_3_RA2_01_1232.d 1.17E6 5 5 150 165
K.MKVDFVDVEFSEDGALPAER.A Y 126.95 2253.0623 20 18.6 752.0420 3 81.71 2 41898 AEV_1_3_RA2_01_1232.d 1.08E5 2 2 207 226
R.AFLSDDGIPQPAEFFLSSDPSAIVEHTKK.V Y 125.61 3145.5608 29 3.9 787.4005 4 86.60 2 45365 AEV_1_3_RA2_01_1232.d 1.36E6 7 7 256 284
K.GFRFETETDTEC(+57.02)IAK.L Y 120.12 1802.8145 15 5.1 601.9485 3 67.38 2 30939 AEV_1_3_RA2_01_1232.d 6.77E5 5 5 132 146 Carbamidomethylation
K.EIFEQPESVVNTMR.G Y 118.06 1677.8032 14 -0.6 839.9084 2 76.85 2 38076 AEV_1_3_RA2_01_1232.d 2.33E5 3 3 340 353
R.AFLSDDGIPQPAEFFLSSDPSAIVEHTK.K Y 114.64 3017.4658 28 11.7 1006.8409 3 89.47 2 47002 AEV_1_3_RA2_01_1232.d 4.6E5 2 2 256 283
R.GVFEELTEIPIAVELASDFLDR.Q Y 110.52 2462.2581 22 0.3 1232.1367 2 97.87 3 58361 AEV_3_3_RA3_01_1233.d 6.32E4 1 1 398 419
K.AVVKELQGAFGLLLK.S Y 109.86 1584.9602 15 2.3 529.3286 3 83.79 3 50864 AEV_3_3_RA3_01_1233.d 3.66E5 2 2 166 180
K.HGVLALVDENLPIIMILTR.D Y 109.76 2116.2078 19 2.2 706.4114 3 95.53 2 49522 AEV_1_3_RA2_01_1232.d 3.19E5 2 2 579 597
K.SATSLLAPPDKSLLHR.S Y 109.16 1704.9523 16 -0.5 569.3244 3 68.35 3 38936 AEV_3_3_RA3_01_1233.d 2.6E6 8 8 236 251
R.AFLSDDGIPQPAE(+6.01)FFLSSDPSAIVEHTKK.V Y 100.72 3151.5688 29 -55.3 788.8559 4 86.67 2 45413 AEV_1_3_RA2_01_1232.d 7.38E4 1 1 256 284 Replacement of proton by lithium
K.TFDSHAGIAHTR.W Y 99.52 1311.6320 12 4.5 438.2199 3 31.80 2 11554 AEV_1_3_RA2_01_1232.d 5.04E6 17 17 76 87
K.SLNAYQQVIAR.R Y 98.18 1261.6779 11 4.2 631.8489 2 66.90 2 30599 AEV_1_3_RA2_01_1232.d 1.76E6 6 6 604 614
K.SVHYPHEVIAAR.K Y 95.66 1377.7153 12 3.6 460.2474 3 49.10 2 19994 AEV_1_3_RA2_01_1232.d 2.46E6 10 10 181 192
R.SYILQTLVNGLSR.L Y 94.80 1462.8143 13 -1.4 732.4135 2 86.06 3 52419 AEV_3_3_RA3_01_1233.d 3.3E5 5 5 17 29
R.AIQTIELELQEIMK.G Y 89.91 1657.8960 14 -0.4 829.9550 2 88.12 3 53705 AEV_3_3_RA3_01_1233.d 1.03E5 2 2 317 330
K.M(+15.99)KVDFVDVEFSEDGALPAER.A Y 89.30 2269.0571 20 29.5 757.3820 3 79.05 3 47325 AEV_3_3_RA3_01_1233.d 0 1 1 207 226 Oxidation (M)
K.VDFVDVEFSEDGALPAER.A Y 87.21 1993.9268 18 1.4 997.9720 2 82.79 3 50158 AEV_3_3_RA3_01_1233.d 3.36E5 3 3 209 226
R.FETETDTEC(+57.02)IAK.L Y 86.65 1442.6235 12 2.8 722.3210 2 56.49 3 29856 AEV_3_3_RA3_01_1233.d 1.76E5 3 3 135 146 Carbamidomethylation
K.VLYLEDDDIAHIHEGQLNIHR.L Y 86.54 2499.2505 21 6.1 500.8604 5 74.60 3 43889 AEV_3_3_RA3_01_1233.d 1.82E6 6 6 285 305
R.GYDSAGLAVDGDKK.N Y 85.76 1394.6677 14 9.1 698.3475 2 44.74 2 17803 AEV_1_3_RA2_01_1232.d 9.84E5 7 7 34 47
R.RGRPIVIC(+57.02)NTGDEEFPASETER.I Y 84.45 2532.2026 22 1.2 634.0587 4 64.95 2 29218 AEV_1_3_RA2_01_1232.d 1.55E5 1 1 615 636 Carbamidomethylation
R.QAPVFRDDTC(+57.02)VFVSQSGETADSLMALR.Y Y 80.78 2999.4116 27 -1.3 1000.8098 3 82.91 3 50249 AEV_3_3_RA3_01_1233.d 3E4 1 1 420 446 Carbamidomethylation
R.Q(-17.03)APVFRDDTC(+57.02)VFVSQSGETADSLMALR.Y Y 78.67 2982.3850 27 7.6 995.1431 3 87.82 2 46100 AEV_1_3_RA2_01_1232.d 5.53E4 1 1 420 446 Pyro-glu from Q; Carbamidomethylation
K.LKDLIDSSKLDLSK.T Y 76.37 1573.8926 14 1.5 394.4810 4 67.91 3 38600 AEV_3_3_RA3_01_1233.d 1.33E6 4 4 62 75
R.LTKHDGTSNVR.A Y 74.02 1226.6367 11 2.3 409.8871 3 11.05 3 3027 AEV_3_3_RA3_01_1233.d 4.41E5 6 6 306 316
R.GVFEELTEIPIAVELASDFLDR(+14.02).Q Y 73.19 2476.2737 22 0.6 1239.1449 2 97.94 3 58382 AEV_3_3_RA3_01_1233.d 1.06E5 2 2 398 419 Methylation(KR)
K.SLNAYQQVIARR.G Y 71.87 1417.7789 12 -3.1 473.5988 3 62.54 3 34460 AEV_3_3_RA3_01_1233.d 3.65E5 2 2 604 615
R.GYDSAGLAVDGDKKNEVFAFK.E Y 71.37 2230.0906 21 8.4 744.3771 3 71.48 3 41390 AEV_3_3_RA3_01_1233.d 1.42E5 1 1 34 54
K.VSDQFKQILK.L Y 70.61 1204.6815 10 -3.3 603.3461 2 60.82 3 33041 AEV_3_3_RA3_01_1233.d 8.81E5 4 4 525 534
K.EIFEQPESVVNTM(+15.99)R.G Y 70.47 1693.7981 14 -1.9 847.9047 2 70.28 3 40444 AEV_3_3_RA3_01_1233.d 1.57E5 2 2 340 353 Oxidation (M)
R.SDPNWEFSVVHNGIITNYRELK.A Y 69.91 2617.2925 22 -2.7 873.4357 3 79.65 3 47806 AEV_3_3_RA3_01_1233.d 4.57E5 4 4 104 125
K.GFRFETETDTE(+14.02)C(+57.02)IAK.L Y 69.83 1816.8301 15 10.5 606.6237 3 70.29 2 33062 AEV_1_3_RA2_01_1232.d 1.88E5 1 1 132 146 Methylation(others); Carbamidomethylation
K.KSATSLLAPPDKSLLHR.S Y 69.19 1833.0471 17 -5.3 367.6147 5 65.05 2 29290 AEV_1_3_RA2_01_1232.d 4.56E4 2 2 235 251
R.KGSPLVVGVR.T Y 67.50 1010.6237 10 -16.6 506.3107 2 45.19 3 22667 AEV_3_3_RA3_01_1233.d 9.81E5 9 9 193 202
K.SLNAYQQVIAR(+14.02).R Y 67.17 1275.6935 11 -3.8 638.8516 2 69.26 3 39700 AEV_3_3_RA3_01_1233.d 4.62E4 1 1 604 614 Methylation(KR)
R.INC(+57.02)HPHR.S Y 65.80 932.4399 7 4.9 467.2295 2 9.90 3 2505 AEV_3_3_RA3_01_1233.d 7.49E5 7 7 97 103 Carbamidomethylation
R.GYDSAGLAVDGDK.K Y 65.55 1266.5728 13 8.9 634.2993 2 57.11 2 24156 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 34 46
R.GVFEE(+14.02)LTEIPIAVELASDFLDR.Q Y 64.51 2476.2737 22 -0.5 826.4315 3 97.94 3 58385 AEV_3_3_RA3_01_1233.d 0 1 1 398 419 Methylation(others)
K.SATSLLAPPDK.S Y 63.26 1098.5920 11 -2.6 550.3019 2 61.39 3 33499 AEV_3_3_RA3_01_1233.d 1.11E6 4 4 236 246
R.WATHGTPSR.I Y 61.27 1011.4886 9 -85.5 506.7084 2 37.24 1 12880 AEV 2_3_RA2_01_1224.d 2.91E6 9 9 88 96
K.GSPLVVGVR.T Y 60.34 882.5287 9 1.0 442.2721 2 60.48 2 26191 AEV_1_3_RA2_01_1232.d 2.56E5 3 3 194 202
R.GRPIVIC(+57.02)NTGDEEFPAS(+14.02)ETER.I Y 58.67 2390.1172 21 -2.6 797.7109 3 70.30 3 40466 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 616 636 Carbamidomethylation; Methylation(others)
K.DRSYILQTLVNGLSR.L Y 52.28 1733.9424 15 29.1 579.0049 3 84.76 2 44155 AEV_1_3_RA2_01_1232.d 0 1 1 15 29
K.VLY(-2.02)LEDDDIAHIHEGQLNIHR.L Y 50.98 2497.2349 21 13.1 625.3242 4 74.54 3 43767 AEV_3_3_RA3_01_1233.d 7.9E4 1 1 285 305 2-amino-3-oxo-butanoic_acid
R.AFLSDDGIPQPAE(+14.02)FFLSSDPSAIVEHTK.K Y 50.96 3031.4814 28 2.1 1011.5032 3 89.74 3 54573 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 256 283 Methylation(others)
R.AIQ(+.98)TIELELQEIMK.G Y 47.42 1658.8800 14 -6.8 830.4417 2 88.26 2 46326 AEV_1_3_RA2_01_1232.d 0 1 1 317 330 Deamidation (NQ)
K.SATS(+44.01)LLAPPDKSLLHR.S Y 45.06 1748.9607 16 14.1 438.2536 4 68.42 3 38987 AEV_3_3_RA3_01_1233.d 7.9E4 1 1 236 251 S-Ethylcystine from Serine
K.VLYLE(+14.02)DDDIAHIHEGQLNIHR.L Y 43.91 2513.2661 21 -12.8 503.6541 5 75.93 3 44860 AEV_3_3_RA3_01_1233.d 7.55E4 2 2 285 305 Methylation(others)
K.S(+42.01)LNAYQ(+.98)QVIAR.R Y 41.57 1304.6725 11 -56.5 435.8735 3 74.15 1 37266 AEV 2_3_RA2_01_1224.d 2.75E5 1 1 604 614 Acetylation (N-term); Deamidation (NQ)
R.AIQTIELELQEIMKGTFDHFMQK.E Y 39.31 2749.3818 23 1.7 688.3539 4 93.86 2 48919 AEV_1_3_RA2_01_1232.d 0 1 1 317 339
K.LSEPIKEMC(+57.02)AK.F Y 35.82 1304.6469 11 -1.0 653.3301 2 52.31 2 21630 AEV_1_3_RA2_01_1232.d 2.13E5 2 2 535 545 Carbamidomethylation
K.VTLGGLR.Q Y 34.01 714.4388 7 -2.5 358.2258 2 51.42 3 26654 AEV_3_3_RA3_01_1233.d 9.11E5 6 6 363 369
K.T(+87.05)FDSHAGIAHTR.W Y 33.85 1398.6826 12 3.3 350.6791 4 31.81 2 11561 AEV_1_3_RA2_01_1232.d 0 1 1 76 87 Phosphorylation to amine thiol
K.DLIDSSKLDLSK.T Y 33.77 1332.7136 12 -0.1 445.2451 3 70.67 3 40748 AEV_3_3_RA3_01_1233.d 4.16E5 2 2 64 75
R.WAT(+79.96)HGTPSR.I Y 33.64 1091.4454 9 100.9 364.8591 3 37.19 1 12821 AEV 2_3_RA2_01_1224.d 9.44E4 1 1 88 96 Sulfation
K.SLLHR.S N 32.10 624.3707 5 -1.4 313.1922 2 19.48 3 7563 AEV_3_3_RA3_01_1233.d 3.7E5 2 2 247 251
R.GRLDVANKK.V Y 29.44 999.5825 9 0.8 500.7990 2 13.98 3 4567 AEV_3_3_RA3_01_1233.d 3.78E5 4 4 354 362
K.LK(+40.03)DLIDSSKLDLSK.T Y 29.42 1613.9240 14 -45.6 404.4699 4 68.09 3 38722 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 62 75 Propionaldehyde +40
R.AFLSDDGIPQPAEF(+17.99)FLSSDPSAIVEHTKK.V Y 28.54 3163.5513 29 35.9 791.9235 4 87.16 2 45753 AEV_1_3_RA2_01_1232.d 0 1 1 256 284 Fluorination
R.AIQTIELE(+14.02)LQEIMK.G Y 28.07 1671.9116 14 -1.4 836.9619 2 91.74 2 48054 AEV_1_3_RA2_01_1232.d 1.59E4 1 1 317 330 Methylation(others)
R.REDIMDGLSK.V Y 28.02 1162.5652 10 -8.0 582.2852 2 54.49 3 28672 AEV_3_3_RA3_01_1233.d 9.25E4 2 2 515 524
K.SVTVE(+14.02) Y 27.95 547.2853 5 -15.5 548.2841 1 36.19 2 13638 AEV_1_3_RA2_01_1232.d 3.7E4 1 1 679 683 Methylation(others)
K.SATSLLAPPD(+14.02)KSLLHR.S Y 27.80 1718.9679 16 5.6 430.7516 4 70.62 3 40717 AEV_3_3_RA3_01_1233.d 6.75E4 1 1 236 251 Methylation(others)
K.SATSLLAPPDK(+14.02)SLLHR.S Y 27.59 1718.9679 16 3.3 430.7507 4 69.45 2 32432 AEV_1_3_RA2_01_1232.d 8.61E4 1 1 236 251 Methylation(KR)
R.ASQNAAIK.K Y 27.29 801.4344 8 -72.7 802.3834 1 77.29 2 38407 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 227 234
R.QYITTIR.R Y 26.97 893.4971 7 -86.9 447.7170 2 63.41 1 29124 AEV 2_3_RA2_01_1224.d 4.61E4 1 1 370 376
K.L(+42.01)DLSK(+14.02).T Y 26.60 630.3588 5 -69.6 631.3222 1 29.36 1 8642 AEV 2_3_RA2_01_1224.d 2.42E4 1 1 71 75 Acetylation (N-term); Methylation(KR)
K.S(+88.00)ATSLLAPPDKSLLHR.S Y 26.37 1792.9504 16 15.2 449.2517 4 69.34 2 32359 AEV_1_3_RA2_01_1232.d 0 1 1 236 251 3-sulfanylpropanoyl
K.GFR(+14.02)FETETDTEC(+57.02)IAK.L Y 26.35 1816.8301 15 8.9 606.6227 3 69.88 2 32760 AEV_1_3_RA2_01_1232.d 1.88E5 1 1 132 146 Methylation(KR); Carbamidomethylation
R.YC(+57.02)LER.G N 26.26 739.3323 5 -87.5 370.6411 2 40.20 1 14520 AEV 2_3_RA2_01_1224.d 3.4E5 2 2 447 451 Carbamidomethylation
K.HGVLALVDENLPIIM(+15.99)ILT(-18.01)R.D Y 25.40 2114.1921 19 0.8 705.7385 3 95.01 3 57244 AEV_3_3_RA3_01_1233.d 6.05E4 1 1 579 597 Oxidation (M); Dehydration
R.LEYRGYDSAGLAVDGDK.K Y 25.39 1827.8639 17 -76.5 610.2487 3 69.44 1 33515 AEV 2_3_RA2_01_1224.d 2.79E4 1 1 30 46
K.S(+43.01)LNAYQQVIAR.R Y 25.36 1304.6837 11 29.2 435.9146 3 63.42 2 28166 AEV_1_3_RA2_01_1232.d 1.88E5 1 1 604 614 Carbamylation
R.W(+42.01)ATHGTPSR.I Y 24.71 1053.4991 9 -44.2 352.1581 3 37.16 1 12802 AEV 2_3_RA2_01_1224.d 8.62E4 1 1 88 96 Acetylation (N-term)
K.VSDQFK.Q Y 24.64 722.3599 6 4.1 362.1887 2 20.23 2 6527 AEV_1_3_RA2_01_1232.d 3.64E5 2 2 525 530
R.LT(-2.02)KHDGTSNVR.A Y 24.45 1224.6211 11 6.8 409.2171 3 11.03 2 2855 AEV_1_3_RA2_01_1232.d 0 1 1 306 316 2-amino-3-oxo-butanoic_acid
K.ALLESK.G Y 24.01 659.3854 6 -49.9 660.3597 1 17.29 2 5281 AEV_1_3_RA2_01_1232.d 4.78E4 2 2 126 131
R.SYILQTLVN(+.98)GLSR.L Y 24.01 1463.7983 13 19.9 732.9210 2 81.90 3 49517 AEV_3_3_RA3_01_1233.d 0 1 1 17 29 Deamidation (NQ)
R.DGIFK.K Y 23.38 578.3064 5 -27.7 579.2977 1 37.75 3 18038 AEV_3_3_RA3_01_1233.d 0 1 1 598 602
K.EIFE(+14.02)QPESVVNTMR.G Y 23.26 1691.8188 14 3.1 846.9193 2 78.16 3 46630 AEV_3_3_RA3_01_1233.d 1.63E5 1 1 340 353 Methylation(others)
R.L(+43.01)DVANK.K Y 22.93 701.3708 6 -102.5 702.3062 1 84.25 1 45180 AEV 2_3_RA2_01_1224.d 2.72E5 3 3 356 361 Carbamylation
K.SATSLLAP(+31.99)PDKSLLHR.S Y 22.81 1736.9420 16 -21.4 435.2335 4 69.35 2 32366 AEV_1_3_RA2_01_1232.d 3.23E4 1 1 236 251 Dihydroxy
K.SVHYPHE(+37.03)VIAAR.K Y 22.68 1414.7469 12 -101.8 354.6580 4 64.35 1 29816 AEV 2_3_RA2_01_1224.d 0 1 1 181 192 Propargylamine
K.LSEPIKEM(+15.99)C(+57.02)AK.F Y 22.40 1320.6417 11 4.2 661.3309 2 33.96 2 12569 AEV_1_3_RA2_01_1232.d 6.85E3 1 1 535 545 Oxidation (M); Carbamidomethylation
R.WATH(+15.99)GTPSR(+14.02).I Y 22.36 1041.4991 9 -69.3 348.1496 3 60.16 1 26607 AEV 2_3_RA2_01_1224.d 6.79E3 1 1 88 96 Oxidation (HW); Methylation(KR)
R.AFLSDDGIPQPAE(+14.02)FFLSSDPSAIVEHTKK.V Y 21.51 3159.5764 29 10.5 790.9097 4 86.87 3 52923 AEV_3_3_RA3_01_1233.d 2.67E5 1 1 256 284 Methylation(others)
R.ASQNAAIKK.S Y 21.50 929.5294 9 -85.3 465.7324 2 17.67 1 4181 AEV 2_3_RA2_01_1224.d 2.26E4 2 2 227 235
R.LDVANKK.V Y 21.39 786.4599 7 -34.8 394.2235 2 11.86 2 3167 AEV_1_3_RA2_01_1232.d 0 1 1 356 362
R.LEYRGYDSAGLAVDGDK(+42.01).K Y 21.36 1869.8744 17 21.7 624.3123 3 98.07 1 55024 AEV 2_3_RA2_01_1224.d 2.09E5 1 1 30 46 Acetylation (K)
K.ELQGAFGLLLK.S Y 20.61 1187.6914 11 -89.3 594.7999 2 89.25 1 49071 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 170 180
R.N(+.98)LAKSVTVE(-.98) Y 20.55 959.5287 9 4.5 320.8516 3 21.20 2 6892 AEV_1_3_RA2_01_1232.d 9.94E4 1 1 675 683 Deamidation (NQ); Amidation
R.GY(+79.97)DSAGLAVDGDKK(+226.08).N Y 20.48 1700.7117 14 17.3 426.1926 4 63.17 1 28903 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 34 47 Phosphorylation (STY); Biotinylation
R.LDVANK.K Y 20.32 658.3650 6 -13.5 659.3634 1 37.87 3 18120 AEV_3_3_RA3_01_1233.d 7.33E4 1 1 356 361
R.Q(-17.03)YITTIRR.C Y 19.61 1032.5717 8 14.2 517.3004 2 63.11 2 27955 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 370 377 Pyro-glu from Q
R.EDIMDGLSK.V Y 19.32 1006.4641 9 -38.8 504.2198 2 69.77 1 33771 AEV 2_3_RA2_01_1224.d 0 1 1 516 524
K.LK(+43.01)DLIDSSK.L Y 19.26 1060.5764 9 5.6 531.2985 2 76.94 2 38134 AEV_1_3_RA2_01_1232.d 0 1 1 62 70 Carbamylation
K.A(+43.01)LLESK.G Y 19.16 702.3912 6 -2.6 352.2020 2 25.24 2 8607 AEV_1_3_RA2_01_1232.d 1.57E4 1 1 126 131 Carbamylation
K.KMKVDFVDVEFSEDGALPAER.A Y 18.42 2381.1572 21 20.8 596.3090 4 78.14 3 46609 AEV_3_3_RA3_01_1233.d 0 1 1 206 226
K.D(+316.20)LIDSSKLDLSK.T Y 18.41 1648.9175 12 -26.5 413.2257 4 68.13 3 38760 AEV_3_3_RA3_01_1233.d 0 1 1 64 75 Levuglandinyl-lysine pyrrole adduct
K.DLIDS(+79.97)SK.L Y 18.30 856.3579 7 -67.5 429.1573 2 42.18 1 15675 AEV 2_3_RA2_01_1224.d 3.28E5 1 1 64 70 Phosphorylation (STY)
R.SDPNWEFSVVHNGIITNYR.E Y 18.18 2247.0708 19 2.0 750.0324 3 80.10 3 48144 AEV_3_3_RA3_01_1233.d 1.33E5 2 2 104 122
K.S(+42.01)LNAYQQ(+.98)VIAR.R Y 18.17 1304.6725 11 34.4 435.9131 3 62.27 3 34181 AEV_3_3_RA3_01_1233.d 3.71E5 1 1 604 614 Acetylation (N-term); Deamidation (NQ)
R.NLAK(+14.02)SVTVE(+43.99) Y 18.05 1017.5342 9 3.5 340.1866 3 38.64 3 18593 AEV_3_3_RA3_01_1233.d 2.72E5 1 1 675 683 Methylation(KR); Carboxylation (E)
K.EM(+15.99)C(+57.02)AK.F Y 18.05 653.2513 5 75.1 654.3076 1 113.45 2 54672 AEV_1_3_RA2_01_1232.d 0 1 1 541 545 Oxidation (M); Carbamidomethylation
R.GRLDVANK.K Y 17.90 871.4875 8 -3.7 436.7494 2 17.80 3 6676 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 354 361
K.KVTLGGLR.Q Y 17.87 842.5338 8 -12.9 422.2687 2 43.04 2 16975 AEV_1_3_RA2_01_1232.d 3.88E4 1 1 362 369
R.DGIFK(+14.02).K Y 17.85 592.3220 5 14.7 593.3380 1 41.38 2 16146 AEV_1_3_RA2_01_1232.d 2.04E5 1 1 598 602 Methylation(KR)
R.WATHGTPS(+95.94)R.I Y 17.84 1107.4321 9 -23.1 1108.4138 1 94.45 1 52778 AEV 2_3_RA2_01_1224.d 0 1 1 88 96 Thiophosphorylation
K.LDLSK(+27.99).T Y 17.65 602.3275 5 -4.6 603.3320 1 83.74 2 43422 AEV_1_3_RA2_01_1232.d 0 1 1 71 75 Formylation
K.VT(+79.96)LGGLR.Q Y 17.23 794.3956 7 -8.7 795.3960 1 76.59 3 45368 AEV_3_3_RA3_01_1233.d 0 1 1 363 369 Sulfation
K.TFDSHAGIAHTR(+.98).W Y 17.05 1312.6160 12 22.8 329.1688 4 46.20 1 17985 AEV 2_3_RA2_01_1224.d 0 1 1 76 87 Deamidation (R)
R.ASQN(+.98)AAIK(+42.01).K Y 16.95 844.4290 8 12.8 423.2272 2 30.68 2 11046 AEV_1_3_RA2_01_1232.d 6.44E4 1 1 227 234 Deamidation (NQ); Acetylation (K)
K.FFKNQK(+21.98).S Y 16.88 832.4207 6 -7.6 833.4217 1 75.60 3 44597 AEV_3_3_RA3_01_1233.d 1.66E4 1 1 546 551 Sodium adduct
R.QYITTIR(+14.02).R Y 16.73 907.5127 7 -6.8 303.5095 3 35.17 2 13149 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 370 376 Methylation(KR)
K.G(+42.01)SPLVVGVR.T Y 16.70 924.5392 9 -39.3 309.1749 3 25.75 3 11000 AEV_3_3_RA3_01_1233.d 5.14E4 1 1 194 202 Acetylation (N-term)
K.LDLSK(+43.99).T Y 16.59 618.3224 5 -98.3 619.2689 1 95.93 1 53735 AEV 2_3_RA2_01_1224.d 3.46E4 1 1 71 75 Carboxylation (DKW)
K.L(+43.01)K(+42.01)DLIDSSKLDLSK.T Y 16.55 1658.9091 14 -116.2 415.6863 4 77.21 1 39622 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 62 75 Carbamylation; Acetylation (K)
K.KS(+79.97)ATSLLAPPDK(+226.08).S Y 16.55 1532.7310 12 -68.0 384.1639 4 67.42 1 31961 AEV 2_3_RA2_01_1224.d 4.71E4 1 1 235 246 Phosphorylation (STY); Biotinylation
R.E(+42.01)D(-18.01)IMDGLSK.V Y 16.54 1030.4641 9 26.6 516.2531 2 30.11 3 13457 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 516 524 Acetylation (N-term); Dehydration
K.L(+42.01)K(+14.02)DLIDS(+79.97)SK.L Y 16.22 1153.5631 9 -86.6 1154.4705 1 112.60 1 59511 AEV 2_3_RA2_01_1224.d 3.07E4 1 1 62 70 Acetylation (N-term); Methylation(KR); Phosphorylation (STY)
K.RREDIMDGLSK.V Y 16.01 1318.6663 11 22.6 440.5726 3 34.50 3 16029 AEV_3_3_RA3_01_1233.d 2.3E5 2 2 514 524
K.EVGK(+43.99)VAKLKDLIDSSK(+42.01).L Y 15.75 1814.9989 16 -7.1 606.0026 3 90.23 3 54829 AEV_3_3_RA3_01_1233.d 1.35E5 1 1 55 70 Carboxylation (DKW); Acetylation (K)
K.S(-2.02)LNAYQQVIAR.R Y 15.62 1259.6622 11 -23.6 630.8235 2 67.36 2 30906 AEV_1_3_RA2_01_1232.d 1.62E4 1 1 604 614 2-amino-3-oxo-butanoic_acid
R.REDIM(+15.99)DGLSK(+226.08).V Y 15.52 1404.6377 10 -29.8 703.3052 2 93.20 1 51896 AEV 2_3_RA2_01_1224.d 0 1 1 515 524 Oxidation (M); Biotinylation
R.A(+43.01)SQNAAIKK.S Y 15.12 972.5352 9 -1.8 487.2740 2 57.75 2 24512 AEV_1_3_RA2_01_1232.d 0 1 1 227 235 Carbamylation
K.T(+79.97)FDSH(+15.99)AGIAHTR.W Y 15.10 1407.5933 12 98.4 352.9402 4 69.85 1 33836 AEV 2_3_RA2_01_1224.d 4.72E5 1 1 76 87 Phosphorylation (STY); Oxidation (HW)
K.S(+42.01)ATSLLAPPDK(+42.01).S Y 15.03 1182.6132 11 18.9 395.2191 3 39.16 3 18915 AEV_3_3_RA3_01_1233.d 0 1 1 236 246 Acetylation (N-term); Acetylation (K)
R.LEYRGYDSAGLAVDGDKKNEVFAFK.E Y 15.03 2791.3816 25 4.0 698.8555 4 74.44 2 36202 AEV_1_3_RA2_01_1232.d 3.71E4 1 1 30 54
total 130 peptides
C1GDK2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AGGETLTLDQLALRAPTGANTLLLRGPK.N Y 174.96 2846.5977 28 3.7 712.6593 4 82.00 2 42128 AEV_1_3_RA2_01_1232.d 8.66E5 4 4 124 151
K.AGGETLTLDQLALRAPTGANTLLLR.G Y 148.05 2564.4285 25 5.3 642.1178 4 84.60 2 44042 AEV_1_3_RA2_01_1232.d 1.5E6 7 7 124 148
R.IEKAGGETLTLDQLALRAPTGANTLLLR.G Y 142.51 2934.6501 28 -4.8 734.6663 4 82.44 2 42481 AEV_1_3_RA2_01_1232.d 2.13E5 2 2 121 148
K.AGGETLTLDQLALR.A Y 121.08 1456.7886 14 -10.6 729.3939 2 78.88 2 39713 AEV_1_3_RA2_01_1232.d 2.71E6 8 8 124 137
R.APTGANTLLLRGPK.N Y 115.71 1407.8197 14 3.8 470.2823 3 63.08 2 27933 AEV_1_3_RA2_01_1232.d 1.53E6 6 6 138 151
K.TIVIVGTVTDDNRLLNVPK.I Y 115.22 2066.1736 19 1.8 689.7330 3 79.26 2 39986 AEV_1_3_RA2_01_1232.d 1.62E6 5 5 87 105
R.APTGANTLLLR.G Y 107.82 1125.6506 11 1.2 563.8333 2 66.59 2 30410 AEV_1_3_RA2_01_1232.d 5.08E6 5 5 138 148
R.IVSAIGTKETAEANKGK.T Y 106.35 1715.9417 17 3.6 572.9899 3 35.78 2 13465 AEV_1_3_RA2_01_1232.d 6.76E6 16 16 70 86
R.IEKAGGETLTLDQLALR.A Y 105.75 1827.0101 17 6.6 610.0146 3 75.91 2 37321 AEV_1_3_RA2_01_1232.d 2.97E5 2 2 121 137
K.TIVIVGTVTDDNR.L Y 101.02 1401.7463 13 1.6 701.8816 2 69.91 2 32784 AEV_1_3_RA2_01_1232.d 1.11E6 7 7 87 99
K.SDNVYLLLLVK.L Y 99.49 1275.7438 11 1.8 638.8803 2 85.82 2 44860 AEV_1_3_RA2_01_1232.d 2.9E5 2 2 24 34
R.INRPPVSLSR.I Y 88.22 1137.6619 10 -0.1 380.2279 3 50.59 2 20792 AEV_1_3_RA2_01_1232.d 1.21E7 21 21 60 69
K.SDNVYLLLLVKLYRFLSR.R Y 85.19 2211.2778 18 4.8 553.8294 4 97.46 2 50150 AEV_1_3_RA2_01_1232.d 1.53E5 2 2 24 41
K.SDNVYLLLLVKLYRFLSRR.T Y 77.87 2367.3789 19 1.2 474.4836 5 94.22 3 56892 AEV_3_3_RA3_01_1233.d 2.83E5 2 2 24 42
K.AGGE(+14.02)TLTLDQLALRAPTGANTLLLR.G Y 70.58 2578.4441 25 4.6 645.6213 4 85.69 2 44776 AEV_1_3_RA2_01_1232.d 8.48E4 2 2 124 148 Methylation(others)
R.APTGANTLLLR(+14.02)GPK.N Y 69.77 1421.8354 14 1.9 474.9533 3 64.57 3 35936 AEV_3_3_RA3_01_1233.d 1.38E5 2 2 138 151 Methylation(KR)
R.RTDSSFNKVVLR.R Y 66.17 1420.7786 12 -85.6 356.1715 4 65.81 1 30729 AEV 2_3_RA2_01_1224.d 4.24E5 3 3 42 53
R.EAVKHFGFGPHSGK.K Y 65.13 1496.7524 14 2.4 375.1963 4 36.37 3 17162 AEV_3_3_RA3_01_1233.d 2.34E6 6 6 155 168
R.APTGANTLLLR(+14.02).G Y 65.06 1139.6663 11 0.3 570.8406 2 70.84 2 33476 AEV_1_3_RA2_01_1232.d 3.36E5 2 2 138 148 Methylation(KR)
K.TIVIVGTVTDDNRLLNVPKISVAALR.F Y 63.20 2776.6174 26 2.6 695.1635 4 83.79 2 43464 AEV_1_3_RA2_01_1232.d 6.66E4 1 1 87 112
R.IVSAIGTK.E Y 61.87 787.4803 8 -8.1 788.4813 1 31.84 3 14468 AEV_3_3_RA3_01_1233.d 4.17E6 9 9 70 77
R.INRPPVSLSR(+14.02).I Y 60.14 1151.6775 10 2.6 384.9008 3 52.32 3 27262 AEV_3_3_RA3_01_1233.d 1.14E6 5 5 60 69 Methylation(KR)
R.IVSAIGTK(+14.02)ETAEANKGK.T Y 57.70 1729.9574 17 2.2 577.6610 3 43.21 3 21425 AEV_3_3_RA3_01_1233.d 9.07E4 1 1 70 86 Methylation(KR)
R.IVSAIGTKETAEANK.G Y 57.09 1530.8253 15 1.6 511.2832 3 42.31 2 16617 AEV_1_3_RA2_01_1232.d 4.77E5 3 3 70 84
R.LLNVPKISVAALR.F Y 57.05 1392.8816 13 -36.3 465.2843 3 77.65 2 38690 AEV_1_3_RA2_01_1232.d 0 1 1 100 112
K.AGGETLTLDQLALR(+14.02)APTGANTLLLR.G Y 56.66 2578.4441 25 -15.3 860.4755 3 85.77 2 44886 AEV_1_3_RA2_01_1232.d 6.56E4 1 1 124 148 Methylation(KR)
R.APTGANTLLLR(+282.05).G Y 52.94 1407.7034 11 -6.4 470.2387 3 71.72 1 35325 AEV 2_3_RA2_01_1224.d 8.19E5 2 2 138 148 Bis(hydroxphenylglyoxal) arginine
R.IVSAIGTKETAEANKGK(+14.02).T Y 51.75 1729.9574 17 1.0 577.6603 3 39.08 3 18845 AEV_3_3_RA3_01_1233.d 2.35E5 3 3 70 86 Methylation(KR)
R.IN(+.98)RPPVSLSR.I Y 50.50 1138.6459 10 13.4 380.5610 3 48.50 3 24768 AEV_3_3_RA3_01_1233.d 8.1E5 5 5 60 69 Deamidation (NQ)
R.I(+41.03)NRPPVSLSR.I Y 50.36 1178.6884 10 -0.6 393.9032 3 48.51 3 24771 AEV_3_3_RA3_01_1233.d 2.89E4 1 1 60 69 Amidination of lysines or N-terminal amines with methyl acetimidate
R.EAVKHFGFGPHSGKKPYVQSK.G Y 49.46 2327.2173 21 1.3 466.4514 5 45.95 3 23200 AEV_3_3_RA3_01_1233.d 1.13E6 3 3 155 175
R.IVSAIGTKETAE(+14.02)ANKGK.T Y 48.27 1729.9574 17 6.0 433.4992 4 39.28 3 18977 AEV_3_3_RA3_01_1233.d 3.01E5 1 1 70 86 Methylation(others)
K.AGGET(+13.03)LTLDQLALRAPTGANTLLLRGPK.N Y 45.68 2859.6294 28 -3.3 715.9122 4 82.70 3 50091 AEV_3_3_RA3_01_1233.d 0 1 1 124 151 Michael addition with methylamine
R.T(+41.03)DSSFNKVVLR.R Y 42.76 1305.7041 11 -12.7 436.2365 3 58.50 2 24941 AEV_1_3_RA2_01_1232.d 2.72E4 1 1 43 53 Amidination of lysines or N-terminal amines with methyl acetimidate
R.INR(+.98)PPVSLSR.I Y 42.43 1138.6459 10 20.2 380.5636 3 50.92 2 20910 AEV_1_3_RA2_01_1232.d 4.39E5 1 1 60 69 Deamidation (R)
K.ISVAALR.F Y 41.09 728.4545 7 2.9 365.2356 2 57.48 2 24383 AEV_1_3_RA2_01_1232.d 6.13E6 12 12 106 112
K.T(+41.03)IVIVGTVTDDNR.L Y 39.42 1442.7729 13 -13.2 481.9252 3 69.84 2 32731 AEV_1_3_RA2_01_1232.d 6.74E4 1 1 87 99 Amidination of lysines or N-terminal amines with methyl acetimidate
R.INRPPVS(+79.96)LSR.I Y 38.64 1217.6187 10 -40.5 406.8637 3 62.89 1 28697 AEV 2_3_RA2_01_1224.d 1.12E5 1 1 60 69 Sulfation
R.A(+42.01)PTGANTLLLRGPK.N Y 38.56 1449.8303 14 -71.5 484.2495 3 63.23 2 28033 AEV_1_3_RA2_01_1232.d 0 1 1 138 151 Acetylation (N-term)
K.KPYVQSK.G Y 38.19 848.4756 7 -8.3 425.2415 2 9.81 2 2423 AEV_1_3_RA2_01_1232.d 3.7E3 1 1 169 175
K.HFGFGPHSGKKPYVQSK.G Y 38.02 1899.9744 17 1.5 476.0016 4 43.53 3 21618 AEV_3_3_RA3_01_1233.d 2.26E6 6 6 159 175
R.IVS(-2.02)AIGTKETAEANKGK.T Y 36.23 1713.9260 17 -14.3 572.3078 3 33.54 3 15465 AEV_3_3_RA3_01_1233.d 9.96E4 1 1 70 86 2-amino-3-oxo-butanoic_acid
R.IVSAIGTK(+14.02).E Y 35.53 801.4960 8 4.8 401.7572 2 43.81 2 17348 AEV_1_3_RA2_01_1232.d 5.17E4 1 1 70 77 Methylation(KR)
R.F(+134.05)TSTAR.A Y 32.52 815.3926 6 -40.5 816.3668 1 59.16 1 25872 AEV 2_3_RA2_01_1224.d 4.85E4 1 1 113 118 3-methyl-2-pyridyl isocyanate
K.AGGETLTLDQ(+.98)LALR.A Y 31.47 1457.7726 14 -87.2 729.8300 2 84.35 1 45257 AEV 2_3_RA2_01_1224.d 1.61E5 1 1 124 137 Deamidation (NQ)
K.AGGETLTLDQLALRAPTGANTLLLR(+282.05).G Y 28.89 2846.4814 25 -49.4 712.5925 4 88.19 1 48281 AEV 2_3_RA2_01_1224.d 3.92E5 1 1 124 148 Bis(hydroxphenylglyoxal) arginine
R.LLNVPK.I Y 27.50 682.4377 6 -5.0 342.2244 2 49.36 2 20121 AEV_1_3_RA2_01_1232.d 6.51E5 4 4 100 105
K.GRKFER.A Y 27.40 791.4402 6 2.5 396.7284 2 10.11 3 2593 AEV_3_3_RA3_01_1233.d 1.37E5 2 2 176 181
K.AGGET(-2.02)LTLDQLALR.A Y 26.77 1454.7728 14 -38.3 728.3658 2 78.99 3 47277 AEV_3_3_RA3_01_1233.d 0 1 1 124 137 2-amino-3-oxo-butanoic_acid
R.LLNVPK(+43.99).I Y 25.30 726.4276 6 -2.4 727.4331 1 100.25 3 59153 AEV_3_3_RA3_01_1233.d 1.35E5 1 1 100 105 Carboxylation (DKW)
K.ISVAALR(+14.02).F Y 24.85 742.4701 7 0.8 372.2426 2 65.08 2 29305 AEV_1_3_RA2_01_1232.d 1.55E5 1 1 106 112 Methylation(KR)
K.AGGETLTLDQLALR(+199.07).A Y 24.79 1655.8552 14 -29.3 552.9429 3 72.00 3 41819 AEV_3_3_RA3_01_1233.d 4.9E4 1 1 124 137 Oxidized Arginine biotinylated with biotin hydrazide
K.KPYVQSK(+14.02).G Y 24.38 862.4912 7 -24.8 432.2422 2 13.50 2 3780 AEV_1_3_RA2_01_1232.d 0 1 1 169 175 Methylation(KR)
R.IEK(+14.02)AGGET(-18.01)LTLDQLALR.A Y 24.33 1823.0153 17 -70.6 608.6361 3 75.92 2 37327 AEV_1_3_RA2_01_1232.d 0 1 1 121 137 Methylation(KR); Dehydration
R.FTSTAR.A Y 23.77 681.3446 6 -21.6 682.3372 1 77.90 2 38891 AEV_1_3_RA2_01_1232.d 7.13E4 3 3 113 118
R.RLFMSR.I Y 22.68 808.4377 6 1.9 405.2269 2 43.51 2 17204 AEV_1_3_RA2_01_1232.d 1.79E5 1 1 54 59
R.RTDS(+79.97)SFNK(+42.01).V Y 22.34 1075.4336 8 -15.9 538.7155 2 22.72 1 5634 AEV 2_3_RA2_01_1224.d 8.33E4 1 1 42 49 Phosphorylation (STY); Acetylation (K)
K.ETAEANK.G Y 22.22 761.3555 7 28.7 762.3846 1 25.71 1 6863 AEV 2_3_RA2_01_1224.d 3.19E4 1 1 78 84
R.TDSSFNKVVLRR.L Y 21.99 1420.7786 12 1.5 474.6009 3 51.68 2 21299 AEV_1_3_RA2_01_1232.d 5.63E5 2 2 43 54
K.AGGET(+13.03)LTLDQLALRAPTGANTLLLR.G Y 21.72 2577.4602 25 -24.1 860.1400 3 85.45 3 52001 AEV_3_3_RA3_01_1233.d 0 1 1 124 148 Michael addition with methylamine
R.TDSSFNKVVLR.R Y 21.16 1264.6775 11 -90.3 422.5284 3 67.16 1 31788 AEV 2_3_RA2_01_1224.d 5.05E5 1 1 43 53
R.IVSAIGTKETAEAN(+.98)KGK.T Y 20.82 1716.9258 17 -17.6 573.3058 3 36.59 3 17319 AEV_3_3_RA3_01_1233.d 0 1 1 70 86 Deamidation (NQ)
K.AGGETLTLDQLALR(+14.02).A Y 20.78 1470.8042 14 -88.7 736.3442 2 86.02 1 46582 AEV 2_3_RA2_01_1224.d 9.52E4 1 1 124 137 Methylation(KR)
K.HFGFGPHSGK.K Y 20.41 1069.5093 10 4.0 357.5118 3 35.63 2 13361 AEV_1_3_RA2_01_1232.d 2.74E5 2 2 159 168
R.L(+42.01)LNVPK.I Y 20.29 724.4483 6 -98.9 363.1956 2 46.93 3 23769 AEV_3_3_RA3_01_1233.d 2.24E5 1 1 100 105 Acetylation (N-term)
R.RTDSSFNK.V Y 20.23 953.4567 8 -53.8 477.7100 2 49.58 1 20013 AEV 2_3_RA2_01_1224.d 5.79E3 2 2 42 49
R.FTST(-18.01)AR(+14.02).A Y 19.91 677.3497 6 -125.4 678.2720 1 85.64 1 46294 AEV 2_3_RA2_01_1224.d 0 1 1 113 118 Dehydration; Methylation(KR)
R.FTSTARARIEK(+188.03)AGGETLTLDQLALR.A Y 19.71 2905.5154 25 -4.2 727.3831 4 79.37 2 40060 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 113 137 Lipoyl
R.RTDSS(-2.02)FNKVVLR.R Y 19.33 1418.7629 12 8.6 355.7010 4 46.88 3 23761 AEV_3_3_RA3_01_1233.d 2.47E6 1 1 42 53 2-amino-3-oxo-butanoic_acid
K.E(+14.02)TAEANK.G Y 19.14 775.3712 7 -90.6 776.3082 1 83.74 1 44788 AEV 2_3_RA2_01_1224.d 9.96E4 1 1 78 84 Methylation(others)
R.IN(+.98)R(+14.02)PPVSLSR(+14.02).I Y 19.08 1166.6771 10 1.0 389.9000 3 53.21 3 27852 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 60 69 Deamidation (NQ); Methylation(KR)
K.KPY(+79.97)VQSK(+42.01).G Y 18.99 970.4525 7 -88.9 486.1904 2 37.19 1 12822 AEV 2_3_RA2_01_1224.d 0 1 1 169 175 Phosphorylation (STY); Acetylation (K)
R.LFMSR.I Y 18.78 652.3367 5 0.5 327.1758 2 44.84 3 22457 AEV_3_3_RA3_01_1233.d 5.77E5 3 3 55 59
R.T(-18.01)DSSFNK.V Y 18.45 779.3450 7 -30.8 780.3282 1 111.91 1 59308 AEV 2_3_RA2_01_1224.d 5.45E4 1 1 43 49 Dehydration
R.LLNVPK(+21.98).I Y 18.19 704.4197 6 -24.3 353.2086 2 11.84 3 3425 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 100 105 Sodium adduct
R.I(+42.01)NRPPVSLSR(+14.02).I Y 17.88 1193.6880 10 -44.1 398.8857 3 52.36 3 27289 AEV_3_3_RA3_01_1233.d 0 1 1 60 69 Acetylation (N-term); Methylation(KR)
R.IVSAIGT(+79.97)K(+42.01).E Y 17.41 909.4572 8 -9.8 455.7314 2 38.69 2 14841 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 70 77 Phosphorylation (STY); Acetylation (K)
K.ETAEANK(+226.08).G Y 17.29 987.4331 7 5.4 494.7265 2 59.00 1 25763 AEV 2_3_RA2_01_1224.d 1.65E5 1 1 78 84 Biotinylation
K.AGGETLTLD(-18.01)QLALR(+14.02).A Y 17.18 1452.7936 14 -29.6 727.3826 2 78.85 2 39642 AEV_1_3_RA2_01_1232.d 9.96E4 1 1 124 137 Dehydration; Methylation(KR)
R.IVSAIGTKET(+79.97)AEAN(+162.05)K.G Y 17.01 1772.8445 15 -18.2 591.9447 3 54.44 1 22824 AEV 2_3_RA2_01_1224.d 6.18E4 1 1 70 84 Phosphorylation (STY); Hexose (NSY)
R.I(+43.01)VSAIGTK.E Y 17.00 830.4861 8 -44.1 416.2321 2 33.55 2 12383 AEV_1_3_RA2_01_1232.d 0 1 1 70 77 Carbamylation
K.ETAEANK(+14.02)GK.T Y 16.82 960.4876 9 -14.4 481.2442 2 35.73 3 16772 AEV_3_3_RA3_01_1233.d 0 1 1 78 86 Methylation(KR)
R.LLNVP(+31.99)KISVAALR.F Y 16.64 1424.8715 13 7.1 357.2277 4 62.54 2 27566 AEV_1_3_RA2_01_1232.d 0 1 1 100 112 Dihydroxy
R.FTST(-18.01)AR.A Y 16.25 663.3340 6 -28.5 664.3224 1 75.20 2 36767 AEV_1_3_RA2_01_1232.d 7.6E4 1 1 113 118 Dehydration
K.KPY(-18.01)VQ(+.98)SK.G Y 15.99 831.4490 7 20.6 416.7404 2 14.34 2 4094 AEV_1_3_RA2_01_1232.d 0 1 1 169 175 Dehydration; Deamidation (NQ)
R.RTD(-18.01)SSFN(+.98)K.V Y 15.89 936.4301 8 -42.2 937.3978 1 95.68 1 53573 AEV 2_3_RA2_01_1224.d 7.01E4 1 1 42 49 Dehydration; Deamidation (NQ)
R.SRGFKV Y 15.56 692.3969 6 -15.1 347.2005 2 24.64 2 8339 AEV_1_3_RA2_01_1232.d 0 1 1 188 193
K.ETAEANK(+42.01).G Y 15.15 803.3661 7 -12.6 804.3633 1 28.65 1 8293 AEV 2_3_RA2_01_1224.d 1.09E4 1 1 78 84 Acetylation (K)
M(+42.01)GKPPC(+57.02)IDLDR(+14.02).H Y 15.07 1356.6530 11 -0.4 679.3335 2 67.46 2 30975 AEV_1_3_RA2_01_1232.d 6.63E4 1 1 1 11 Acetylation (Protein N-term); Carbamidomethylation; Methylation(KR)
total 89 peptides
C1G0E3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.FKVYEPLLIVGLDKFAGVDIR.V Y 160.86 2391.3564 21 1.8 598.8475 4 88.80 2 46643 AEV_1_3_RA2_01_1232.d 1.58E6 5 5 46 66
K.VNGQPLALTQPEILR.F Y 158.98 1647.9308 15 1.6 824.9740 2 77.87 2 38894 AEV_1_3_RA2_01_1232.d 2.1E6 6 6 31 45
K.VYEPLLIVGLDKFAGVDIR.V Y 135.30 2116.1931 19 4.1 706.4079 3 89.72 2 47086 AEV_1_3_RA2_01_1232.d 3.66E5 3 3 48 66
K.GLIKVNGQPLALTQPEILR.F Y 133.26 2059.2153 19 -14.2 687.4026 3 80.22 2 40743 AEV_1_3_RA2_01_1232.d 4.7E5 3 3 27 45
R.VTGGGHTSQIYAIR.Q Y 117.93 1458.7579 14 3.3 487.2615 3 51.94 2 21464 AEV_1_3_RA2_01_1232.d 4.27E6 11 11 69 82
K.AGKGLIKVNGQPLALTQPEILR.F Y 116.82 2315.3689 22 -0.9 579.8490 4 76.03 3 44946 AEV_3_3_RA3_01_1233.d 1.27E5 1 1 24 45
K.GLIKVN(+.98)GQPLALTQPEILR.F Y 111.87 2060.1992 19 3.9 687.7430 3 81.30 2 41645 AEV_1_3_RA2_01_1232.d 1.76E6 5 5 27 45 Deamidation (NQ)
R.FKVYEPLLIVGLDK.F Y 108.49 1632.9490 14 2.3 545.3248 3 83.95 2 43580 AEV_1_3_RA2_01_1232.d 5.01E5 4 4 46 59
K.VN(+.98)GQPLALTQPEILR.F Y 105.41 1648.9148 15 1.2 825.4657 2 79.39 2 40071 AEV_1_3_RA2_01_1232.d 1.19E6 4 4 31 45 Deamidation (NQ)
K.KKTATAVAQC(+57.02)K.A Y 103.76 1204.6598 11 3.5 603.3393 2 10.37 2 2615 AEV_1_3_RA2_01_1232.d 3.98E5 6 6 13 23 Carbamidomethylation
K.AGKGLIKVN(+.98)GQPLALTQPEILR.F Y 101.66 2316.3528 22 3.6 580.0975 4 77.80 2 38812 AEV_1_3_RA2_01_1232.d 3.1E5 3 3 24 45 Deamidation (NQ)
K.NQLKQALVQYDR.T Y 98.04 1474.7892 12 -9.2 492.5992 3 60.05 3 32486 AEV_3_3_RA3_01_1233.d 1.93E5 2 2 103 114
K.YVDEHAKNQLK.Q Y 97.33 1343.6833 11 0.5 672.8493 2 19.59 3 7655 AEV_3_3_RA3_01_1233.d 8.6E5 7 7 96 106
R.FKVYEPLLIVGLDKFAGVDIRVR.V Y 93.35 2646.5261 23 3.7 530.3145 5 86.81 3 52881 AEV_3_3_RA3_01_1233.d 2.95E5 3 3 46 68
K.VNGQ(+.98)PLALTQPEILR.F Y 87.86 1648.9148 15 -6.7 825.4592 2 78.93 2 39757 AEV_1_3_RA2_01_1232.d 3.84E5 4 4 31 45 Deamidation (NQ)
K.VNGQPLALTQPEILR(+14.02).F Y 86.80 1661.9464 15 1.2 831.9814 2 79.17 3 47420 AEV_3_3_RA3_01_1233.d 2.44E5 3 3 31 45 Methylation(KR)
K.VN(-17.03)GQPLALTQPEILR.F Y 86.52 1630.9042 15 -0.5 816.4589 2 84.93 3 51662 AEV_3_3_RA3_01_1233.d 1.08E6 6 6 31 45 Ammonia-loss (N)
K.KTATAVAQC(+57.02)K.A Y 84.70 1076.5648 10 3.6 539.2916 2 11.45 3 3218 AEV_3_3_RA3_01_1233.d 1.86E5 4 4 14 23 Carbamidomethylation
K.GLIKVNGQPLALTQPEILR(+14.02).F Y 84.68 2073.2310 19 0.2 692.0844 3 80.66 3 48577 AEV_3_3_RA3_01_1233.d 1.91E5 2 2 27 45 Methylation(KR)
K.QALVQYDR.T Y 84.66 991.5087 8 -3.5 496.7599 2 44.06 3 22010 AEV_3_3_RA3_01_1233.d 3.69E6 15 15 107 114
K.TATAVAQC(+57.02)KAGK.G Y 84.63 1204.6234 12 1.2 603.3197 2 13.41 3 4260 AEV_3_3_RA3_01_1233.d 8.93E4 4 4 15 26 Carbamidomethylation
K.VNGQPLALTQPE(+14.02)ILR.F Y 83.60 1661.9464 15 4.6 831.9843 2 79.12 2 39864 AEV_1_3_RA2_01_1232.d 6.12E4 1 1 31 45 Methylation(others)
R.FK(+14.02)VYEPLLIVGLDKFAGVDIR.V Y 81.30 2405.3721 21 -2.6 602.3488 4 89.95 3 54688 AEV_3_3_RA3_01_1233.d 2.28E5 1 1 46 66 Methylation(KR)
R.VTGGGHTSQ(+.98)IYAIR.Q Y 76.47 1459.7419 14 14.0 487.5947 3 49.16 3 25193 AEV_3_3_RA3_01_1233.d 7.47E5 2 2 69 82 Deamidation (NQ)
K.TATAVAQC(+57.02)K.A Y 76.11 948.4698 9 15.5 475.2496 2 14.14 2 4016 AEV_1_3_RA2_01_1232.d 6.53E5 6 6 15 23 Carbamidomethylation
K.Q(-17.03)ALVQYDRTLLVADNR.R Y 74.04 1856.9744 16 5.4 620.0021 3 80.25 3 48263 AEV_3_3_RA3_01_1233.d 1.55E4 1 1 107 122 Pyro-glu from Q
K.SIVAYYQK.Y Y 73.79 970.5123 8 -1.3 486.2628 2 54.16 3 28499 AEV_3_3_RA3_01_1233.d 2.82E6 8 8 88 95
K.GLIKVNGQ(+.98)PLALTQPEILR(+14.02).F Y 68.74 2074.2151 19 -23.9 692.3958 3 82.20 3 49734 AEV_3_3_RA3_01_1233.d 0 1 1 27 45 Deamidation (NQ); Methylation(KR)
M.A(+42.01)TTQSVQC(+57.02)FGKK.K Y 66.77 1395.6816 12 2.2 698.8496 2 55.16 2 23145 AEV_1_3_RA2_01_1232.d 1.36E6 6 6 2 13 Acetylation (Protein N-term); Carbamidomethylation
K.KKTATAVAQC(+57.02)K(+14.02).A Y 66.52 1218.6754 11 -36.9 610.3225 2 13.56 3 4347 AEV_3_3_RA3_01_1233.d 5.03E4 2 2 13 23 Carbamidomethylation; Methylation(KR)
K.GLIKVN(+.98)GQPLALTQ(+.98)PEILR.F Y 65.19 2061.1833 19 -20.1 688.0546 3 82.47 2 42476 AEV_1_3_RA2_01_1232.d 0 1 1 27 45 Deamidation (NQ)
M.A(+42.01)TTQSVQC(+57.02)FGK.K Y 65.04 1267.5867 11 4.1 634.8032 2 64.09 2 28667 AEV_1_3_RA2_01_1232.d 5.28E6 9 9 2 12 Acetylation (Protein N-term); Carbamidomethylation
K.TATAVAQC(+57.02)K(+14.02).A Y 64.67 962.4855 9 4.0 482.2520 2 21.30 3 8572 AEV_3_3_RA3_01_1233.d 5.5E5 6 6 15 23 Carbamidomethylation; Methylation(KR)
R.TLLVADNRR.A Y 64.06 1056.6040 9 1.8 529.3102 2 35.37 3 16553 AEV_3_3_RA3_01_1233.d 4.28E6 12 12 115 123
K.Q(-17.03)ALVQYDR.T Y 62.80 974.4821 8 -1.6 488.2476 2 66.16 3 37193 AEV_3_3_RA3_01_1233.d 2.37E6 6 6 107 114 Pyro-glu from Q
R.TLLVADNR.R Y 61.05 900.5029 8 -89.1 451.2186 2 61.31 1 27449 AEV 2_3_RA2_01_1224.d 5.4E6 10 10 115 122
R.F(+42.01)K(+14.02)VYEPLLIVGLDKFAGVDIR.V Y 59.93 2447.3828 21 4.1 612.8555 4 90.51 2 47470 AEV_1_3_RA2_01_1232.d 2.65E4 1 1 46 66 Acetylation (N-term); Methylation(KR)
M.A(+42.01)TTQ(+.98)SVQC(+57.02)FGK.K Y 58.35 1268.5707 11 -1.7 635.2916 2 65.77 3 36885 AEV_3_3_RA3_01_1233.d 4.84E5 5 5 2 12 Acetylation (Protein N-term); Deamidation (NQ); Carbamidomethylation
K.VN(+.98)GQPLALTQPEILR(+14.02).F Y 57.76 1662.9304 15 1.2 832.4735 2 80.30 3 48304 AEV_3_3_RA3_01_1233.d 1.09E5 3 3 31 45 Deamidation (NQ); Methylation(KR)
M.A(+42.01)TTQSVQ(+.98)C(+57.02)FGK.K Y 57.00 1268.5707 11 4.0 635.2952 2 66.78 2 30495 AEV_1_3_RA2_01_1232.d 6.49E5 4 4 2 12 Acetylation (Protein N-term); Deamidation (NQ); Carbamidomethylation
K.KFGGPGAR.A Y 55.68 788.4293 8 6.4 395.2244 2 14.81 2 4286 AEV_1_3_RA2_01_1232.d 2.43E6 6 6 128 135
R.FK(+14.02)VYEPLLIVGLDK.F Y 53.82 1646.9647 14 2.9 549.9971 3 85.99 2 44969 AEV_1_3_RA2_01_1232.d 7.92E4 2 2 46 59 Methylation(KR)
R.VRVTGGGHTSQIYAIR.Q Y 53.55 1713.9274 16 10.8 429.4937 4 57.55 2 24389 AEV_1_3_RA2_01_1232.d 7.35E4 1 1 67 82
K.QALVQYDR(+14.02).T Y 53.32 1005.5243 8 -0.1 503.7693 2 52.03 3 27073 AEV_3_3_RA3_01_1233.d 6.89E5 2 2 107 114 Methylation(KR)
M.A(+42.01)TTQSVQC(+57.02)FGK(+14.02).K Y 52.80 1281.6023 11 5.6 641.8120 2 67.09 2 30747 AEV_1_3_RA2_01_1232.d 5.8E5 2 2 2 12 Acetylation (Protein N-term); Carbamidomethylation; Methylation(KR)
K.FGGPGAR.A Y 50.84 660.3344 7 7.3 331.1768 2 18.56 2 5798 AEV_1_3_RA2_01_1232.d 2.68E6 10 10 129 135
K.SIVAYYQKYVDEHAK.N Y 50.16 1812.9045 15 0.9 454.2338 4 70.99 3 41038 AEV_3_3_RA3_01_1233.d 7.69E4 2 2 88 102
K.Q(+.98)ALVQYDR.T Y 46.90 992.4927 8 1.4 497.2543 2 49.15 2 20017 AEV_1_3_RA2_01_1232.d 1.02E6 5 5 107 114 Deamidation (NQ)
K.SIVAYYQK(+14.02).Y Y 45.07 984.5280 8 0.9 493.2717 2 60.85 2 26428 AEV_1_3_RA2_01_1232.d 9.53E4 1 1 88 95 Methylation(KR)
K.TATAVAQ(+.98)C(+57.02)K(+14.02).A Y 44.07 963.4695 9 -0.7 482.7417 2 26.22 3 11266 AEV_3_3_RA3_01_1233.d 1.95E5 2 2 15 23 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
R.TLLVADN(+.98)R.R Y 42.94 901.4869 8 -1.2 451.7502 2 50.65 3 26131 AEV_3_3_RA3_01_1233.d 2.66E5 1 1 115 122 Deamidation (NQ)
K.VYE(+14.02)PLLIVGLDKFAGVDIR.V Y 42.79 2130.2087 19 14.3 711.0870 3 91.02 3 55277 AEV_3_3_RA3_01_1233.d 4.14E4 1 1 48 66 Methylation(others)
R.VTGGGHTSQIYAIR(+14.02).Q Y 42.14 1472.7736 14 3.2 491.9334 3 60.43 2 26158 AEV_1_3_RA2_01_1232.d 7.58E4 1 1 69 82 Methylation(KR)
R.T(+42.01)LLVADNRR.A Y 41.89 1098.6145 9 -27.0 367.2022 3 37.68 2 14363 AEV_1_3_RA2_01_1232.d 8.1E5 4 4 115 123 Acetylation (N-term)
M.ATTQSVQC(+57.02)FGK.K Y 41.79 1225.5762 11 0.9 613.7959 2 38.88 3 18741 AEV_3_3_RA3_01_1233.d 7.03E5 3 3 2 12 Carbamidomethylation
K.TATAVAQ(+.98)C(+57.02)K.A Y 41.43 949.4539 9 4.8 475.7365 2 15.83 3 5574 AEV_3_3_RA3_01_1233.d 1.28E5 3 3 15 23 Deamidation (NQ); Carbamidomethylation
R.TLLVADNRRAEPK.K Y 41.31 1481.8314 13 -0.9 494.9506 3 37.77 3 18048 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 115 127
K.FAGVDIR.V Y 39.79 776.4180 7 -89.3 389.1816 2 69.11 1 33267 AEV 2_3_RA2_01_1224.d 8.01E5 3 3 60 66
K.QALVQ(+.98)YDR.T Y 39.71 992.4927 8 3.7 497.2555 2 46.98 3 23799 AEV_3_3_RA3_01_1233.d 3.01E5 3 3 107 114 Deamidation (NQ)
R.TLLVADNR(+14.02).R Y 38.62 914.5185 8 -3.0 458.2652 2 54.33 3 28564 AEV_3_3_RA3_01_1233.d 7.48E5 3 3 115 122 Methylation(KR)
M.A(+42.01)TTQSVQC(+57.02)FGKKK.T Y 36.66 1523.7766 13 -2.0 762.8940 2 41.82 3 20550 AEV_3_3_RA3_01_1233.d 2.73E5 2 2 2 14 Acetylation (Protein N-term); Carbamidomethylation
M.A(+42.01)TTQSVQ(+.98)C(+57.02)FGKK.K Y 34.56 1396.6656 12 3.5 699.3425 2 58.25 3 31132 AEV_3_3_RA3_01_1233.d 2.09E5 2 2 2 13 Acetylation (Protein N-term); Deamidation (NQ); Carbamidomethylation
M.A(+42.01)TTQSVQC(+57.02)FGK(+14.02)K.K Y 31.70 1409.6973 12 -1.1 705.8551 2 57.47 3 30569 AEV_3_3_RA3_01_1233.d 8.26E4 1 1 2 13 Acetylation (Protein N-term); Carbamidomethylation; Methylation(KR)
K.AGKGLIK.V Y 31.10 685.4486 7 0.0 343.7316 2 14.87 2 4289 AEV_1_3_RA2_01_1232.d 1.96E5 2 2 24 30
K.GLIKVN(+.98)GQ(+.98)PLALTQPEILR(+14.02).F Y 30.94 2075.1990 19 -51.4 692.7047 3 81.25 2 41549 AEV_1_3_RA2_01_1232.d 5.73E4 1 1 27 45 Deamidation (NQ); Methylation(KR)
M.ATTQSVQC(+57.02)FGK(+14.02).K Y 30.48 1239.5918 11 3.7 620.8055 2 47.81 2 19340 AEV_1_3_RA2_01_1232.d 5.72E4 1 1 2 12 Carbamidomethylation; Methylation(KR)
M.A(+42.01)TTQ(+.98)SVQC(+57.02)FGKK.K Y 29.66 1396.6656 12 -9.3 699.3336 2 57.29 3 30427 AEV_3_3_RA3_01_1233.d 1.45E5 2 2 2 13 Acetylation (Protein N-term); Deamidation (NQ); Carbamidomethylation
K.VNGQPLALTQP(+13.98)EILR.F Y 29.59 1661.9100 15 -78.3 831.8972 2 83.81 1 44846 AEV 2_3_RA2_01_1224.d 3.76E4 1 1 31 45 Proline oxidation to pyroglutamic acid
R.TLLVADN(+.98)RRAEPK(-.98).K Y 26.99 1481.8314 13 1.5 371.4657 4 37.73 3 18025 AEV_3_3_RA3_01_1233.d 5.09E5 2 2 115 127 Deamidation (NQ); Amidation
K.N(+.98)Q(+.98)LKQ(+.98)ALVQYDR.T Y 26.32 1477.7412 12 9.5 493.5923 3 60.03 3 32443 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 103 114 Deamidation (NQ)
M.A(+41.03)TTQSVQC(+57.02)FGKKKTATAVAQC(+57.02)K.A Y 26.08 2453.2520 22 -56.8 614.2854 4 54.88 3 28916 AEV_3_3_RA3_01_1233.d 0 1 1 2 23 Amidination of lysines or N-terminal amines with methyl acetimidate; Carbamidomethylation
K.AGK(+421.07)GLIKVNGQPLALTQPEILR.F Y 25.81 2736.4421 22 14.3 685.1276 4 80.98 3 48830 AEV_3_3_RA3_01_1233.d 6.89E4 1 1 24 45 Fluorescein-5-thiosemicarbazide
M.ATTQ(+.98)SVQC(+57.02)FGK.K Y 25.08 1226.5602 11 1.4 614.2882 2 44.38 3 22193 AEV_3_3_RA3_01_1233.d 1.72E5 2 2 2 12 Deamidation (NQ); Carbamidomethylation
R.VRVTGGGHTSQIYAIR(-.98).Q Y 25.03 1712.9434 16 22.7 429.2528 4 54.33 3 28569 AEV_3_3_RA3_01_1233.d 0 1 1 67 82 Amidation
K.KFGGPGAR(+14.02).A Y 24.85 802.4449 8 -1.8 402.2290 2 19.03 3 7353 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 128 135 Methylation(KR)
K.T(+42.01)ATAVAQC(+57.02)K.A Y 24.02 990.4804 9 5.0 496.2499 2 43.06 3 21326 AEV_3_3_RA3_01_1233.d 6.44E4 1 1 15 23 Acetylation (Protein N-term); Carbamidomethylation
K.Y(+120.03)VDEHAKNQLK.Q Y 23.33 1463.7173 11 8.4 366.9397 4 19.79 3 7713 AEV_3_3_RA3_01_1233.d 0 1 1 96 106 O-Isopropylmethylphosphonylation
R.TLLVADNRR(+14.02)AEPK.K Y 23.16 1495.8470 13 -0.6 499.6227 3 46.36 3 23414 AEV_3_3_RA3_01_1233.d 9.23E4 1 1 115 127 Methylation(KR)
R.Q(+42.01)(+.98)AIAK(+42.01).S Y 22.76 614.3275 5 -2.2 615.3334 1 77.20 2 38334 AEV_1_3_RA2_01_1232.d 0 1 1 83 87 Acetylation (N-term); Deamidation (NQ); Acetylation (K)
K.FGGPGAR(-.98).A Y 22.58 659.3503 7 6.3 660.3617 1 39.99 2 15453 AEV_1_3_RA2_01_1232.d 0 1 1 129 135 Amidation
K.K(+43.99)KTATAVAQC(+57.02)K.A Y 21.65 1248.6497 11 -12.0 417.2188 3 10.40 2 2623 AEV_1_3_RA2_01_1232.d 0 1 1 13 23 Carboxylation (DKW); Carbamidomethylation
K.VNGQPLALTQ(+.98)PEILR.F Y 21.55 1648.9148 15 -18.6 550.6353 3 79.32 2 40019 AEV_1_3_RA2_01_1232.d 0 1 1 31 45 Deamidation (NQ)
K.K(+42.01)TATAVAQC(+57.02)K(+42.01)AGK.G Y 21.07 1416.7395 13 -19.5 355.1852 4 43.01 3 21294 AEV_3_3_RA3_01_1233.d 0 1 1 14 26 Acetylation (Protein N-term); Carbamidomethylation; Acetylation (K)
K.KKTATAVAQ(+.98)C(+57.02)K.A Y 20.69 1205.6438 11 4.9 402.8905 3 11.00 3 3007 AEV_3_3_RA3_01_1233.d 1.25E5 2 2 13 23 Deamidation (NQ); Carbamidomethylation
K.SIVAYYQKYVDEHAKNQLK.Q Y 20.26 2296.1851 19 10.9 575.0598 4 71.44 3 41354 AEV_3_3_RA3_01_1233.d 4.47E4 1 1 88 106
K.KTAT(+79.97)AVAQCKAGKGLIK.V Y 19.94 1766.9478 17 7.0 589.9940 3 83.49 3 50663 AEV_3_3_RA3_01_1233.d 0 1 1 14 30 Phosphorylation (STY)
K.T(+43.01)ATAVAQ(+.98)C(+57.02)K.A Y 19.89 992.4597 9 -57.8 497.2084 2 67.64 1 32145 AEV 2_3_RA2_01_1224.d 7.36E4 1 1 15 23 Carbamylation; Deamidation (NQ); Carbamidomethylation
K.TATAVAQC(+57.02)K(+42.01)AGK.G Y 19.59 1246.6339 12 -69.6 624.2808 2 82.03 1 43428 AEV 2_3_RA2_01_1224.d 2.46E4 1 1 15 26 Carbamidomethylation; Acetylation (K)
K.KTATAVAQ(+.98)CK.A Y 19.33 1020.5273 10 -26.8 511.2573 2 47.99 2 19437 AEV_1_3_RA2_01_1232.d 0 1 1 14 23 Deamidation (NQ)
K.TATAVAQC(+57.02)K(+54.01).A Y 17.37 1002.4804 9 -70.8 335.1438 3 41.12 1 15062 AEV 2_3_RA2_01_1224.d 0 1 1 15 23 Carbamidomethylation; MDA adduct +54
K.K(+14.02)FGGPGARAR.Y Y 17.21 1029.5831 10 2.0 344.2023 3 42.84 3 21181 AEV_3_3_RA3_01_1233.d 1.82E4 1 1 128 137 Methylation(KR)
K.TATAVAQC(+57.02)KAGK(-.98).G Y 17.13 1203.6394 12 41.3 402.2370 3 73.42 2 35436 AEV_1_3_RA2_01_1232.d 1E5 1 1 15 26 Carbamidomethylation; Amidation
R.TLLVADNR(+21.98).R Y 16.33 922.4848 8 75.5 923.5618 1 100.99 1 56040 AEV 2_3_RA2_01_1224.d 0 1 1 115 122 Sodium adduct
K.KFGGPGAR(+31.99)AR.Y Y 15.50 1047.5574 10 -14.4 350.1880 3 40.93 3 19961 AEV_3_3_RA3_01_1233.d 0 1 1 128 137 Dihydroxy
K.T(+42.01)ATAVAQC(+57.02)K(+14.02).A Y 15.43 1004.4961 9 38.9 335.8523 3 18.14 3 6837 AEV_3_3_RA3_01_1233.d 0 1 1 15 23 Acetylation (Protein N-term); Carbamidomethylation; Methylation(KR)
K.VNGQ(+.98)PLALTQPEILRF(+31.99)K.V Y 15.25 1956.0680 17 -17.2 490.0159 4 51.43 3 26658 AEV_3_3_RA3_01_1233.d 2.72E5 1 1 31 47 Deamidation (NQ); Dihydroxy
K.TATAVAQ(+.98)CK.A Y 15.07 892.4324 9 -94.1 447.1815 2 49.86 1 20168 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 15 23 Deamidation (NQ)
total 97 peptides
C1G821
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.LDSQKHIDFALTSPFGGGRPGR.V Y 155.62 2355.2083 22 1.9 589.8105 4 72.06 2 34432 AEV_1_3_RA2_01_1232.d 3.56E6 10 10 148 169
K.HIDFALTSPFGGGRPGR.V Y 135.48 1783.9117 17 0.0 595.6445 3 74.56 2 36332 AEV_1_3_RA2_01_1232.d 3.86E6 13 13 153 169
R.LQTQVYQLGLAK.S Y 121.64 1360.7715 12 2.5 681.3947 2 71.72 2 34127 AEV_1_3_RA2_01_1232.d 1.89E6 5 5 107 118
R.LDSELKIVGTYGLR.N Y 118.67 1562.8667 14 2.2 521.9640 3 75.99 2 37384 AEV_1_3_RA2_01_1232.d 1.99E6 7 7 22 35
R.RLQTQVYQLGLAK.S Y 116.74 1516.8726 13 4.8 506.6339 3 67.55 2 31041 AEV_1_3_RA2_01_1232.d 2.59E6 7 7 106 118
R.MKLDYVLALTVEDFLER.R Y 107.76 2054.0757 17 -1.4 685.6982 3 95.25 3 57332 AEV_3_3_RA3_01_1233.d 5.93E5 5 5 89 105
R.VGKQIVNVPSFVVR.L Y 104.59 1540.9089 14 -1.6 514.6428 3 73.15 3 42758 AEV_3_3_RA3_01_1233.d 1.41E6 6 6 134 147
K.SKAAEKGGEDEEEEDEE Y 100.85 1879.7443 17 3.5 627.5909 3 14.53 3 4853 AEV_3_3_RA3_01_1233.d 5.79E5 5 5 175 191
K.QIVNVPSFVVR.L Y 99.94 1256.7241 11 1.8 629.3705 2 78.56 2 39441 AEV_1_3_RA2_01_1232.d 1.48E6 4 4 137 147
R.MKLDYVLALTVEDFLERR.L Y 98.32 2210.1768 18 -1.5 553.5507 4 92.05 3 55820 AEV_3_3_RA3_01_1233.d 6.91E5 5 5 89 106
R.M(+15.99)KLDYVLALTVEDFLER.R Y 96.71 2070.0706 17 -1.0 691.0301 3 92.14 3 55862 AEV_3_3_RA3_01_1233.d 2.63E5 3 3 89 105 Oxidation (M)
R.MKLDYVLALTVEDFLERRLQTQVYQLGLAK.S Y 92.67 3552.9377 30 5.0 711.5984 5 95.06 3 57250 AEV_3_3_RA3_01_1233.d 2.55E5 2 2 89 118
K.Q(-17.03)IVNVPSFVVR.L Y 89.77 1239.6975 11 1.9 620.8572 2 86.63 2 45425 AEV_1_3_RA2_01_1232.d 2.42E6 3 3 137 147 Pyro-glu from Q
K.HIDFALTSPFGGGRPGR(+14.02).V Y 89.28 1797.9274 17 6.8 450.4922 4 74.27 2 36084 AEV_1_3_RA2_01_1232.d 2.78E5 2 2 153 169 Methylation(KR)
R.M(+15.99)KLDYVLALTVEDFLERR.L Y 84.74 2226.1719 18 -2.3 557.5490 4 89.37 3 54359 AEV_3_3_RA3_01_1233.d 2.04E5 1 1 89 106 Oxidation (M)
K.AAEKGGEDEEEEDEE Y 83.65 1664.6172 15 4.2 833.3193 2 17.91 3 6765 AEV_3_3_RA3_01_1233.d 2.24E6 9 9 177 191
R.LDSQKHIDFALTSPFGGGRPGR(+14.02).V Y 80.86 2369.2239 22 -2.1 593.3120 4 70.77 3 40832 AEV_3_3_RA3_01_1233.d 0 2 2 148 169 Methylation(KR)
R.LDSQ(+.98)KHIDFALTSPFGGGRPGR.V Y 80.49 2356.1924 22 5.4 590.0585 4 71.17 3 41149 AEV_3_3_RA3_01_1233.d 2.41E5 1 1 148 169 Deamidation (NQ)
R.RLQTQVYQLGLAK(+14.02).S Y 79.51 1530.8882 13 -1.8 511.3024 3 68.59 3 39127 AEV_3_3_RA3_01_1233.d 3.51E5 4 4 106 118 Methylation(KR)
R.RLQTQ(+.98)VYQLGLAK.S Y 77.80 1517.8566 13 -0.6 506.9592 3 68.55 3 39086 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 106 118 Deamidation (NQ)
K.RLFEGNALIR.R Y 76.91 1187.6775 10 -6.1 396.8973 3 67.20 3 38013 AEV_3_3_RA3_01_1233.d 1.57E6 7 7 67 76
R.ELLTLDEKDPK.R Y 75.91 1299.6921 11 -1.3 650.8525 2 59.87 3 32324 AEV_3_3_RA3_01_1233.d 3.5E5 5 5 56 66
R.LQTQVYQLGLAK(+14.02).S Y 73.89 1374.7871 12 -26.5 688.3826 2 73.36 3 42863 AEV_3_3_RA3_01_1233.d 0 1 1 107 118 Methylation(KR)
R.LDSELKIVGTYGLR(+14.02).N Y 73.64 1576.8824 14 -1.0 526.6342 3 77.55 3 46144 AEV_3_3_RA3_01_1233.d 7.18E4 1 1 22 35 Methylation(KR)
R.LFEGNALIR.R Y 71.61 1031.5763 9 -4.2 516.7933 2 70.79 3 40847 AEV_3_3_RA3_01_1233.d 3.51E6 6 6 68 76
R.ELLTLDEKDPKR.L Y 69.12 1455.7932 12 3.7 486.2735 3 54.88 2 22937 AEV_1_3_RA2_01_1232.d 2.24E6 10 10 56 67
K.Q(-17.03)IVNVPSFVVR(+14.02).L Y 68.93 1253.7131 11 -1.1 627.8632 2 88.15 3 53680 AEV_3_3_RA3_01_1233.d 5.11E4 1 1 137 147 Pyro-glu from Q; Methylation(KR)
R.LDS(-18.01)QK(+14.02)HIDFALTSPFGGGRPGR.V Y 68.67 2351.2134 22 -21.7 588.7979 4 71.27 3 41223 AEV_3_3_RA3_01_1233.d 0 1 1 148 169 Dehydration; Methylation(KR)
R.MKLDYVLALTVEDFLER(+14.02).R Y 68.20 2068.0913 17 0.7 690.3715 3 96.55 3 57862 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 89 105 Methylation(KR)
K.LDYVLALTVEDFLER.R Y 63.16 1794.9403 15 -9.4 898.4690 2 95.10 3 57271 AEV_3_3_RA3_01_1233.d 1.34E5 3 3 91 105
R.LQTQVYQ(+.98)LGLAK.S Y 62.43 1361.7555 12 0.9 681.8856 2 73.28 2 35327 AEV_1_3_RA2_01_1232.d 2.16E5 2 2 107 118 Deamidation (NQ)
K.AAEKGGEDE(+14.02)EEEDEE Y 61.93 1678.6329 15 0.9 840.3245 2 26.14 3 11216 AEV_3_3_RA3_01_1233.d 1.98E6 1 1 177 191 Methylation(others)
K.IVGTYGLR.N Y 61.14 877.5021 8 -2.3 439.7573 2 56.86 3 30117 AEV_3_3_RA3_01_1233.d 4.03E6 7 7 28 35
K.SKAAEKGGEDEEEEDE(+14.02)E Y 60.71 1893.7599 17 3.1 947.8901 2 20.82 3 8265 AEV_3_3_RA3_01_1233.d 8.88E5 2 2 175 191 Methylation(others)
R.VGVLDESR.M Y 60.32 873.4556 8 -0.2 437.7350 2 41.13 3 20078 AEV_3_3_RA3_01_1233.d 7.87E6 14 14 81 88
K.SKAAEKGGEDEEE(+14.02)EDEE Y 60.13 1893.7599 17 4.1 632.2632 3 21.14 3 8446 AEV_3_3_RA3_01_1233.d 7.69E5 1 1 175 191 Methylation(others)
R.MKLDYVLALTVED(+14.02)FLER.R Y 59.76 2068.0913 17 5.0 690.3745 3 97.52 2 50181 AEV_1_3_RA2_01_1232.d 4.63E4 1 1 89 105 Methylation(others)
K.AAEKGGEDEEEE(+14.02)DEE Y 59.17 1678.6329 15 0.1 840.3238 2 26.56 3 11449 AEV_3_3_RA3_01_1233.d 2.65E6 3 3 177 191 Methylation(others)
R.VQLTLSK.I Y 57.93 787.4803 7 -4.9 788.4838 1 51.50 2 21209 AEV_1_3_RA2_01_1232.d 4.44E6 8 8 43 49
K.AAEKGGEDEEE(+14.02)EDEE Y 57.90 1678.6329 15 -0.8 840.3231 2 26.97 3 11683 AEV_3_3_RA3_01_1233.d 1.98E6 2 2 177 191 Methylation(others)
R.VGVLDESRM(+15.99)KLDYVLALTVEDFLER.R Y 55.98 2925.5156 25 -3.3 732.3838 4 96.21 3 57732 AEV_3_3_RA3_01_1233.d 0 1 1 81 105 Oxidation (M)
R.LDSE(+14.02)LKIVGTYGLR.N Y 55.95 1576.8824 14 -3.1 526.6331 3 78.23 3 46685 AEV_3_3_RA3_01_1233.d 1.34E5 1 1 22 35 Methylation(others)
K.AAEK(+14.02)GGEDEEEEDEE Y 55.73 1678.6329 15 0.8 840.3244 2 25.64 3 11009 AEV_3_3_RA3_01_1233.d 4.74E5 5 5 177 191 Methylation(KR)
K.Q(-17.03)IVNVPSFVVRLDSQK.H Y 55.26 1810.9941 16 -5.2 604.6688 3 86.19 2 45100 AEV_1_3_RA2_01_1232.d 2.25E5 3 3 137 152 Pyro-glu from Q
R.RPYGSAR.L Y 55.10 805.4194 7 1.9 403.7177 2 10.11 3 2589 AEV_3_3_RA3_01_1233.d 4.11E5 3 3 15 21
K.AAEKGGEDEEEEDEE(+14.02) Y 54.97 1678.6329 15 1.9 840.3253 2 27.76 3 12100 AEV_3_3_RA3_01_1233.d 1.92E5 2 2 177 191 Methylation(others)
R.VGVLDESRMKLDYVLALTVEDFLERR.L Y 54.86 3065.6218 26 15.4 614.1411 5 94.00 3 56790 AEV_3_3_RA3_01_1233.d 0 1 1 81 106
K.TYKVPR.R Y 54.86 762.4388 6 -0.9 382.2263 2 18.92 3 7247 AEV_3_3_RA3_01_1233.d 2.13E6 8 8 9 14
R.ELLTLDEKDPKRLFEGNALIR.R Y 53.15 2469.3591 21 -42.6 618.3207 4 78.86 3 47179 AEV_3_3_RA3_01_1233.d 9.39E4 2 2 56 76
K.KSKAAEKGGEDEEEEDEE Y 52.00 2007.8391 18 7.1 670.2917 3 12.24 3 3625 AEV_3_3_RA3_01_1233.d 3.62E4 2 2 174 191
R.LFEGNALIRR.L Y 51.60 1187.6775 10 -16.0 594.8365 2 64.21 3 35663 AEV_3_3_RA3_01_1233.d 9.39E5 4 4 68 77
R.LDSQKHIDFALT(-18.01)SPFGGGRPGR.V Y 51.38 2337.1978 22 3.6 468.4485 5 71.14 3 41125 AEV_3_3_RA3_01_1233.d 1.38E5 1 1 148 169 Dehydration
K.AAEKGGEDEEEE(+28.03)DEE Y 51.06 1692.6486 15 1.6 847.3329 2 35.89 3 16867 AEV_3_3_RA3_01_1233.d 2.67E6 5 5 177 191 Ethylation
K.SKAAEKGGEDEEEEDEE(+14.02) Y 50.64 1893.7599 17 4.5 632.2634 3 21.99 3 8888 AEV_3_3_RA3_01_1233.d 1.97E5 4 4 175 191 Methylation(others)
R.MKLDYVLALTVEDFLER(+14.02)R.L Y 49.79 2224.1926 18 -5.4 557.0524 4 92.90 3 56263 AEV_3_3_RA3_01_1233.d 6.38E3 1 1 89 106 Methylation(KR)
K.AAE(+14.02)KGGEDEEEEDEE Y 49.56 1678.6329 15 1.4 840.3250 2 24.72 3 10421 AEV_3_3_RA3_01_1233.d 3.68E5 1 1 177 191 Methylation(others)
K.HIDFALTSPFGGGRP(+13.98)GR.V Y 49.54 1797.8910 17 -61.9 450.4522 4 83.47 1 44573 AEV 2_3_RA2_01_1224.d 1.49E5 1 1 153 169 Proline oxidation to pyroglutamic acid
K.AAEKGGEDEEEEDEE(+28.03) Y 48.96 1692.6486 15 1.9 847.3331 2 37.51 3 17898 AEV_3_3_RA3_01_1233.d 2.67E6 2 2 177 191 Ethylation
R.EVWRVQLTLSK.I Y 47.59 1357.7717 11 -0.6 453.5976 3 73.11 3 42695 AEV_3_3_RA3_01_1233.d 1.56E5 2 2 39 49
R.LFE(+14.02)GNALIR.R Y 47.39 1045.5920 9 -2.4 523.8021 2 73.89 3 43262 AEV_3_3_RA3_01_1233.d 4.93E5 2 2 68 76 Methylation(others)
R.VGVLDESR(+14.02).M Y 44.39 887.4712 8 -1.0 444.7424 2 49.80 3 25601 AEV_3_3_RA3_01_1233.d 1.87E6 6 6 81 88 Methylation(KR)
R.VGKQIVNVPSFVVRLDSQK.H Y 43.93 2112.2056 19 -3.5 529.0568 4 76.82 2 38040 AEV_1_3_RA2_01_1232.d 3.69E4 1 1 134 152
R.VQ(+.98)LTLSK.I Y 42.94 788.4644 7 -2.3 789.4698 1 51.58 3 26770 AEV_3_3_RA3_01_1233.d 1.55E5 4 4 43 49 Deamidation (NQ)
R.RPYGSAR(+14.02).L Y 42.78 819.4351 7 2.1 410.7257 2 13.39 3 4245 AEV_3_3_RA3_01_1233.d 2.7E5 2 2 15 21 Methylation(KR)
K.SK(+14.02)AAEKGGEDEEEEDEE Y 42.00 1893.7599 17 9.7 632.2667 3 19.97 2 6395 AEV_1_3_RA2_01_1232.d 3.19E5 2 2 175 191 Methylation(KR)
K.AAEK(+229.01)GGEDEEEEDEE Y 41.87 1893.6312 15 -15.9 632.2076 3 32.28 1 10272 AEV 2_3_RA2_01_1224.d 4.79E5 2 2 177 191 Pyridoxal phosphate
K.RLFEGNALIR(+14.02).R Y 41.73 1201.6931 10 -85.8 401.5373 3 83.29 1 44429 AEV 2_3_RA2_01_1224.d 2.34E4 1 1 67 76 Methylation(KR)
K.AAEKGGE(+14.02)DEEEEDEE Y 40.80 1678.6329 15 3.9 840.3270 2 26.22 2 9043 AEV_1_3_RA2_01_1232.d 6.68E5 1 1 177 191 Methylation(others)
K.AAEKGGEDEEE(+28.03)EDEE Y 40.43 1692.6486 15 2.1 847.3334 2 35.07 3 16367 AEV_3_3_RA3_01_1233.d 2.01E6 1 1 177 191 Ethylation
R.VGKQ(+.98)IVNVPSFVVR.L Y 40.31 1541.8929 14 -4.6 514.9692 3 74.59 3 43811 AEV_3_3_RA3_01_1233.d 1.27E5 1 1 134 147 Deamidation (NQ)
K.AAEKGGEDEEEEDE(+28.03)E Y 39.36 1692.6486 15 1.7 847.3330 2 37.10 3 17648 AEV_3_3_RA3_01_1233.d 2.67E6 4 4 177 191 Ethylation
K.HIDFALT(-18.01)SPFGGGR(+14.02)PGR.V Y 39.35 1779.9169 17 13.7 445.9926 4 74.71 2 36402 AEV_1_3_RA2_01_1232.d 8.3E4 2 2 153 169 Dehydration; Methylation(KR)
R.E(+14.02)LLTLDEKDPK.R Y 38.91 1313.7078 11 -7.0 657.8566 2 62.44 3 34307 AEV_3_3_RA3_01_1233.d 2.68E4 1 1 56 66 Methylation(others)
R.LFEGNALIR(+14.02).R Y 38.59 1045.5920 9 -0.4 523.8031 2 74.99 3 44146 AEV_3_3_RA3_01_1233.d 2.25E5 2 2 68 76 Methylation(KR)
R.LFEGN(+.98)ALIR.R Y 38.29 1032.5603 9 -3.6 517.2856 2 73.10 3 42657 AEV_3_3_RA3_01_1233.d 2.12E5 1 1 68 76 Deamidation (NQ)
K.AAEKGGEDEEEED(+14.02)EE Y 37.99 1678.6329 15 4.0 840.3271 2 26.91 2 9329 AEV_1_3_RA2_01_1232.d 6.68E5 1 1 177 191 Methylation(others)
K.AAEKGGEDEEEEDE(+14.02)E Y 37.39 1678.6329 15 3.3 840.3265 2 28.58 3 12576 AEV_3_3_RA3_01_1233.d 2.6E5 3 3 177 191 Methylation(others)
R.VQLTLSK(+14.02).I Y 36.68 801.4960 7 -10.5 401.7511 2 56.39 3 29781 AEV_3_3_RA3_01_1233.d 4.14E5 2 2 43 49 Methylation(KR)
R.ELLTLDEK(+14.02)DPK.R Y 36.46 1313.7078 11 -2.4 657.8596 2 65.64 3 36783 AEV_3_3_RA3_01_1233.d 3.18E4 1 1 56 66 Methylation(KR)
R.VGVLDE(+14.02)SR.M Y 36.31 887.4712 8 0.9 444.7433 2 56.78 3 30054 AEV_3_3_RA3_01_1233.d 9.55E5 2 2 81 88 Methylation(others)
R.ELLTLDE(+14.02)KDPKR.L Y 35.71 1469.8090 12 1.5 368.4601 4 60.64 3 32898 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 56 67 Methylation(others)
K.AAEKGGEDEEEED(+28.03)EE Y 34.98 1692.6486 15 3.1 847.3342 2 38.27 2 14660 AEV_1_3_RA2_01_1232.d 2.67E6 2 2 177 191 Ethylation
K.QIVNVPSFVVRLDSQK.H Y 34.88 1828.0206 16 -20.9 610.3348 3 79.83 2 40451 AEV_1_3_RA2_01_1232.d 7.11E4 1 1 137 152
K.SKAAEKGGE(+14.02)DEEEEDEE Y 34.08 1893.7599 17 2.1 947.8892 2 20.53 3 8104 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 175 191 Methylation(others)
R.LVRVGVLDESR.M Y 34.07 1241.7091 11 9.7 414.9143 3 61.06 3 33235 AEV_3_3_RA3_01_1233.d 8.74E4 1 1 78 88
K.SKAAEKGGEDEEEED(+28.03)EE Y 33.72 1907.7755 17 2.0 636.9337 3 29.54 3 13119 AEV_3_3_RA3_01_1233.d 5.36E5 1 1 175 191 Ethylation
K.Q(+.98)IVNVPSFVVR.L Y 33.70 1257.7081 11 -23.3 629.8467 2 79.43 2 40192 AEV_1_3_RA2_01_1232.d 0 1 1 137 147 Deamidation (NQ)
K.SKAAEK(+14.02)GGEDEEEEDEE Y 32.44 1893.7599 17 2.3 947.8894 2 19.13 3 7370 AEV_3_3_RA3_01_1233.d 2.27E4 1 1 175 191 Methylation(KR)
R.VQLTLSKIR.R Y 32.24 1056.6655 9 -27.0 353.2196 3 61.40 2 26796 AEV_1_3_RA2_01_1232.d 9.77E3 1 1 43 51
R.SYSKTYKVPR.R Y 31.99 1227.6611 10 0.6 307.9227 4 25.54 3 10866 AEV_3_3_RA3_01_1233.d 1.52E5 1 1 5 14
K.AAEK(+214.97)GGEDEEEEDEE Y 31.72 1879.5884 15 -0.8 627.5363 3 25.37 1 6722 AEV 2_3_RA2_01_1224.d 3.91E5 1 1 177 191 4-sulfophenyl isothiocyanate
K.QIVNVPSFVVR(+14.02).L Y 31.72 1270.7397 11 -5.5 636.3737 2 79.96 3 48036 AEV_3_3_RA3_01_1233.d 4.5E4 1 1 137 147 Methylation(KR)
K.QIVNVPSFVVRLDSQKHIDFALTSPFGGGRPGR.V Y 31.38 3593.9219 33 15.6 719.8029 5 82.94 3 50274 AEV_3_3_RA3_01_1233.d 4.4E4 1 1 137 169
K.IVGTYGLR(+14.02).N Y 30.67 891.5178 8 -2.4 446.7651 2 62.82 3 34593 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 28 35 Methylation(KR)
R.VLIKQR.H Y 30.64 755.5017 6 -7.8 378.7552 2 17.16 3 6302 AEV_3_3_RA3_01_1233.d 2.79E5 2 2 125 130
K.SIHHAR.V Y 30.10 719.3827 6 4.7 360.7003 2 7.72 2 1810 AEV_1_3_RA2_01_1232.d 2.24E3 1 1 119 124
K.SKAAEKGGEDEE(+14.02)EEDEE Y 29.90 1893.7599 17 1.3 947.8884 2 21.23 3 8504 AEV_3_3_RA3_01_1233.d 2.85E5 2 2 175 191 Methylation(others)
K.R(+14.02)LFEGNALIR.R Y 29.49 1201.6931 10 -86.7 401.5369 3 81.67 1 43139 AEV 2_3_RA2_01_1224.d 5.17E4 1 1 67 76 Methylation(KR)
K.SKAAEKGGEDEEEEDE(+28.03)E Y 28.92 1907.7755 17 0.5 636.9327 3 29.12 3 12885 AEV_3_3_RA3_01_1233.d 6.51E5 3 3 175 191 Ethylation
K.SK(+14.02)AAEK(+14.02)GGEDEEEEDEE Y 28.50 1907.7755 17 0.9 636.9330 3 26.85 3 11613 AEV_3_3_RA3_01_1233.d 9.8E4 1 1 175 191 Methylation(KR)
R.RPYGSARLDSELK.I Y 28.26 1490.7841 13 2.6 373.7043 4 46.45 3 23466 AEV_3_3_RA3_01_1233.d 3.8E5 2 2 15 27
K.SKAAEKGGEDEEE(+28.03)EDEE Y 27.56 1907.7755 17 3.1 636.9344 3 28.31 3 12416 AEV_3_3_RA3_01_1233.d 6.51E5 3 3 175 191 Ethylation
R.R(+43.01)(+14.02)LQTQVYQLGLAK.S Y 27.51 1573.8940 13 -11.1 525.6328 3 67.37 3 38149 AEV_3_3_RA3_01_1233.d 5.28E4 1 1 106 118 Carbamylation; Methylation(KR)
R.AARELLTLDEKDPK.R Y 27.41 1597.8674 14 2.0 533.6308 3 59.04 2 25258 AEV_1_3_RA2_01_1232.d 3.06E4 1 1 53 66
R.E(+42.01)LLTLDEKDPKR.L Y 27.38 1497.8038 12 -23.7 500.2634 3 54.92 2 22963 AEV_1_3_RA2_01_1232.d 0 1 1 56 67 Acetylation (N-term)
R.VGVLDESR(+28.03).M Y 27.35 901.4869 8 -6.5 451.7478 2 61.78 3 33801 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 81 88 Dimethylation(KR)
R.RLQTQVY(-2.02)QLGLAK.S Y 27.12 1514.8569 13 -71.6 505.9234 3 67.91 2 31302 AEV_1_3_RA2_01_1232.d 1.21E4 1 1 106 118 2-amino-3-oxo-butanoic_acid
K.SKAAEKGGEDEEEE(+28.03)DEE Y 27.00 1907.7755 17 21.7 636.9462 3 27.79 3 12170 AEV_3_3_RA3_01_1233.d 2.39E3 1 1 175 191 Ethylation
K.IVGT(+79.96)YGLR.N Y 26.79 957.4589 8 -8.1 958.4584 1 90.83 3 55172 AEV_3_3_RA3_01_1233.d 2.7E4 1 1 28 35 Sulfation
R.ELLTLDEK.D Y 26.53 959.5175 8 -87.7 480.7239 2 71.66 1 35230 AEV 2_3_RA2_01_1224.d 6.58E4 1 1 56 63
K.RLFEGNALIRR.L Y 25.00 1343.7786 11 0.3 336.9520 4 64.08 2 28610 AEV_1_3_RA2_01_1232.d 1.7E5 2 2 67 77
R.LDSELK.I Y 24.99 703.3752 6 -27.5 352.6852 2 23.74 3 9833 AEV_3_3_RA3_01_1233.d 3.46E5 3 3 22 27
R.LDSQ(+.98)K(+42.01).H Y 24.77 632.3017 5 -2.2 633.3076 1 65.89 3 36977 AEV_3_3_RA3_01_1233.d 0 1 1 148 152 Deamidation (NQ); Acetylation (K)
R.RLQTQVYQLGLAK(-.98).S Y 24.64 1515.8885 13 -29.7 506.2885 3 66.86 3 37789 AEV_3_3_RA3_01_1233.d 2.07E5 1 1 106 118 Amidation
R.E(+14.02)LLTLDEKDPKR.L Y 24.38 1469.8090 12 -8.6 368.4564 4 56.90 3 30161 AEV_3_3_RA3_01_1233.d 2.64E5 1 1 56 67 Methylation(others)
K.QRHIR(+282.05)VGKQIVNVPSFVVR.L Y 24.21 2513.3655 19 0.2 629.3488 4 78.94 2 39719 AEV_1_3_RA2_01_1232.d 0 1 1 129 147 Bis(hydroxphenylglyoxal) arginine
R.MK(-1.03)LDYVLALTVEDFLER.R Y 23.52 2053.0442 17 22.0 685.3704 3 96.60 2 49881 AEV_1_3_RA2_01_1232.d 0 1 1 89 105 Lysine oxidation to aminoadipic semialdehyde
R.R(+14.02)LQT(-18.01)QVYQLGLAK.S Y 23.18 1512.8776 13 -21.7 505.2888 3 67.67 2 31130 AEV_1_3_RA2_01_1232.d 0 1 1 106 118 Methylation(KR); Dehydration
K.Q(-17.03)IVN(+.98)VPSFVVR.L Y 22.87 1240.6815 11 3.4 621.3502 2 87.76 2 46058 AEV_1_3_RA2_01_1232.d 4.08E4 1 1 137 147 Pyro-glu from Q; Deamidation (NQ)
R.MKLDYVLALTVED(+14.02)FLERR.L Y 22.64 2224.1926 18 7.0 557.0593 4 93.45 3 56529 AEV_3_3_RA3_01_1233.d 1.64E5 1 1 89 106 Methylation(others)
R.LD(+45.99)SELKIVGTYGLR.N Y 21.97 1608.8545 14 3.0 537.2937 3 75.57 3 44580 AEV_3_3_RA3_01_1233.d 6.06E4 1 1 22 35 Beta-methylthiolation (ND)
R.LDSQK(+14.02)HIDFALTSPFGGGRPGR.V Y 21.74 2369.2239 22 3.0 474.8535 5 71.81 3 41652 AEV_3_3_RA3_01_1233.d 1.15E5 1 1 148 169 Methylation(KR)
R.ELLT(+79.97)LDEK.D Y 21.55 1039.4839 8 85.4 1040.5800 1 90.68 2 47558 AEV_1_3_RA2_01_1232.d 1.73E4 1 1 56 63 Phosphorylation (STY)
K.AAEK(+28.03)GGEDEEEEDEE Y 21.40 1692.6486 15 1.6 847.3329 2 32.96 3 15123 AEV_3_3_RA3_01_1233.d 4.96E5 1 1 177 191 Dimethylation(KR)
K.D(+42.01)PK(+14.02)RLFEGN(+.98)ALIR.R Y 21.35 1584.8623 13 3.6 397.2243 4 69.65 3 39974 AEV_3_3_RA3_01_1233.d 0 1 1 64 76 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
K.AAEKGGED(+14.02)EEEEDEE Y 20.62 1678.6329 15 5.2 840.3281 2 26.50 2 9158 AEV_1_3_RA2_01_1232.d 6.68E5 1 1 177 191 Methylation(others)
R.NKREVWR.V Y 20.55 986.5410 7 2.2 329.8550 3 15.54 3 5422 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 36 42
R.LFEGNALIR(+79.97)R.L Y 19.01 1267.6438 10 0.0 634.8292 2 71.50 3 41410 AEV_3_3_RA3_01_1233.d 0 1 1 68 77 Phosphorylation (HCDR)
K.HID(-15.99)FALTSPFGGGRPGR.V Y 18.82 1767.9169 17 -16.4 590.3032 3 72.28 3 42011 AEV_3_3_RA3_01_1233.d 5.7E4 1 1 153 169 Deoxy
K.R(+28.03)LFEGNALIR.R Y 18.73 1215.7087 10 -10.7 304.9312 4 48.76 3 24938 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 67 76 Dimethylation(KR)
K.IVGTY(+79.97)GLR(+31.99).N Y 18.42 989.4583 8 15.8 990.4813 1 91.28 2 47842 AEV_1_3_RA2_01_1232.d 2.76E4 1 1 28 35 Phosphorylation (STY); Dihydroxy
K.HIDFALTS(-18.01)PFGGGR(+14.02)PGR.V Y 18.28 1779.9169 17 23.2 594.3267 3 73.45 3 42939 AEV_3_3_RA3_01_1233.d 5.97E3 1 1 153 169 Dehydration; Methylation(KR)
R.LFEGNALIRRLVRVGVLDESR.M Y 18.14 2411.3760 21 12.7 483.2886 5 80.45 3 48417 AEV_3_3_RA3_01_1233.d 9.89E4 1 1 68 88
R.MKLDYVLALTVEDFLER(+.98).R Y 17.40 2055.0598 17 -21.2 1028.5154 2 95.30 3 57376 AEV_3_3_RA3_01_1233.d 0 1 1 89 105 Deamidation (R)
R.RLQT(-2.02)QVYQLGLAK.S Y 17.39 1514.8569 13 -50.4 505.9341 3 68.53 3 39070 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 106 118 2-amino-3-oxo-butanoic_acid
K.AAEKGGED(+28.03)EEEEDEE Y 17.16 1692.6486 15 9.6 847.3397 2 32.63 3 14943 AEV_3_3_RA3_01_1233.d 4.96E5 1 1 177 191 Ethylation
R.LDS(-18.01)ELK.I Y 16.26 685.3646 6 -103.3 686.3011 1 88.94 1 48829 AEV 2_3_RA2_01_1224.d 7.19E4 1 1 22 27 Dehydration
MAPRSYSKT(+79.97)YK.V Y 15.69 1410.6367 11 -27.2 706.3065 2 41.24 3 20155 AEV_3_3_RA3_01_1233.d 2.41E4 1 1 1 11 Phosphorylation (STY)
total 138 peptides
C1GM03
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.GLVANPTAQALDSTHNVAFHR.G Y 167.57 2218.1243 21 2.8 555.5399 4 70.70 2 33393 AEV_1_3_RA2_01_1232.d 1.92E6 5 5 163 183
K.YVETEGIAAFAQGAYSKPSIAIVSSGPSTTALSK.W Y 145.64 3400.7402 34 -1.7 1134.5854 3 82.64 3 50066 AEV_3_3_RA3_01_1233.d 1.93E5 2 2 200 233
R.SLEAADHATSFLEFTGSR.L Y 141.21 1937.9119 18 2.6 646.9796 3 77.83 2 38832 AEV_1_3_RA2_01_1232.d 1.04E6 5 5 388 405
K.YSQHELDELVLDLVK.Y Y 106.00 1799.9304 15 4.8 600.9869 3 86.63 3 52810 AEV_3_3_RA3_01_1233.d 1.81E5 2 2 144 158
R.DIPTTSSSGPFSPK.A Y 105.73 1419.6881 14 3.3 710.8537 2 66.48 2 30285 AEV_1_3_RA2_01_1232.d 1.91E6 7 7 241 254
R.ESELLGGELSASHSRENLVLTAK.F Y 99.27 2439.2605 23 6.4 610.8263 4 72.56 3 42233 AEV_3_3_RA3_01_1233.d 9.79E4 2 2 100 122
K.ASEPSKYFGGEER.I Y 97.90 1455.6630 13 1.2 728.8397 2 43.14 3 21423 AEV_3_3_RA3_01_1233.d 1.61E6 10 10 255 267
R.ESELLGGELSASHSR.E Y 90.28 1570.7587 15 -2.8 786.3844 2 61.81 3 33827 AEV_3_3_RA3_01_1233.d 1.16E5 3 3 100 114
K.GFEYEVGEAAGVK.F Y 87.89 1354.6404 13 -1.3 678.3266 2 68.80 3 39294 AEV_3_3_RA3_01_1233.d 4.89E5 3 3 36 48
K.VAAGNVSSEDIKK.A Y 87.73 1316.6936 13 -1.0 439.9047 3 30.76 3 13879 AEV_3_3_RA3_01_1233.d 1.26E6 5 5 367 379
R.YQPFPGYSDLLEK.F Y 83.78 1555.7559 13 4.3 778.8885 2 80.41 2 40890 AEV_1_3_RA2_01_1232.d 6.34E5 3 3 71 83
R.GLGENLIPC(+57.02)ASSPFR.K Y 83.57 1616.7980 15 -2.2 809.4045 2 80.17 3 48199 AEV_3_3_RA3_01_1233.d 3.08E5 3 3 184 198 Carbamidomethylation
K.ASVSAVGDLHALPFAAEIGLTV Y 82.73 2137.1418 22 0.6 1069.5789 2 90.96 3 55253 AEV_3_3_RA3_01_1233.d 4.77E5 5 5 442 463
R.GLGENLIPC(+57.02)ASSPFRK.Y Y 82.01 1744.8929 16 0.7 582.6387 3 75.37 3 44417 AEV_3_3_RA3_01_1233.d 5.26E5 2 2 184 199 Carbamidomethylation
R.YQPFPGYSDLLEKFAFK.S Y 78.02 2049.0247 17 0.3 684.0157 3 87.40 3 53239 AEV_3_3_RA3_01_1233.d 3.78E5 3 3 71 87
R.TTTLSLVAK.A Y 74.06 932.5543 9 1.1 467.2849 2 60.32 2 26087 AEV_1_3_RA2_01_1232.d 7.03E5 5 5 58 66
R.SLEAADHATSFLE(+14.02)FTGSR.L Y 71.69 1951.9275 18 8.1 651.6550 3 78.51 3 46903 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 388 405 Methylation(others)
R.DIPTTSSSGPFSPK(+14.02).A Y 66.31 1433.7037 14 1.1 717.8599 2 68.23 3 38837 AEV_3_3_RA3_01_1233.d 4.65E5 2 2 241 254 Methylation(KR)
R.YQPFPGYSDLLEKFAFKSTIKR.S Y 62.48 2634.3845 22 6.4 527.8876 5 82.64 3 50051 AEV_3_3_RA3_01_1233.d 7.47E4 1 1 71 92
R.ENLVLTAK.F Y 57.27 886.5123 8 -2.6 887.5173 1 50.15 3 25824 AEV_3_3_RA3_01_1233.d 2.53E5 5 5 115 122
R.SLE(+14.02)AADHATSFLEFTGSR.L Y 55.54 1951.9275 18 -2.6 651.6481 3 78.61 2 39449 AEV_1_3_RA2_01_1232.d 0 1 1 388 405 Methylation(others)
K.ASEPSKYFGGEER(+14.02).I Y 53.28 1469.6786 13 3.3 735.8490 2 51.59 3 26772 AEV_3_3_RA3_01_1233.d 3.11E5 4 4 255 267 Methylation(KR)
R.LVHGGKPLQISDIGQ(+.98)GIEK.V Y 49.37 1989.0895 19 -0.5 498.2794 4 66.67 3 37592 AEV_3_3_RA3_01_1233.d 1.79E5 1 1 406 424 Deamidation (NQ)
R.YQPFPGYSDLLEK(+14.02).F Y 47.12 1569.7715 13 5.3 785.8972 2 81.74 2 41924 AEV_1_3_RA2_01_1232.d 1.15E5 2 2 71 83 Methylation(KR)
K.SIVETIEKVAAGNVSSEDIKK.A Y 43.46 2216.1899 21 22.3 555.0671 4 78.87 3 47187 AEV_3_3_RA3_01_1233.d 8.89E4 1 1 359 379
K.WVGQLC(+57.02)R.D Y 41.24 917.4542 7 -86.2 459.6948 2 64.85 1 30077 AEV 2_3_RA2_01_1224.d 9.72E5 4 4 234 240 Carbamidomethylation
K.FLNSDLPYYAELLVEVISGTK.Y Y 35.25 2370.2358 21 10.1 791.0939 3 97.79 3 58337 AEV_3_3_RA3_01_1233.d 8E4 1 1 123 143
R.YQ(+.98)PFPGYSDLLEKFAFK.S Y 34.63 2050.0088 17 11.4 684.3513 3 87.51 3 53304 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 71 87 Deamidation (NQ)
K.ASVSAVGDLHALPFAAE(+14.02)IGLTV Y 33.14 2151.1575 22 2.5 1076.5887 2 93.22 2 48681 AEV_1_3_RA2_01_1232.d 1.24E5 3 3 442 463 Methylation(others)
R.LVHGGKPLQISDIGQGIEK.V Y 32.96 1988.1055 19 4.8 498.0360 4 67.78 2 31208 AEV_1_3_RA2_01_1232.d 1.04E5 1 1 406 424
K.YSQHELDELVLDLVK(-.98).Y Y 31.07 1798.9464 15 -9.1 600.6506 3 86.83 2 45509 AEV_1_3_RA2_01_1232.d 2.04E5 1 1 144 158 Amidation
K.SIVETIEK.V Y 30.72 917.5070 8 -89.2 459.7198 2 65.90 1 30790 AEV 2_3_RA2_01_1224.d 9.08E5 2 2 359 366
K.YFGGEER.I Y 30.59 856.3715 7 -76.8 429.1601 2 41.76 1 15418 AEV 2_3_RA2_01_1224.d 3.28E5 1 1 261 267
K.GFE(+14.02)YEVGEAAGVK.F Y 28.96 1368.6561 13 22.7 685.3509 2 72.30 2 34581 AEV_1_3_RA2_01_1232.d 1.65E5 1 1 36 48 Methylation(others)
K.SLLSGK.A Y 28.94 603.3591 6 -14.5 604.3577 1 27.62 2 9650 AEV_1_3_RA2_01_1232.d 0 2 2 436 441
K.VAAGNVSSEDIK.K Y 28.89 1188.5986 12 -15.2 595.2975 2 40.91 3 19947 AEV_3_3_RA3_01_1233.d 2.38E5 2 2 367 378
K.FRSLEAADHATSFLEFTGSR.L Y 28.13 2241.0813 20 -80.9 561.2323 4 85.40 1 46101 AEV 2_3_RA2_01_1224.d 1.08E5 1 1 386 405
R.RGMAAAANKGFEYEVGEAAGVK.F Y 27.68 2225.0898 22 -3.3 742.7014 3 80.21 3 48231 AEV_3_3_RA3_01_1233.d 0 2 2 27 48
R.GTSLLAK.A Y 27.05 688.4119 7 -7.3 689.4142 1 28.36 3 12449 AEV_3_3_RA3_01_1233.d 7.02E4 2 2 313 319
K.FANREVAGR.T Y 26.84 1018.5308 9 2.1 510.2737 2 20.39 3 8027 AEV_3_3_RA3_01_1233.d 2.98E5 2 2 49 57
R.EVAGR(+14.02).T Y 26.35 544.2969 5 -15.6 545.2957 1 20.41 3 8042 AEV_3_3_RA3_01_1233.d 0 1 1 53 57 Methylation(KR)
K.Q(+42.01)CIAQPSTR.R Y 24.25 1044.5022 9 -45.6 349.1588 3 29.42 1 8678 AEV 2_3_RA2_01_1224.d 2.34E5 1 1 18 26 Acetylation (Protein N-term)
R.G(+42.01)MAAAANK(+14.02).G Y 24.23 788.3851 8 54.6 789.4354 1 100.69 1 55938 AEV 2_3_RA2_01_1224.d 0 1 1 28 35 Acetylation (N-term); Methylation(KR)
K.V(+42.01)AAGNVSSEDIKK.A Y 23.88 1358.7041 13 -37.6 453.8916 3 31.02 3 13984 AEV_3_3_RA3_01_1233.d 0 1 1 367 379 Acetylation (N-term)
R.EVAGR(+39.99).T Y 23.47 570.2761 5 -40.2 571.2605 1 84.30 1 45217 AEV 2_3_RA2_01_1224.d 7.32E4 2 2 53 57 Glyoxal-derived hydroimiadazolone
R.RGMAAAANK.G Y 22.68 888.4600 9 -4.0 445.2355 2 38.90 3 18751 AEV_3_3_RA3_01_1233.d 3.66E5 1 1 27 35
K.F(+42.01)ANREVAGR.T Y 22.12 1060.5414 9 -89.0 531.2308 2 49.83 1 20147 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 49 57 Acetylation (N-term)
R.GM(+15.99)AAAANK.G Y 21.45 748.3538 8 -76.4 749.3038 1 107.76 1 58114 AEV 2_3_RA2_01_1224.d 3.88E5 1 1 28 35 Oxidation (M)
R.GLGE(+14.02)NLIPC(+57.02)ASSPFR.K Y 20.85 1630.8137 15 -0.5 816.4138 2 81.64 3 49320 AEV_3_3_RA3_01_1233.d 8.05E4 1 1 184 198 Methylation(others); Carbamidomethylation
R.EVAGR.T Y 20.80 530.2812 5 -12.0 531.2822 1 45.14 2 18007 AEV_1_3_RA2_01_1232.d 5.26E4 1 1 53 57
K.YSQK(+233.05)GLVANPTAQALDSTHNVAFHR.G Y 20.73 2957.4243 25 -15.5 740.3519 4 69.96 3 40194 AEV_3_3_RA3_01_1233.d 0 1 1 159 183 5-dimethylaminonaphthalene-1-sulfonyl
R.RGM(+15.99)AAAANK.G Y 20.72 904.4548 9 27.4 453.2471 2 45.00 3 22561 AEV_3_3_RA3_01_1233.d 0 1 1 27 35 Oxidation (M)
K.VAAGNVSS(+79.97)E(+21.98)DIK.K Y 20.66 1290.5469 12 27.8 431.2015 3 69.06 1 33231 AEV 2_3_RA2_01_1224.d 1.09E5 1 1 367 378 Phosphorylation (STY); Sodium adduct
R.G(+210.20)MAAAANK.G Y 20.34 942.5572 8 21.8 315.1999 3 32.16 3 14669 AEV_3_3_RA3_01_1233.d 0 1 1 28 35 Myristoylation
R.KQC(+57.02)IAQ(+.98)PSTR(+21.98).R Y 20.18 1210.5740 10 17.9 606.3051 2 32.98 2 12111 AEV_1_3_RA2_01_1232.d 6.19E4 1 1 17 26 Carbamidomethylation; Deamidation (NQ); Sodium adduct
K.GLVANPTAQALDSTHN(+.98)VAFHR.G Y 19.74 2219.1084 21 7.3 555.7885 4 71.97 2 34324 AEV_1_3_RA2_01_1232.d 1.47E5 1 1 163 183 Deamidation (NQ)
K.AQSVAAASK(+226.08).S Y 19.29 1057.5226 9 -37.1 529.7490 2 55.79 1 23691 AEV 2_3_RA2_01_1224.d 1.7E6 1 1 350 358 Biotinylation
K.QC(+57.02)IAQ(+.98)PS(+79.97)TR.R Y 19.16 1140.4635 9 53.1 381.1819 3 50.10 1 20302 AEV 2_3_RA2_01_1224.d 8.59E4 1 1 18 26 Carbamidomethylation; Deamidation (NQ); Phosphorylation (STY)
K.A(+42.01)Q(+.98)SVAAAS(+79.97)K.S Y 18.99 954.4059 9 -26.7 955.3876 1 95.86 1 53693 AEV 2_3_RA2_01_1224.d 0 1 1 350 358 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
R.E(+43.01)VAGR.T Y 18.65 573.2870 5 -93.5 574.2407 1 74.66 1 37597 AEV 2_3_RA2_01_1224.d 0 1 1 53 57 Carbamylation
R.G(+42.01)MAAAANK(+21.98).G Y 18.45 796.3514 8 -43.9 399.1655 2 40.81 1 14892 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 28 35 Acetylation (N-term); Sodium adduct
R.EVAGR(-.98).T Y 18.18 529.2972 5 -28.6 530.2894 1 51.80 3 26912 AEV_3_3_RA3_01_1233.d 8.96E4 1 1 53 57 Amidation
K.WSRGTSLLAK(+226.08).A Y 17.93 1343.7019 10 -10.8 336.9291 4 21.44 2 7017 AEV_1_3_RA2_01_1232.d 2.13E5 1 1 310 319 Biotinylation
K.VAAGNVSS(+79.97)ED(+21.98)IK.K Y 17.67 1290.5469 12 -39.3 646.2554 2 68.53 1 32843 AEV 2_3_RA2_01_1224.d 0 1 1 367 378 Phosphorylation (STY); Sodium adduct
K.K(+226.08)ASALAK(+42.01).F Y 17.47 955.5161 7 26.7 319.5211 3 36.42 2 13733 AEV_1_3_RA2_01_1232.d 6.58E4 1 1 379 385 Biotinylation; Acetylation (K)
R.T(+79.97)TTLSLVAK(+226.08).A Y 17.42 1238.5981 9 13.9 620.3149 2 71.41 3 41403 AEV_3_3_RA3_01_1233.d 0 1 1 58 66 Phosphorylation (STY); Biotinylation
K.GFEY(+79.97)EVGEAAGVK.F Y 17.06 1434.6068 13 4.1 479.2115 3 46.29 1 18043 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 36 48 Phosphorylation (STY)
K.VAAGN(+.98)VSSEDIK.K Y 16.99 1189.5826 12 -18.4 595.7877 2 30.81 2 11083 AEV_1_3_RA2_01_1232.d 1.8E4 1 1 367 378 Deamidation (NQ)
R.DIPTTSSSGPFSPK(+42.01).A Y 16.93 1461.6987 14 -47.2 488.2172 3 81.32 1 42876 AEV 2_3_RA2_01_1224.d 8.2E4 1 1 241 254 Acetylation (K)
K.AQSVAAAS(+79.97)KSIVETIEK(+28.03).V Y 16.83 1838.9390 17 19.2 368.8021 5 31.50 2 11410 AEV_1_3_RA2_01_1232.d 0 1 1 350 366 Phosphorylation (STY); Dimethylation(KR)
K.A(+43.01)QSVAAAS(+79.97)K.S Y 16.82 954.4171 9 32.1 478.2311 2 19.04 3 7322 AEV_3_3_RA3_01_1233.d 0 1 1 350 358 Carbamylation; Phosphorylation (STY)
R.GMAAAAN(-17.03)K.G Y 16.81 715.3323 8 16.5 716.3514 1 56.24 3 29686 AEV_3_3_RA3_01_1233.d 0 1 1 28 35 Ammonia-loss (N)
R.E(+42.01)VAGR(-.98).T Y 16.66 571.3078 5 -22.6 572.3022 1 69.37 2 32378 AEV_1_3_RA2_01_1232.d 0 1 1 53 57 Acetylation (N-term); Amidation
R.E(+43.99)VAGR.T Y 16.11 574.2711 5 9.8 575.2839 1 24.24 3 10143 AEV_3_3_RA3_01_1233.d 7.62E4 1 1 53 57 Carboxylation (E)
R.R(+31.99)GMAAAANK.G Y 16.05 920.4498 9 14.2 461.2387 2 54.44 2 22757 AEV_1_3_RA2_01_1232.d 0 1 1 27 35 Dihydroxy
K.A(+27.99)GSRYQPFPGYS(+79.97)DLLEK.F Y 15.96 2034.9087 17 -42.8 679.2811 3 71.53 1 35142 AEV 2_3_RA2_01_1224.d 1.9E5 1 1 67 83 Formylation; Phosphorylation (STY)
K.AQSVAAASKSIVE(+21.98)TIEK.V Y 15.93 1752.9233 17 -19.4 585.3037 3 79.45 3 47639 AEV_3_3_RA3_01_1233.d 4.5E4 1 1 350 366 Sodium adduct
K.WVGQ(+.98)LCR.D Y 15.77 861.4167 7 0.9 431.7160 2 8.70 2 2063 AEV_1_3_RA2_01_1232.d 3.86E4 1 1 234 240 Deamidation (NQ)
R.S(+42.01)AFGRNAPR.C Y 15.74 1016.5151 9 20.5 509.2753 2 19.86 3 7760 AEV_3_3_RA3_01_1233.d 4.02E3 1 1 5 13 Acetylation (Protein N-term)
K.S(+27.99)IVETIEK.V Y 15.64 945.5018 8 2.7 316.1754 3 56.25 1 23985 AEV 2_3_RA2_01_1224.d 7.6E5 1 1 359 366 Formylation
K.YFGGEER(-.98).I Y 15.54 855.3875 7 -25.7 428.6900 2 24.96 1 6533 AEV 2_3_RA2_01_1224.d 6.63E4 1 1 261 267 Amidation
K.Y(+42.01)(+162.05)FGGEER.I Y 15.21 1060.4348 7 -33.2 354.4738 3 33.22 1 10754 AEV 2_3_RA2_01_1224.d 3.14E6 1 1 261 267 Acetylation (N-term); Hexose (NSY)
total 82 peptides
C1GLI2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.SINPDEAVAYGAAVQAAILSGDTTSK.S Y 150.43 2548.2656 26 1.1 850.4301 3 87.95 2 46202 AEV_1_3_RA2_01_1232.d 6.99E5 5 5 360 385
R.IINEPTAAAIAYGLDKK.A Y 109.70 1786.9828 17 2.4 596.6696 3 74.90 2 36606 AEV_1_3_RA2_01_1232.d 6.77E5 5 5 170 186
R.IINEPTAAAIAYGLDKKAEGER.N Y 109.15 2329.2278 22 -2.7 583.3126 4 74.24 3 43538 AEV_3_3_RA3_01_1233.d 4.12E5 2 2 170 191
K.STAGDTHLGGEDFDNR.L Y 107.31 1690.7183 16 4.1 846.3699 2 51.75 2 21333 AEV_1_3_RA2_01_1232.d 1.54E6 8 8 219 234
K.STNEILLLDVAPLSVGIETAGGVMTPLIKR.N Y 105.83 3106.7312 30 3.9 1036.5884 3 93.59 3 56597 AEV_3_3_RA3_01_1233.d 2.22E5 2 2 386 415
K.NQVAMNPSNTVFDAKR.L Y 104.56 1790.8733 16 6.5 597.9689 3 63.39 2 28147 AEV_1_3_RA2_01_1232.d 2.74E5 2 2 55 70
R.TLSSAAQTSIEIDSLYEGIDFYTSITR.A Y 104.49 2980.4553 27 4.2 1491.2412 2 93.60 3 56606 AEV_3_3_RA3_01_1233.d 2.4E5 4 4 271 297
K.SINPDEAVAYGAAVQ(+.98)AAILSGDTTSK.S Y 102.20 2549.2495 26 8.9 850.7647 3 88.13 2 46260 AEV_1_3_RA2_01_1232.d 2.51E5 3 3 360 385 Deamidation (NQ)
K.FYGAGGEGGAPGAGFPGAGGPGGFPGAGASGAHSGGDDGPTVEEVD Y 101.67 3973.7051 46 1.9 1325.5781 3 80.89 2 41289 AEV_1_3_RA2_01_1232.d 4.89E5 2 2 609 654
K.NQVAM(+15.99)NPSNTVFDAKR.L Y 100.05 1806.8683 16 -0.7 603.2963 3 54.50 3 28679 AEV_3_3_RA3_01_1233.d 3.22E5 3 3 55 70 Oxidation (M)
R.IINEPTAAAIAYGLDK.K Y 99.63 1658.8879 16 -10.7 830.4424 2 78.76 2 39589 AEV_1_3_RA2_01_1232.d 5.5E5 3 3 170 185
R.ARFEELC(+57.02)QDLFR.S Y 95.13 1582.7561 12 0.7 528.5930 3 78.04 2 39051 AEV_1_3_RA2_01_1232.d 1.12E6 7 7 298 309 Carbamidomethylation
K.KSETFSTFADNQPGVLIQVFEGER.A Y 94.21 2698.3237 24 1.5 900.4499 3 85.61 2 44728 AEV_1_3_RA2_01_1232.d 2.32E5 3 3 423 446
K.M(+15.99)RETAESYLGGTVNNAVVTVPAYFNDSQR.Q Y 89.72 3204.5146 29 -1.1 1069.1776 3 81.06 3 48885 AEV_3_3_RA3_01_1233.d 9.12E4 2 2 125 153 Oxidation (M)
K.MRETAESYLGGTVNNAVVTVPAYFNDSQR.Q Y 89.07 3188.5195 29 4.5 1063.8519 3 81.77 2 41946 AEV_1_3_RA2_01_1232.d 1.8E5 1 1 125 153
R.FEELC(+57.02)QDLFR.S Y 88.96 1355.6179 10 0.0 678.8162 2 78.45 3 46861 AEV_3_3_RA3_01_1233.d 1.01E5 2 2 300 309 Carbamidomethylation
K.DNNLLGKFELTGIPPAPR.G N 86.63 1951.0526 18 5.1 651.3615 3 82.96 2 42847 AEV_1_3_RA2_01_1232.d 8.17E5 10 10 451 468
K.DAGLIAGLNVLR.I Y 85.97 1210.7034 12 1.4 606.3598 2 83.39 2 43158 AEV_1_3_RA2_01_1232.d 1.13E6 7 7 158 169
K.IDKSSVHEIVLVGGSTR.I Y 85.26 1795.9791 17 -3.1 599.6651 3 63.65 3 35238 AEV_3_3_RA3_01_1233.d 1.63E5 3 3 324 340
R.TTPSFVAFTDTERLIGDAAK.N Y 83.55 2139.0847 20 -2.4 1070.5471 2 82.77 3 50146 AEV_3_3_RA3_01_1233.d 3.87E5 4 4 35 54
R.TTPSFVAFTDTER.L Y 83.40 1470.6991 13 2.8 736.3589 2 74.45 3 43725 AEV_3_3_RA3_01_1233.d 1.61E6 5 5 35 47
R.QATKDAGLIAGLNVLR.I Y 82.83 1638.9417 16 0.9 547.3217 3 76.98 2 38160 AEV_1_3_RA2_01_1232.d 2.28E5 2 2 154 169
K.NQVAM(+15.99)NPSNTVFDAK.R Y 81.40 1650.7672 15 -0.2 826.3907 2 60.53 3 32812 AEV_3_3_RA3_01_1233.d 2.16E5 2 2 55 69 Oxidation (M)
R.Q(-17.03)ATKDAGLIAGLNVLR.I Y 80.28 1621.9152 16 1.5 811.9661 2 82.13 3 49689 AEV_3_3_RA3_01_1233.d 4.41E5 4 4 154 169 Pyro-glu from Q
K.FYGAGGEGGAPGAGFPGAGGPGGFPGAGASGAHSGGDDGPTVEE(+14.02)VD Y 79.39 3987.7207 46 0.2 1330.2478 3 81.81 3 49455 AEV_3_3_RA3_01_1233.d 9.92E4 1 1 609 654 Methylation(others)
K.NQVAMNPSNTVFDAK.R Y 78.98 1634.7722 15 -2.0 818.3918 2 67.39 3 38168 AEV_3_3_RA3_01_1233.d 3.11E5 3 3 55 69
K.SSVHEIVLVGGSTR.I Y 77.84 1439.7732 14 -1.5 720.8928 2 60.53 3 32815 AEV_3_3_RA3_01_1233.d 3.65E5 4 4 327 340
R.AR(+14.02)FEELC(+57.02)QDLFR.S Y 76.66 1596.7719 12 0.9 533.2650 3 78.91 2 39694 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 298 309 Methylation(KR); Carbamidomethylation
K.STAGDTHLGGEDFDNRLVNHFVNEFK.R Y 74.97 2918.3584 26 2.4 584.6804 5 79.89 2 40470 AEV_1_3_RA2_01_1232.d 1.93E5 1 1 219 244
K.LVSDFFNGKEPNK.S Y 70.38 1493.7513 13 1.8 498.9253 3 65.44 3 36630 AEV_3_3_RA3_01_1233.d 9.08E5 3 3 347 359
K.LVSDFFN(+.98)GKEPNK.S Y 68.23 1494.7354 13 6.8 499.2558 3 67.02 2 30666 AEV_1_3_RA2_01_1232.d 2.93E5 2 2 347 359 Deamidation (NQ)
K.FADPEVQSDMKHFPFK.V Y 67.71 1921.9032 16 1.4 481.4838 4 73.34 2 35422 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 76 91
K.NGLESYAYSLR.N Y 67.08 1271.6146 11 -1.0 636.8140 2 72.34 3 42067 AEV_3_3_RA3_01_1233.d 5.22E5 3 3 539 549
R.NTISDSKVDEKLDASDKEK.L Y 66.21 2121.0437 19 2.2 708.0234 3 39.81 3 19293 AEV_3_3_RA3_01_1233.d 1.51E5 2 2 550 568
R.LIGDAAKNQVAMNPSNTVFDAKR.L Y 58.93 2459.2590 23 -1.3 615.8212 4 69.67 2 32604 AEV_1_3_RA2_01_1232.d 0 1 1 48 70
R.TKDNNLLGKFELTGIPPAPR.G Y 58.79 2180.1953 20 -7.0 546.0523 4 78.71 2 39531 AEV_1_3_RA2_01_1232.d 9.05E5 6 6 449 468
R.ARFEELC(+57.02)QDLFR(+14.02).S Y 54.24 1596.7719 12 9.9 533.2698 3 79.73 2 40347 AEV_1_3_RA2_01_1232.d 3.58E4 1 1 298 309 Carbamidomethylation; Methylation(KR)
R.STM(+15.99)DPVER.V Y 53.26 949.4175 8 -86.6 475.6749 2 28.10 1 8024 AEV 2_3_RA2_01_1224.d 5.26E5 5 5 310 317 Oxidation (M)
K.AGKPVISVEFKGEEK.Q Y 52.54 1616.8773 15 -3.7 405.2251 4 55.96 3 29532 AEV_3_3_RA3_01_1233.d 2.74E5 2 2 96 110
R.IINEPTAAAIAYGLDK(+14.02).K Y 51.76 1672.9036 16 -19.9 837.4424 2 81.44 2 41699 AEV_1_3_RA2_01_1232.d 0 1 1 170 185 Methylation(KR)
K.SETFSTFADNQPGVLIQVFEGER.A Y 51.33 2570.2288 23 23.5 857.7703 3 89.57 3 54479 AEV_3_3_RA3_01_1233.d 0 1 1 424 446
K.N(+.98)GLESYAYSLR.N Y 51.26 1272.5986 11 -1.7 637.3055 2 78.34 3 46774 AEV_3_3_RA3_01_1233.d 1.21E5 1 1 539 549 Deamidation (NQ)
K.Q(-17.03)FTPEEISSMVLTK.M Y 50.04 1591.7804 14 7.9 796.9037 2 90.81 2 47623 AEV_1_3_RA2_01_1232.d 1.26E5 1 1 111 124 Pyro-glu from Q
K.SETFST(-2.02)FADNQPGVLIQVFEGER.A Y 48.89 2568.2131 23 18.9 1285.1381 2 89.57 2 47019 AEV_1_3_RA2_01_1232.d 0 1 1 424 446 2-amino-3-oxo-butanoic_acid
R.ETAESYLGGTVNNAVVTVPAYFNDSQR.Q Y 46.82 2901.3779 27 -1.0 968.1323 3 84.34 3 51258 AEV_3_3_RA3_01_1233.d 2.93E4 1 1 127 153
R.TTPSFVAFTDTER(+14.02).L Y 46.76 1484.7147 13 4.2 743.3677 2 75.91 3 44846 AEV_3_3_RA3_01_1233.d 2.98E5 2 2 35 47 Methylation(KR)
K.SETFSTFADNQPGVLIQVFEGERAR.T Y 45.63 2797.3669 25 -4.1 933.4591 3 86.08 3 52427 AEV_3_3_RA3_01_1233.d 1.64E5 1 1 424 448
K.MRETAESYLGGTVNNAVVT(-2.02)VPAYFNDSQR.Q Y 44.79 3186.5039 29 15.2 1063.1914 3 81.50 3 49211 AEV_3_3_RA3_01_1233.d 3.17E4 1 1 125 153 2-amino-3-oxo-butanoic_acid
K.ST(-2.02)AGDTHLGGEDFDNRLVNHFVNEFK.R Y 44.71 2916.3425 26 59.4 584.3104 5 79.90 2 40480 AEV_1_3_RA2_01_1232.d 0 1 1 219 244 2-amino-3-oxo-butanoic_acid
K.DAGLIAGLNVLR(+14.02).I Y 44.48 1224.7190 12 2.3 613.3682 2 85.28 2 44503 AEV_1_3_RA2_01_1232.d 3.74E4 1 1 158 169 Methylation(KR)
K.ELESVANPIMMK.F Y 43.23 1360.6731 12 4.5 681.3469 2 73.92 2 35822 AEV_1_3_RA2_01_1232.d 4.07E4 1 1 597 608
K.SINPD(+14.02)EAVAYGAAVQAAILSGDTTSK.S Y 42.06 2562.2812 26 18.6 855.1169 3 88.83 3 54070 AEV_3_3_RA3_01_1233.d 0 1 1 360 385 Methylation(others)
R.MLAEAEKYKAEDEAEASR.I Y 39.31 2039.9469 18 0.2 680.9897 3 54.97 3 28958 AEV_3_3_RA3_01_1233.d 7.2E4 1 1 517 534
R.NTTIPTKK.S N 38.81 901.5233 8 -7.7 451.7654 2 13.35 2 3721 AEV_1_3_RA2_01_1232.d 7.7E4 2 2 416 423
R.LRTAC(+57.02)ER.A N 36.66 904.4549 7 4.9 453.2369 2 11.28 2 2944 AEV_1_3_RA2_01_1232.d 9.04E4 2 2 261 267 Carbamidomethylation
K.N(+43.01)QVAM(+15.99)NPSNTVFDAKR.L Y 35.67 1849.8740 16 10.9 463.4808 4 40.51 3 19703 AEV_3_3_RA3_01_1233.d 1.02E6 1 1 55 70 Carbamylation; Oxidation (M)
K.QFTPEEISSMVLTK.M Y 32.82 1608.8069 14 -5.3 805.4064 2 82.17 3 49717 AEV_3_3_RA3_01_1233.d 2.62E5 3 3 111 124
K.SETFSTFADN(+.98)Q(+.98)PGVLIQVFEGER.A Y 30.57 2572.1968 23 49.5 858.4487 3 89.51 3 54446 AEV_3_3_RA3_01_1233.d 0 1 1 424 446 Deamidation (NQ)
K.LVSDFFNGKEPNKSINPDEAVAYGAAVQAAILSGDTTSK.S Y 30.47 4024.0063 39 1.7 1007.0106 4 87.00 2 45619 AEV_1_3_RA2_01_1232.d 0 1 1 347 385
K.STNEILLLDVAPLS(-2.02)VGIETAGGVMTPLIKR.N Y 29.17 3104.7156 30 -11.6 1035.9005 3 93.97 2 48962 AEV_1_3_RA2_01_1232.d 2.91E3 1 1 386 415 2-amino-3-oxo-butanoic_acid
K.HKKDLSSNARALR.R Y 28.46 1494.8379 13 -6.3 299.9730 5 12.87 3 3972 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 247 259
K.LDAS(-18.01)DK.E Y 27.57 629.3020 6 18.2 630.3207 1 87.59 3 53357 AEV_3_3_RA3_01_1233.d 4.72E4 1 1 561 566 Dehydration
K.IVITNDKGR.L Y 26.47 1014.5822 9 -37.3 508.2794 2 21.26 3 8554 AEV_3_3_RA3_01_1233.d 5.89E5 4 4 500 508
R.STM(-48.00)DPVER.V Y 26.25 885.4192 8 6.8 443.7199 2 11.49 2 3030 AEV_1_3_RA2_01_1232.d 4.75E5 3 3 310 317 Dethiomethyl
R.IINEPTAAAIAYGLDK(+14.02)K.A Y 26.11 1800.9985 17 -28.7 601.3229 3 76.05 2 37434 AEV_1_3_RA2_01_1232.d 9.5E4 2 2 170 186 Methylation(KR)
K.SETFSTFADNQPGVLIQVFEGER(+14.02).A Y 26.11 2584.2444 23 2.8 862.4245 3 91.17 2 47789 AEV_1_3_RA2_01_1232.d 1.94E5 3 3 424 446 Methylation(KR)
R.AR(+14.02)FEELC(+57.02)Q(+.98)DLFR.S Y 25.48 1597.7559 12 -6.3 533.5892 3 78.32 3 46753 AEV_3_3_RA3_01_1233.d 0 1 1 298 309 Methylation(KR); Carbamidomethylation; Deamidation (NQ)
K.LDASDK(+31.99).E Y 25.19 679.3024 6 17.4 680.3215 1 51.23 3 26523 AEV_3_3_RA3_01_1233.d 6.52E4 1 1 561 566 Dihydroxy
R.ETAESYLGGT(-2.02)VNNAVVTVPAYFNDSQR.Q Y 24.13 2899.3623 27 9.6 967.4707 3 84.41 2 43908 AEV_1_3_RA2_01_1232.d 0 1 1 127 153 2-amino-3-oxo-butanoic_acid
R.IIN(+203.08)EPTAAAIAYGLDK.K Y 23.34 1861.9673 16 20.7 466.5087 4 61.41 2 26799 AEV_1_3_RA2_01_1232.d 7.77E4 1 1 170 185 HexNAcylation (N)
R.I(+226.08)INEPTAAAIAYGLDK.K Y 23.24 1884.9655 16 -11.9 472.2430 4 44.26 3 22091 AEV_3_3_RA3_01_1233.d 2.47E5 1 1 170 185 Biotinylation
R.NTISDSK(+14.02)VDEK(+14.02)LDASDKEK.L Y 22.54 2149.0750 19 0.9 538.2765 4 61.14 2 26623 AEV_1_3_RA2_01_1232.d 4.66E4 1 1 550 568 Methylation(KR)
K.EEIER.M N 22.54 674.3235 5 41.0 338.1828 2 25.22 3 10693 AEV_3_3_RA3_01_1233.d 0 2 2 512 516
K.TEIDK(+14.02).T N 22.49 618.3224 5 -119.0 619.2562 1 77.11 1 39538 AEV 2_3_RA2_01_1224.d 0 1 1 571 575 Methylation(KR)
K.FELTGIPPAPR.G N 22.47 1196.6553 11 -21.4 599.3221 2 75.70 2 37221 AEV_1_3_RA2_01_1232.d 2.16E4 3 3 458 468
R.M(+42.01)LAEAEK(+42.01).Y Y 21.86 874.4106 7 -62.1 875.3636 1 66.82 1 31498 AEV 2_3_RA2_01_1224.d 0 1 1 517 523 Acetylation (N-term); Acetylation (K)
K.GTGKT(-18.01)NK.I Y 21.81 686.3712 7 -5.7 687.3745 1 106.68 1 57801 AEV 2_3_RA2_01_1224.d 5.15E5 1 1 493 499 Dehydration
K.F(+42.01)ELT(-18.01)GIPPAPR.G N 21.80 1220.6553 11 1.7 611.3359 2 39.68 2 15317 AEV_1_3_RA2_01_1232.d 0 1 1 458 468 Acetylation (N-term); Dehydration
R.L(+43.01)VNHFVNEFKR.K Y 21.20 1444.7574 11 -14.1 362.1915 4 73.82 1 36999 AEV 2_3_RA2_01_1224.d 5.34E5 1 1 235 245 Carbamylation
K.T(-18.01)EIDK.T N 21.06 586.2962 5 4.8 587.3063 1 62.53 3 34373 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 571 575 Dehydration
K.LDASD(-18.01)K.E Y 20.80 629.3020 6 2.6 630.3109 1 31.75 3 14426 AEV_3_3_RA3_01_1233.d 6.51E4 1 1 561 566 Dehydration
K.TEIDK.T N 20.43 604.3068 5 -9.5 605.3083 1 73.62 3 43060 AEV_3_3_RA3_01_1233.d 1.52E5 2 2 571 575
R.STMDPVER.V Y 20.25 933.4225 8 1.9 467.7194 2 35.52 2 13326 AEV_1_3_RA2_01_1232.d 1.15E5 1 1 310 317
K.AEDEAEASR.I Y 19.99 976.4097 9 -47.5 489.1890 2 28.52 1 8220 AEV 2_3_RA2_01_1224.d 0 1 1 526 534
R.M(+15.99)LAEAEKYK.A Y 19.98 1097.5426 9 10.9 549.7845 2 60.78 2 26389 AEV_1_3_RA2_01_1232.d 2.11E4 1 1 517 525 Oxidation (M)
R.TKDNNLLGK(+14.02)FELT(-18.01)GIPPAPR.G Y 19.84 2176.2004 20 -25.3 545.0436 4 77.63 3 46212 AEV_3_3_RA3_01_1233.d 8.53E3 1 1 449 468 Methylation(KR); Dehydration
K.STAGD(+21.98)THLGGEDFDNR.L Y 19.79 1712.7002 16 17.3 429.1897 4 54.44 1 22821 AEV 2_3_RA2_01_1224.d 0 1 1 219 234 Sodium adduct
K.QFTPEEISSM(+15.99)VLT(+79.97)K(+42.01).M Y 19.63 1746.7787 14 -47.6 583.2391 3 84.83 1 45645 AEV 2_3_RA2_01_1224.d 0 1 1 111 124 Oxidation (M); Phosphorylation (STY); Acetylation (K)
K.LDASDK(+31.99)EK.L Y 19.56 936.4399 8 -66.5 937.3849 1 89.83 1 49496 AEV 2_3_RA2_01_1224.d 9.82E4 1 1 561 568 Dihydroxy
MAPAIGIDLGTT(-15.99)YSC(+57.02)VGIFRDDR.I Y 19.32 2511.2249 23 -9.3 628.8077 4 60.47 2 26185 AEV_1_3_RA2_01_1232.d 5.04E4 1 1 1 23 Deoxy; Carbamidomethylation
R.N(+27.99)TISDSKVDEKLDASDK(+14.02).E Y 19.30 1905.9166 17 -42.2 382.1745 5 70.43 1 34405 AEV 2_3_RA2_01_1224.d 0 1 1 550 566 Formylation; Methylation(KR)
K.M(+15.99)RETAESYLGGTVNNAVVTVPAYFNDSQR(-.98).Q Y 19.24 3203.5305 29 8.5 801.8967 4 81.33 2 41612 AEV_1_3_RA2_01_1232.d 0 1 1 125 153 Oxidation (M); Amidation
K.VDEKLDASDK(+226.08).E Y 19.14 1344.6230 10 -17.9 337.1570 4 24.60 1 6377 AEV 2_3_RA2_01_1224.d 0 1 1 557 566 Biotinylation
K.H(+42.01)FP(+31.99)FKVIDK.A Y 19.12 1203.6288 9 -95.1 402.1787 3 58.01 1 25097 AEV 2_3_RA2_01_1224.d 0 1 1 87 95 Acetylation (N-term); Dihydroxy
K.ELESVANPIM(+15.99)MK.F Y 18.96 1376.6680 12 -116.6 459.8431 3 118.06 1 60827 AEV 2_3_RA2_01_1224.d 0 1 1 597 608 Oxidation (M)
K.DLSSNAR(+14.02).A Y 18.83 775.3824 7 -42.6 776.3566 1 58.40 3 31226 AEV_3_3_RA3_01_1233.d 0 1 1 250 256 Methylation(KR)
K.VD(+43.99)EKLDASDK(+14.02).E Y 18.79 1176.5510 10 -26.9 393.1804 3 56.86 1 24335 AEV 2_3_RA2_01_1224.d 1.4E5 1 1 557 566 Carboxylation (DKW); Methylation(KR)
K.AEGER(+14.02).N Y 18.45 574.2711 5 -85.0 575.2295 1 62.54 1 28425 AEV 2_3_RA2_01_1224.d 9.56E4 1 1 187 191 Methylation(KR)
R.NTISDSKVDEK.L Y 18.43 1234.6041 11 -78.5 618.2609 2 31.06 1 9555 AEV 2_3_RA2_01_1224.d 2.61E5 3 3 550 560
K.FAD(+43.99)PEVQSDMK(+42.01).H Y 18.28 1351.5602 11 9.7 676.7939 2 86.62 1 47054 AEV 2_3_RA2_01_1224.d 2.17E4 1 1 76 86 Carboxylation (DKW); Acetylation (K)
R.LIGD(+43.99)AAK.N Y 18.16 730.3861 7 -61.8 366.1778 2 45.52 1 17563 AEV 2_3_RA2_01_1224.d 2E5 1 1 48 54 Carboxylation (DKW)
R.I(+42.01)INEPTAAAIAYGLDK(+42.01)K(+42.01).A Y 18.09 1913.0145 17 -57.5 957.4595 2 86.89 3 52943 AEV_3_3_RA3_01_1233.d 1.73E5 1 1 170 186 Acetylation (N-term); Acetylation (K)
R.FE(+14.02)ELC(+57.02)QDLFR.S Y 17.95 1369.6335 10 12.1 685.8323 2 80.77 2 41174 AEV_1_3_RA2_01_1232.d 4.19E4 1 1 300 309 Methylation(others); Carbamidomethylation
R.ISAKNGLESYAYSLR.N Y 17.87 1670.8628 15 17.3 557.9712 3 72.45 2 34696 AEV_1_3_RA2_01_1232.d 2.2E4 1 1 535 549
R.LRTAC(+57.02)ER(-43.05)AKR.T Y 17.83 1216.6346 10 25.7 305.1738 4 21.99 3 8890 AEV_3_3_RA3_01_1233.d 0 1 1 261 270 Carbamidomethylation; Arginine oxidation to glutamic semialdehyde
K.N(+42.01)QVAM(+15.99)NPSNTVFDAKR.L Y 17.68 1848.8788 16 10.6 617.3068 3 40.52 3 19707 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 55 70 Acetylation (N-term); Oxidation (M)
K.DLS(+79.97)SN(+.98)AR.A Y 17.38 842.3171 7 68.3 843.3819 1 87.82 1 47970 AEV 2_3_RA2_01_1224.d 0 1 1 250 256 Phosphorylation (STY); Deamidation (NQ)
R.MLAE(+43.99)AEK.Y Y 17.19 834.3793 7 -37.2 835.3555 1 91.83 1 50944 AEV 2_3_RA2_01_1224.d 0 1 1 517 523 Carboxylation (E)
K.SINPDEAVAYGAAVQAAILSGDTTSK(+21.98)(+14.02).S Y 17.19 2584.2632 26 6.7 647.0774 4 69.91 3 40158 AEV_3_3_RA3_01_1233.d 3.11E5 1 1 360 385 Sodium adduct; Methylation(KR)
R.IQKLVSDFFNGK(+42.01).E Y 17.18 1436.7664 12 11.5 360.2030 4 17.99 2 5570 AEV_1_3_RA2_01_1232.d 0 1 1 344 355 Acetylation (K)
R.N(+42.01)TISDSK.V Y 17.13 805.3818 7 -63.5 806.3379 1 97.50 1 54676 AEV 2_3_RA2_01_1224.d 2.98E5 1 1 550 556 Acetylation (N-term)
K.DAGLIAGLNVLR(+21.98).I Y 17.10 1232.6853 12 14.7 309.1831 4 47.39 3 24053 AEV_3_3_RA3_01_1233.d 3.44E5 1 1 158 169 Sodium adduct
R.ARFEE(+14.02)LC(+57.02)QDLFR.S Y 17.00 1596.7719 12 -74.5 533.2249 3 86.08 1 46690 AEV 2_3_RA2_01_1224.d 1.73E5 1 1 298 309 Methylation(others); Carbamidomethylation
R.N(+203.08)TTIPTK.K Y 16.60 976.5077 7 -9.0 489.2567 2 71.04 3 41046 AEV_3_3_RA3_01_1233.d 0 1 1 416 422 HexNAcylation (N)
K.IVIT(+79.97)NDKGR(+28.03).L Y 16.57 1122.5798 9 29.4 375.2115 3 67.67 2 31126 AEV_1_3_RA2_01_1232.d 1.33E5 1 1 500 508 Phosphorylation (STY); Dimethylation(KR)
K.DNNLLGK.F N 16.51 772.4079 7 -126.0 773.3179 1 103.58 1 56876 AEV 2_3_RA2_01_1224.d 0 1 1 451 457
K.IVITNDK.G Y 16.33 801.4596 7 -27.5 802.4448 1 86.84 3 52906 AEV_3_3_RA3_01_1233.d 1.03E4 1 1 500 506
K.VDEK(+42.01)LDASDK(+14.02).E Y 15.90 1174.5717 10 -66.5 392.5051 3 56.68 1 24220 AEV 2_3_RA2_01_1224.d 0 1 1 557 566 Acetylation (K); Methylation(KR)
K.GTGK(+14.02)TNKIVITN(+.98)DK.G Y 15.61 1502.8304 14 15.3 376.7206 4 32.30 2 11783 AEV_1_3_RA2_01_1232.d 6.59E5 1 1 493 506 Methylation(KR); Deamidation (NQ)
K.KDLSSN(+.98)AR.A Y 15.40 890.4457 8 -1.2 446.2296 2 67.15 3 37976 AEV_3_3_RA3_01_1233.d 0 1 1 249 256 Deamidation (NQ)
R.LVNHFVNEFKR.K Y 15.34 1401.7517 11 -84.9 351.4155 4 73.82 1 36985 AEV 2_3_RA2_01_1224.d 3.57E5 1 1 235 245
K.TNK(+31.99)IVITN(+.98)DKGR.L Y 15.33 1390.7416 12 -98.6 348.6584 4 73.47 1 36660 AEV 2_3_RA2_01_1224.d 1.07E5 1 1 497 508 Dihydroxy; Deamidation (NQ)
K.R(+14.02)NTTIPT(+79.97)KK.S Y 15.14 1151.6063 9 30.3 576.8279 2 82.32 3 49825 AEV_3_3_RA3_01_1233.d 2.43E4 1 1 415 423 Methylation(KR); Phosphorylation (STY)
R.N(+27.99)TISDSK.V Y 15.11 791.3661 7 29.0 792.3963 1 78.36 2 39253 AEV_1_3_RA2_01_1232.d 2.24E4 1 1 550 556 Formylation
R.KFADPEVQ(+.98)SDMK.H Y 15.10 1394.6388 12 -35.7 465.8703 3 65.33 1 30386 AEV 2_3_RA2_01_1224.d 5.37E4 1 1 75 86 Deamidation (NQ)
K.DLSSNAR.A Y 15.03 761.3668 7 27.1 762.3947 1 82.59 2 42570 AEV_1_3_RA2_01_1232.d 4.42E4 1 1 250 256
K.ELESVANPIMM(+15.99)K.F Y 15.00 1376.6680 12 21.0 689.3557 2 70.47 3 40598 AEV_3_3_RA3_01_1233.d 3.69E4 1 1 597 608 Oxidation (M)
total 127 peptides
C1G1T5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.YGEAGLPQDTIHANIK.G Y 122.30 1725.8685 16 3.8 576.2990 3 65.86 2 29847 AEV_1_3_RA2_01_1232.d 5.23E5 3 3 1337 1352
R.VC(+57.02)PAPC(+57.02)EGAC(+57.02)VLGINEDPVGIK.S Y 110.70 2354.1069 22 2.1 1178.0632 2 79.37 2 40058 AEV_1_3_RA2_01_1232.d 2.98E5 3 3 1711 1732 Carbamidomethylation
K.C(+57.02)HLNTC(+57.02)PVGIATQDPVLR.Q Y 109.65 2050.0088 18 17.5 684.3555 3 70.61 3 40707 AEV_3_3_RA3_01_1233.d 0 1 1 1188 1205 Carbamidomethylation
K.YAGLPWELGLAETHQTLVLNDLR.G Y 103.38 2608.3650 23 -5.2 870.4578 3 87.47 3 53285 AEV_3_3_RA3_01_1233.d 9.48E3 1 1 1120 1142
K.SLEEQKPNLSYTLDDATVQSDMR.L Y 102.44 2639.2385 23 -3.1 880.7507 3 74.91 3 44050 AEV_3_3_RA3_01_1233.d 4.11E4 1 1 497 519
K.SLLDSELSDGQYISAK.D Y 98.90 1724.8468 16 1.2 863.4317 2 77.99 2 38966 AEV_1_3_RA2_01_1232.d 3.84E5 3 3 1884 1899
K.DKHVIVIGGGDTGNDC(+57.02)IGTSVR.H Y 97.45 2269.1121 22 3.1 568.2870 4 65.13 3 36377 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 1900 1921 Carbamidomethylation
K.ADHILISGHDGGTGASR.W Y 95.44 1662.8074 17 1.6 555.2773 3 37.31 3 17772 AEV_3_3_RA3_01_1233.d 3.91E5 3 3 1098 1114
K.FVTNTSVGPGEDISLQELRDRNDAVVIATGATVAR.D Y 94.88 3670.8914 35 1.4 918.7314 4 80.36 3 48347 AEV_3_3_RA3_01_1233.d 8.5E4 1 1 1825 1859
R.LDNKLIAESELALEK.G Y 92.48 1684.9247 15 -2.7 562.6473 3 76.71 3 45467 AEV_3_3_RA3_01_1233.d 1.86E5 2 2 1294 1308
R.DGGEPHINDPVSIANIQDAVR.T Y 86.55 2216.0820 21 -2.1 739.6997 3 78.53 3 46919 AEV_3_3_RA3_01_1233.d 1.34E5 1 1 861 881
K.C(+57.02)HLN(-17.03)TC(+57.02)PVGIATQDPVLR.Q Y 86.45 2032.9823 18 0.0 1017.4985 2 78.12 3 46595 AEV_3_3_RA3_01_1233.d 2.16E5 2 2 1188 1205 Carbamidomethylation; Ammonia-loss (N)
R.LTEDELKYQSAR.C Y 84.18 1451.7256 12 2.5 484.9170 3 50.23 3 25875 AEV_3_3_RA3_01_1233.d 6.47E5 4 4 1647 1658
K.INMEMVEVSGVEDPAEIAFLR.G Y 79.92 2348.1392 21 3.8 1175.0813 2 88.71 2 46573 AEV_1_3_RA2_01_1232.d 4.03E4 1 1 1488 1508
K.KSDILDIEDTISDLKTEK.K Y 78.99 2062.0681 18 5.7 516.5272 4 79.29 2 39993 AEV_1_3_RA2_01_1232.d 1.56E5 2 2 1590 1607
R.FSTNTFPSWDR.A Y 78.93 1356.6099 11 4.6 679.3153 2 74.70 3 43959 AEV_3_3_RA3_01_1233.d 3.53E5 2 2 274 284
R.LGGKSNTGEGGEDATR.S Y 76.85 1547.7175 16 15.6 516.9211 3 15.53 3 5418 AEV_3_3_RA3_01_1233.d 1.37E5 3 3 958 973
R.DLKIPGRELDGIHLATEFLHR.N Y 76.80 2429.3179 21 -1.0 486.8704 5 80.81 3 48698 AEV_3_3_RA3_01_1233.d 1.11E5 2 2 1860 1880
R.ALGATLSYQISR.R Y 76.59 1278.6931 12 0.5 640.3541 2 70.66 2 33372 AEV_1_3_RA2_01_1232.d 1.41E5 2 2 1324 1335
K.KAEFSLPFSSGNPAK.K Y 76.31 1578.8042 15 -0.6 527.2750 3 71.77 2 34170 AEV_1_3_RA2_01_1232.d 5.34E5 2 2 1561 1575
R.VIVQTDGQLR.T Y 75.02 1127.6299 10 -1.2 564.8215 2 54.47 3 28709 AEV_3_3_RA3_01_1233.d 5.98E5 5 5 1145 1154
R.GLIEDHHHYTGSELAAR.I Y 74.52 1904.9128 17 0.2 477.2356 4 55.73 3 29369 AEV_3_3_RA3_01_1233.d 2.64E5 4 4 1509 1525
R.TRDWAELSTR.L Y 73.62 1233.6102 10 0.6 412.2109 3 54.21 3 28501 AEV_3_3_RA3_01_1233.d 1.54E5 1 1 1637 1646
K.KAEFSLPFSSGNPAKK.T Y 73.50 1706.8990 16 -1.0 427.7316 4 65.45 3 36632 AEV_3_3_RA3_01_1233.d 6.07E5 4 4 1561 1576
R.IIDDTELKSTVASR.Q Y 73.09 1546.8202 14 -15.9 774.4051 2 62.20 3 34123 AEV_3_3_RA3_01_1233.d 1.14E5 2 2 464 477
R.GQSLIVWGINEGR.Q Y 72.00 1427.7521 13 -9.6 714.8765 2 79.11 3 47370 AEV_3_3_RA3_01_1233.d 2.69E4 1 1 2071 2083
R.VRGMTFEQIAEDAFAFHEK.G Y 70.46 2225.0574 19 2.4 557.2729 4 83.36 2 43143 AEV_1_3_RA2_01_1232.d 2.65E4 1 1 820 838
K.TVAIIGSGPAGLAAADQLNHVGHSVTVYER.A Y 68.26 3002.5574 30 41.1 751.6775 4 78.85 3 47171 AEV_3_3_RA3_01_1233.d 0 1 1 1760 1789
R.GMTFEQIAEDAFAFHEK.G Y 67.51 1969.8879 17 -5.2 657.6332 3 85.79 3 52233 AEV_3_3_RA3_01_1233.d 4.41E4 1 1 822 838
K.TPPGQYSTNVPGVFAAGDC(+57.02)RR.G Y 66.98 2249.0647 21 -4.5 750.6921 3 68.47 3 39027 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 2050 2070 Carbamidomethylation
K.YAGLPWELGLAETHQTLVLNDLRGR.V Y 66.77 2821.4875 25 -1.5 941.5017 3 84.76 3 51534 AEV_3_3_RA3_01_1233.d 1.19E5 2 2 1120 1144
R.RYGEAGLPQDTIHANIK.G Y 62.65 1881.9696 17 0.8 471.5000 4 62.60 2 27609 AEV_1_3_RA2_01_1232.d 7.73E4 1 1 1336 1352
R.ALGATLSYQISRR.Y Y 61.49 1434.7943 13 -1.7 479.2712 3 64.90 3 36189 AEV_3_3_RA3_01_1233.d 1.44E5 2 2 1324 1336
R.VLEDEAAKTAASK.K Y 60.10 1331.6932 13 -17.4 666.8423 2 33.88 3 15666 AEV_3_3_RA3_01_1233.d 9.55E5 6 6 1548 1560
R.ATHVLGLANWFYLC(+57.02)SLSNR.N Y 60.02 2221.1101 19 8.8 556.2897 4 86.42 3 52656 AEV_3_3_RA3_01_1233.d 5.6E4 1 1 220 238 Carbamidomethylation
R.VLILGPTGR.N Y 58.71 924.5756 9 -100.3 463.2487 2 73.77 1 36942 AEV 2_3_RA2_01_1224.d 3.08E5 3 3 1456 1464
R.SEHEQIKNC(+57.02)TLR.G Y 58.23 1513.7307 12 2.0 505.5852 3 23.15 3 9524 AEV_3_3_RA3_01_1233.d 4.05E5 2 2 894 905 Carbamidomethylation
R.KC(+57.02)HLNTC(+57.02)PVGIATQDPVLR.Q Y 57.13 2178.1038 19 10.5 545.5389 4 67.41 2 30944 AEV_1_3_RA2_01_1232.d 1.85E5 1 1 1187 1205 Carbamidomethylation
K.GSAGQSFGAFLAPGVTLELEGDANDYVGK.G Y 56.28 2869.3770 29 5.0 957.4711 3 89.16 2 46809 AEV_1_3_RA2_01_1232.d 7.89E4 1 1 1353 1381
K.MLLVDTIAGR.I Y 54.20 1087.6060 10 7.0 544.8141 2 77.39 2 38479 AEV_1_3_RA2_01_1232.d 2.36E5 3 3 454 463
K.FVTNTSVGPGEDISLQELR.D Y 53.93 2061.0378 19 4.4 1031.5308 2 79.30 2 40000 AEV_1_3_RA2_01_1232.d 1.61E4 1 1 1825 1843
K.AKADHILISGHDGGTGASR.W Y 53.29 1861.9395 19 -1.8 621.6526 3 34.10 3 15789 AEV_3_3_RA3_01_1233.d 3.18E4 1 1 1096 1114
R.LLLKSPILSLSEFNAIK.N Y 53.24 1885.1288 17 -31.4 629.3638 3 85.23 3 51890 AEV_3_3_RA3_01_1233.d 0 1 1 612 628
K.VKGVEGYLDALDGIC(+57.02)NAATEGIENGYK.V Y 53.07 2855.3647 27 -2.3 952.7933 3 86.90 2 45558 AEV_1_3_RA2_01_1232.d 7.2E4 1 1 649 675 Carbamidomethylation
K.VSAEIGKTR.H Y 52.09 959.5400 9 -1.0 480.7768 2 18.87 3 7228 AEV_3_3_RA3_01_1233.d 7.85E4 2 2 1029 1037
R.SWVDSQLLR.L Y 52.04 1102.5771 9 0.1 552.2959 2 75.09 3 44191 AEV_3_3_RA3_01_1233.d 1.23E5 1 1 482 490
K.EFVGGN(+.98)GVVK.G Y 51.37 1005.5131 10 2.9 503.7653 2 57.77 3 30836 AEV_3_3_RA3_01_1233.d 0 1 1 1979 1988 Deamidation (NQ)
K.TIDITFEK.V Y 50.30 965.5070 8 -91.2 483.7167 2 74.60 1 37551 AEV 2_3_RA2_01_1224.d 8.82E5 2 2 641 648
R.ILLDFTR.A Y 49.86 876.5069 7 -0.1 439.2607 2 75.47 2 37004 AEV_1_3_RA2_01_1232.d 6.59E5 4 4 1526 1532
R.IEC(+57.02)DIVNTDR.A Y 47.81 1233.5659 10 -84.0 617.7384 2 61.52 1 27621 AEV 2_3_RA2_01_1224.d 2.9E5 4 4 1314 1323 Carbamidomethylation
R.WAAHNGEINTLR.G Y 45.63 1380.6898 12 -86.5 461.1974 3 66.89 1 31548 AEV 2_3_RA2_01_1224.d 1.99E5 3 3 290 301
R.YC(+57.02)GANLDR.N Y 45.26 967.4182 8 20.3 484.7262 2 31.73 2 11520 AEV_1_3_RA2_01_1232.d 1.72E5 2 2 404 411 Carbamidomethylation
R.DSTLLGPAALSR.E Y 44.74 1199.6510 12 -0.8 600.8323 2 72.91 3 42511 AEV_3_3_RA3_01_1233.d 3.18E5 3 3 164 175
K.GLPC(+57.02)RIEC(+57.02)DIVNTDR.A Y 42.50 1816.8560 15 -11.9 606.6187 3 69.26 3 39679 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 1309 1323 Carbamidomethylation
R.LD(-18.01)NK(+14.02)LIAESELALEK.G Y 40.31 1680.9297 15 -22.6 561.3045 3 76.72 3 45477 AEV_3_3_RA3_01_1233.d 0 1 1 1294 1308 Dehydration; Methylation(KR)
R.LDNKLIAESELALEK(+14.02)GLPCR.I Y 38.80 2225.2090 20 11.3 557.3158 4 68.46 2 31706 AEV_1_3_RA2_01_1232.d 0 1 1 1294 1313 Methylation(KR)
R.LGGKSNTGE(+14.02)GGEDATR.S Y 38.00 1561.7332 16 0.9 521.5854 3 22.33 3 9067 AEV_3_3_RA3_01_1233.d 6.09E4 1 1 958 973 Methylation(others)
R.LLYEYFR.Q Y 37.88 1002.5175 7 -89.0 502.2214 2 81.97 1 43446 AEV 2_3_RA2_01_1224.d 2.9E5 2 2 563 569
R.DRNDAVVIATGATVAR.D Y 37.02 1627.8641 16 -91.3 543.5791 3 71.03 1 34741 AEV 2_3_RA2_01_1224.d 9.11E4 1 1 1844 1859
R.SAVFKAEENIIVGNVC(+57.02)LYGATLGHC(+57.02)YFR.G Y 35.99 3187.5583 28 0.8 797.8975 4 85.95 2 44942 AEV_1_3_RA2_01_1232.d 0 1 1 1395 1422 Carbamidomethylation
R.LLGDEIEKDAR.K Y 35.15 1257.6564 11 18.7 420.2339 3 60.61 3 32874 AEV_3_3_RA3_01_1233.d 2.28E5 1 1 2035 2045
K.VLPTDYKR.V Y 34.97 990.5498 8 5.5 496.2849 2 35.22 2 13177 AEV_1_3_RA2_01_1232.d 1.18E6 10 10 1540 1547
R.VIVQ(+.98)TDGQLR.T Y 34.88 1128.6139 10 -6.4 565.3106 2 58.82 2 25121 AEV_1_3_RA2_01_1232.d 3.47E4 1 1 1145 1154 Deamidation (NQ)
R.LIVYPPR.S Y 33.76 856.5170 7 1.8 429.2666 2 62.65 2 27665 AEV_1_3_RA2_01_1232.d 1.63E5 4 4 1388 1394
R.NALILDKTK.G Y 33.30 1014.6073 9 -17.5 508.3021 2 40.79 2 15841 AEV_1_3_RA2_01_1232.d 7.16E4 3 3 1610 1618
K.N(+.98)DKSYEAYAR.S Y 32.87 1216.5360 10 -78.0 609.2278 2 38.07 1 13311 AEV 2_3_RA2_01_1224.d 1.14E5 2 2 884 893 Deamidation (NQ)
K.ASVDGGILK.V Y 31.55 858.4811 9 -31.5 430.2343 2 51.66 2 21291 AEV_1_3_RA2_01_1232.d 2.4E5 4 4 772 780
K.SPILSLSEFNAIK.N Y 31.51 1417.7816 13 -35.1 709.8732 2 82.20 3 49740 AEV_3_3_RA3_01_1233.d 6.04E4 2 2 616 628
K.MAQGAKPGEGGELPGHK.V Y 31.37 1662.8147 17 -10.2 555.2732 3 29.19 3 12926 AEV_3_3_RA3_01_1233.d 3.81E4 1 1 1012 1028
R.FSTNTFPSWDR(+14.02).A Y 31.26 1370.6255 11 7.4 686.3251 2 75.46 3 44492 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 274 284 Methylation(KR)
K.VLILSDR.A Y 31.25 814.4912 7 -90.9 408.2159 2 69.45 1 33519 AEV 2_3_RA2_01_1224.d 1.39E5 1 1 676 682
R.SLAAIIVETAEAR.E Y 30.47 1342.7456 13 -14.8 672.3701 2 83.71 2 43405 AEV_1_3_RA2_01_1232.d 0 1 1 711 723
K.GINTTRVEWTK.S Y 30.47 1303.6885 11 0.4 652.8518 2 53.14 3 27800 AEV_3_3_RA3_01_1233.d 4.6E4 1 1 1989 1999
R.LLM(+15.99)TNNFPEFTGR.V Y 29.73 1554.7500 13 10.0 778.3900 2 76.72 2 37955 AEV_1_3_RA2_01_1232.d 1.63E4 1 1 1698 1710 Oxidation (M)
K.ADHILIS(-2.02)GHDGGTGASR.W Y 29.59 1660.7917 17 -48.5 416.1851 4 60.25 1 26709 AEV 2_3_RA2_01_1224.d 0 1 1 1098 1114 2-amino-3-oxo-butanoic_acid
K.LIAESELALEK.G Y 29.54 1214.6758 11 -32.6 608.3254 2 70.09 2 32915 AEV_1_3_RA2_01_1232.d 0 2 2 1298 1308
R.LLMT(+79.97)N(+.98)NFPEFT(+79.97)GR.V Y 28.96 1699.6718 13 -32.9 425.9113 4 51.94 1 21318 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 1698 1710 Phosphorylation (STY); Deamidation (NQ)
R.VLEDEAAK(+31.99).T Y 28.58 905.4341 8 13.7 906.4539 1 90.97 3 55251 AEV_3_3_RA3_01_1233.d 4.58E4 1 1 1548 1555 Dihydroxy
R.C(+57.02)FAGTASR.V Y 28.50 868.3861 8 -93.8 435.1596 2 32.72 1 10490 AEV 2_3_RA2_01_1224.d 4.39E4 2 2 812 819 Carbamidomethylation
K.SIEC(+57.02)AIIDR.G Y 27.56 1075.5332 9 -86.6 538.7273 2 71.69 1 35287 AEV 2_3_RA2_01_1224.d 2.3E2 1 1 1733 1741 Carbamidomethylation
K.WNELVFQNQWR.D Y 27.47 1518.7368 11 0.3 760.3759 2 80.38 2 40865 AEV_1_3_RA2_01_1232.d 1.04E5 1 1 1682 1692
R.DSTLLGPAALS(+120.03)R.E Y 27.27 1319.6849 12 13.7 330.9330 4 58.38 2 24862 AEV_1_3_RA2_01_1232.d 1.42E4 1 1 164 175 O-Isopropylmethylphosphonylation
R.AQ(+.98)AVGA Y 27.13 516.2543 6 12.6 517.2681 1 49.47 2 20175 AEV_1_3_RA2_01_1232.d 8.31E4 3 3 2120 2125 Deamidation (NQ)
R.TKNDKSYEAYAR.S Y 27.06 1444.6946 12 6.1 362.1831 4 21.65 3 8721 AEV_3_3_RA3_01_1233.d 0 1 1 882 893
R.LLMTNNFPEFTGR.V Y 27.05 1538.7551 13 5.5 770.3890 2 80.53 2 40985 AEV_1_3_RA2_01_1232.d 6.89E4 1 1 1698 1710
R.ALPHFVK.V Y 26.54 810.4752 7 -96.2 406.2059 2 66.87 1 31533 AEV 2_3_RA2_01_1224.d 9.07E4 1 1 1533 1539
R.DWAELSTR.L Y 26.50 976.4614 8 -73.7 489.2020 2 70.72 1 34515 AEV 2_3_RA2_01_1224.d 5.38E4 1 1 1639 1646
K.KAEFSLPFSS(-2.02)GNPAKK.T Y 26.45 1704.8834 16 -2.1 569.3005 3 65.35 3 36558 AEV_3_3_RA3_01_1233.d 0 1 1 1561 1576 2-amino-3-oxo-butanoic_acid
K.DKHVIVIGGGDTGNDC(+57.02)IGTS(-18.01)VR(+14.02).H Y 26.34 2265.1172 22 14.2 567.2946 4 65.14 3 36389 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 1900 1921 Carbamidomethylation; Dehydration; Methylation(KR)
R.G(+42.01)QSLIVWGINEGRQAAR.E Y 26.31 1895.9966 17 -65.2 380.1819 5 71.34 1 34984 AEV 2_3_RA2_01_1224.d 0 1 1 2071 2087 Acetylation (N-term)
R.NLLC(+57.02)NMTHR.G Y 26.15 1157.5435 9 9.5 386.8588 3 54.37 3 28616 AEV_3_3_RA3_01_1233.d 8.43E4 1 1 73 81 Carbamidomethylation
K.TAASK(+21.98).K Y 25.43 498.2414 5 -20.5 499.2385 1 27.43 3 11925 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 1556 1560 Sodium adduct
K.TAASK.K Y 25.03 476.2595 5 -10.6 477.2617 1 20.95 3 8345 AEV_3_3_RA3_01_1233.d 2.54E4 1 1 1556 1560
R.S(+42.01)LAAIIVETAEAR.E Y 24.91 1384.7561 13 -0.7 347.1960 4 33.02 3 15156 AEV_3_3_RA3_01_1233.d 0 1 1 711 723 Acetylation (N-term)
R.A(+42.01)Q(+.98)AVGA Y 24.85 558.2649 6 -98.3 559.2173 1 32.92 1 10584 AEV 2_3_RA2_01_1224.d 0 1 1 2120 2125 Acetylation (N-term); Deamidation (NQ)
R.GAVGSDARDGDGAGVM(+15.99)TSIPHK.F Y 24.72 2112.9858 22 19.7 705.3497 3 78.10 3 46577 AEV_3_3_RA3_01_1233.d 0 1 1 82 103 Oxidation (M)
K.IIENYKAS(+79.97)VDGGILK.V Y 24.59 1698.8593 15 39.4 425.7388 4 60.56 3 32838 AEV_3_3_RA3_01_1233.d 0 1 1 766 780 Phosphorylation (STY)
R.IIDDTELKSTVASR(+14.02).Q Y 24.52 1560.8358 14 -10.2 521.2806 3 65.05 3 36314 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 464 477 Methylation(KR)
R.RGQSLIVWGINEGRQAAR.E Y 24.43 2010.0870 18 4.3 671.0392 3 83.46 3 50638 AEV_3_3_RA3_01_1233.d 0 1 1 2070 2087
K.SLLD(+6.01)SELSDGQYISAK.D Y 24.42 1730.8550 16 -17.2 866.4199 2 77.82 3 46361 AEV_3_3_RA3_01_1233.d 6.88E4 1 1 1884 1899 Replacement of proton by lithium
R.VLGWRDVPR.D Y 24.40 1096.6141 9 -2.8 366.5443 3 64.02 3 35574 AEV_3_3_RA3_01_1233.d 8.46E4 1 1 155 163
R.Q(+42.01)LYVLR.K Y 24.20 832.4807 6 -2.4 417.2466 2 69.34 3 39722 AEV_3_3_RA3_01_1233.d 0 1 1 212 217 Acetylation (N-term)
K.LVSEVGVGIVAS(+79.97)GVAK(+14.02).A Y 23.83 1577.8429 16 13.3 395.4732 4 64.57 2 28956 AEV_1_3_RA2_01_1232.d 9.38E4 1 1 1080 1095 Phosphorylation (STY); Methylation(KR)
K.GSAGQSFGAFLAPGVTLELEGDANDYVGK(-.98).G Y 23.76 2868.3928 29 -3.4 957.1350 3 89.00 3 54158 AEV_3_3_RA3_01_1233.d 0 1 1 1353 1381 Amidation
K.SNTGEGGEDATR.S Y 23.55 1192.4956 12 -51.9 597.2241 2 56.18 1 23933 AEV 2_3_RA2_01_1224.d 2.18E5 2 2 962 973
K.QLIY(+79.97)DLKC(+57.02)S(+79.97)NPRS(+79.97)R.V Y 23.39 1988.7981 14 35.1 663.9633 3 88.32 1 48354 AEV 2_3_RA2_01_1224.d 0 1 1 1062 1075 Phosphorylation (STY); Carbamidomethylation
R.LT(-2.02)EDELKYQSAR.C Y 23.17 1449.7100 12 34.5 484.2606 3 50.27 3 25901 AEV_3_3_RA3_01_1233.d 0 1 1 1647 1658 2-amino-3-oxo-butanoic_acid
K.AEFSLPFSSGNPAK.K Y 23.11 1450.7092 14 3.3 726.3643 2 46.06 3 23226 AEV_3_3_RA3_01_1233.d 1.71E5 2 2 1562 1575
R.LGGKSNTGEGGEDAT(+79.97)R.S Y 22.72 1627.6838 16 36.9 326.5561 5 73.62 1 36778 AEV 2_3_RA2_01_1224.d 0 1 1 958 973 Phosphorylation (STY)
R.VLEDEAAK(+31.99)TAASK.K Y 22.69 1363.6830 13 10.7 682.8561 2 12.58 2 3437 AEV_1_3_RA2_01_1232.d 2.91E5 2 2 1548 1560 Dihydroxy
K.T(+79.97)AASK(+14.02).K Y 22.57 570.2415 5 -49.0 571.2208 1 42.90 1 16096 AEV 2_3_RA2_01_1224.d 3.12E4 1 1 1556 1560 Phosphorylation (STY); Methylation(KR)
R.ND(-18.01)AVVIATGATVAR.D Y 22.47 1338.7256 14 19.7 335.6953 4 67.11 3 37946 AEV_3_3_RA3_01_1233.d 0 1 1 1846 1859 Dehydration
K.THMGKDPR.E Y 22.40 940.4549 8 29.7 941.4901 1 99.85 2 50966 AEV_1_3_RA2_01_1232.d 3.14E4 1 1 1964 1971
K.TAAS(+79.97)K.K Y 22.23 556.2258 5 74.0 557.2742 1 56.18 3 29652 AEV_3_3_RA3_01_1233.d 0 1 1 1556 1560 Phosphorylation (STY)
K.MLLVDTIAGR(+14.02).I Y 22.11 1101.6216 10 -5.2 551.8152 2 78.19 3 46649 AEV_3_3_RA3_01_1233.d 4.41E3 1 1 454 463 Methylation(KR)
R.NDAVVIATGATVARDLK.I Y 22.08 1712.9420 17 -60.6 429.2168 4 58.81 3 31525 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 1846 1862
R.TINEMVGR.A Y 21.92 918.4593 8 3.8 460.2386 2 44.63 2 17755 AEV_1_3_RA2_01_1232.d 0 1 1 1237 1244
R.SKLM(+15.99)ENGDTMR.S Y 21.90 1296.5802 11 16.2 325.1576 4 67.38 1 31933 AEV 2_3_RA2_01_1224.d 5.44E4 1 1 974 984 Oxidation (M)
K.EFVGGN(+.98)GVVK(+14.02).G Y 21.86 1019.5287 10 -16.1 510.7634 2 33.88 3 15665 AEV_3_3_RA3_01_1233.d 8.52E4 1 1 1979 1988 Deamidation (NQ); Methylation(KR)
R.VLEDEAAK(+43.01).T Y 21.79 916.4501 8 -62.6 459.2036 2 60.58 1 26910 AEV 2_3_RA2_01_1224.d 0 1 1 1548 1555 Carbamylation
R.ELDGIHLATEFLHR.N Y 21.68 1649.8525 14 -106.1 413.4266 4 87.40 1 47647 AEV 2_3_RA2_01_1224.d 0 1 1 1867 1880
K.GLSGGR(+21.98).L Y 21.63 567.2741 6 -49.6 568.2532 1 41.81 1 15455 AEV 2_3_RA2_01_1224.d 1.89E4 1 1 1382 1387 Sodium adduct
R.YYVTDDDR(+.98)IIC(+57.02)ASEVGTIPFEPER.I Y 21.55 2845.3115 24 12.6 949.4564 3 81.81 2 41976 AEV_1_3_RA2_01_1232.d 5.99E4 1 1 419 442 Deamidation (R); Carbamidomethylation
K.GFPSR.H N 21.54 562.2863 5 -13.9 563.2858 1 54.98 3 28966 AEV_3_3_RA3_01_1233.d 0 1 1 839 843
R.ENLFR.K N 21.37 677.3497 5 -93.7 678.2935 1 93.83 1 52361 AEV 2_3_RA2_01_1224.d 0 1 1 754 758
K.TAAS(-18.01)K.K Y 21.35 458.2489 5 6.4 459.2591 1 66.01 2 29958 AEV_1_3_RA2_01_1232.d 0 1 1 1556 1560 Dehydration
K.T(-18.01)AASK.K Y 21.09 458.2489 5 -169.9 459.1783 1 28.27 1 8083 AEV 2_3_RA2_01_1224.d 0 1 1 1556 1560 Dehydration
R.NDAVVIATGATVAR.D Y 21.02 1356.7361 14 -101.1 679.3067 2 71.34 1 34981 AEV 2_3_RA2_01_1224.d 9.3E3 1 1 1846 1859
K.IVSDAR(+21.98).N Y 20.99 681.3422 6 -4.8 682.3462 1 70.53 3 40686 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 67 72 Sodium adduct
K.IPGRELDGIHLATEFLHR.N Y 20.90 2073.1118 18 4.6 519.2876 4 76.08 2 37460 AEV_1_3_RA2_01_1232.d 0 1 1 1863 1880
K.GLSGGR(+79.97).L Y 20.81 625.2585 6 -40.6 626.2404 1 30.63 1 9300 AEV 2_3_RA2_01_1224.d 0 1 1 1382 1387 Phosphorylation (HCDR)
K.ADHILISGHD(+43.99)GGTGASR.W Y 20.79 1706.7972 17 -99.4 854.3210 2 79.01 1 41078 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 1098 1114 Carboxylation (DKW)
K.C(+57.02)(+42.01)SNPR.S Y 20.67 674.2806 5 34.2 675.3109 1 51.41 3 26647 AEV_3_3_RA3_01_1233.d 1.94E5 1 1 1069 1073 Carbamidomethylation; Acetylation (N-term)
R.L(+42.01)QPGK(+42.01).M Y 20.40 625.3435 5 -26.1 626.3345 1 68.06 2 31408 AEV_1_3_RA2_01_1232.d 6.13E4 1 1 449 453 Acetylation (N-term); Acetylation (K)
K.T(+79.96)AAS(+79.97)K.K Y 20.30 636.1826 5 92.0 637.2484 1 49.81 1 20136 AEV 2_3_RA2_01_1224.d 1.85E4 1 1 1556 1560 Sulfation; Phosphorylation (STY)
K.VSAEIGK(+27.99).T Y 20.06 730.3861 7 -94.5 366.1658 2 50.73 1 20617 AEV 2_3_RA2_01_1224.d 2.75E4 1 1 1029 1035 Formylation
K.K(+43.01)SDILDIEDT(+79.97)ISDLKTEK.K Y 20.05 2185.0403 18 6.1 547.2707 4 59.49 3 32035 AEV_3_3_RA3_01_1233.d 0 1 1 1590 1607 Carbamylation; Phosphorylation (STY)
K.LVSEVGVGIVASGVAK.A Y 19.76 1483.8610 16 -88.2 742.8723 2 80.68 1 42370 AEV 2_3_RA2_01_1224.d 3.46E4 1 1 1080 1095
K.SD(+21.98)ILDIEDT(+79.97)ISDLK.T Y 19.69 1677.7362 14 -15.5 560.2440 3 75.99 1 38657 AEV 2_3_RA2_01_1224.d 0 1 1 1591 1604 Sodium adduct; Phosphorylation (STY)
R.GFEMGWMIPTPPPS(-18.01)R.S Y 19.54 1683.7902 15 -16.3 562.2615 3 77.54 1 39902 AEV 2_3_RA2_01_1224.d 1.48E5 1 1 1742 1756 Dehydration
R.LDN(+.98)KLIAES(+79.97)ELALEK(+42.01).G Y 19.53 1807.8856 15 -10.8 452.9738 4 59.15 3 31780 AEV_3_3_RA3_01_1233.d 1.98E5 1 1 1294 1308 Deamidation (NQ); Phosphorylation (STY); Acetylation (K)
K.T(+42.01)HMGKD(+43.99)PR.E Y 19.48 1026.4553 8 12.0 343.1631 3 29.39 1 8654 AEV 2_3_RA2_01_1224.d 2.81E5 1 1 1964 1971 Acetylation (N-term); Carboxylation (DKW)
K.MAQGAKPGEGGE(+43.99)LPGHK(+42.01).V Y 19.44 1748.8152 17 96.9 438.2534 4 13.91 2 3932 AEV_1_3_RA2_01_1232.d 0 1 1 1012 1028 Carboxylation (E); Acetylation (K)
K.GLSGGR(+14.02).L Y 19.28 559.3078 6 -117.7 560.2493 1 71.50 1 35104 AEV 2_3_RA2_01_1224.d 0 1 1 1382 1387 Methylation(KR)
K.M(+15.99)LLVDTIAGR.I Y 19.15 1103.6008 10 -4.9 552.8050 2 71.52 3 41418 AEV_3_3_RA3_01_1233.d 1.53E4 1 1 454 463 Oxidation (M)
R.AT(+79.97)SANR.V Y 19.00 698.2748 6 25.1 350.1534 2 38.69 1 13648 AEV 2_3_RA2_01_1224.d 3.26E5 1 1 683 688 Phosphorylation (STY)
R.AQ(+.98)AVGA(-.98) Y 18.99 515.2703 6 -1.1 516.2770 1 64.14 3 35611 AEV_3_3_RA3_01_1233.d 0 1 1 2120 2125 Deamidation (NQ); Amidation
K.T(+42.01)AASK.K Y 18.96 518.2700 5 5.0 519.2799 1 71.14 2 33701 AEV_1_3_RA2_01_1232.d 6.71E4 2 2 1556 1560 Acetylation (N-term)
K.M(+15.99)RDDLPSSK.M Y 18.90 1063.4968 9 -90.7 532.7075 2 30.39 1 9170 AEV 2_3_RA2_01_1224.d 2.31E4 1 1 1250 1258 Oxidation (M)
K.ASVDGGILK(+21.98)(+42.01).V Y 18.86 922.4736 9 9.1 923.4893 1 89.51 3 54448 AEV_3_3_RA3_01_1233.d 8.93E4 1 1 772 780 Sodium adduct; Acetylation (K)
K.VSAEIGK(+21.98)(+14.02).T Y 18.82 738.3888 7 -0.3 739.3959 1 79.20 2 39961 AEV_1_3_RA2_01_1232.d 9.8E4 1 1 1029 1035 Sodium adduct; Methylation(KR)
K.EFVGGNGVVK(+114.04).G Y 18.72 1118.5720 10 21.3 560.3052 2 65.13 2 29343 AEV_1_3_RA2_01_1232.d 1.68E5 1 1 1979 1988 Ubiquitin
R.L(+42.01)Q(+.98)PGK.M Y 18.70 584.3170 5 -78.6 585.2783 1 23.51 2 7850 AEV_1_3_RA2_01_1232.d 2.5E4 1 1 449 453 Acetylation (N-term); Deamidation (NQ)
R.AQAVGA Y 18.57 515.2703 6 -23.0 516.2657 1 24.30 2 8187 AEV_1_3_RA2_01_1232.d 2.56E4 2 2 2120 2125
R.VLE(+21.98)DEAAKTAAS(+79.97)K.K Y 18.54 1433.6415 13 -3.9 478.8859 3 82.54 1 43815 AEV 2_3_RA2_01_1224.d 9.83E4 1 1 1548 1560 Sodium adduct; Phosphorylation (STY)
K.YQSAR(+14.02).C Y 18.52 637.3184 5 -14.7 638.3163 1 78.84 2 39635 AEV_1_3_RA2_01_1232.d 1.47E5 1 1 1654 1658 Methylation(KR)
K.V(+42.01)SAEIGK(+42.01).T Y 18.42 786.4123 7 16.7 787.4327 1 79.34 3 47550 AEV_3_3_RA3_01_1233.d 7.49E4 1 1 1029 1035 Acetylation (N-term); Acetylation (K)
K.Y(+42.01)RNAKLR.T Y 18.42 961.5457 7 -23.7 321.5149 3 17.04 2 5175 AEV_1_3_RA2_01_1232.d 0 1 1 1630 1636 Acetylation (N-term)
K.GLSGGR.L Y 18.40 545.2921 6 -10.9 546.2935 1 98.65 2 50571 AEV_1_3_RA2_01_1232.d 7.14E4 3 3 1382 1387
K.CSN(+.98)PR.S Y 18.39 576.2326 5 -14.3 577.2316 1 50.20 1 20347 AEV 2_3_RA2_01_1224.d 0 1 1 1069 1073 Deamidation (NQ)
K.ES(+79.97)IATFEELAK(+42.01).E Y 18.35 1358.6006 11 82.8 453.9117 3 57.63 3 30677 AEV_3_3_RA3_01_1233.d 0 1 1 139 149 Phosphorylation (STY); Acetylation (K)
R.NDAVVIAT(+79.97)GATVAR.D Y 18.33 1436.7024 14 55.1 360.2027 4 42.13 2 16534 AEV_1_3_RA2_01_1232.d 0 1 1 1846 1859 Phosphorylation (STY)
R.IIDDTELK.S Y 18.30 945.5018 8 -92.3 473.7146 2 61.28 1 27433 AEV 2_3_RA2_01_1224.d 8.8E4 1 1 464 471
K.SYEAYAR.S Y 18.15 858.3871 7 -39.1 430.1841 2 40.33 1 14626 AEV 2_3_RA2_01_1224.d 0 1 1 887 893
K.L(+43.01)IAES(+79.97)ELALEK.G Y 18.13 1337.6479 11 22.3 335.4267 4 48.72 2 19806 AEV_1_3_RA2_01_1232.d 1.74E5 1 1 1298 1308 Carbamylation; Phosphorylation (STY)
R.RVDFMAAEGVK.F Y 18.13 1221.6176 11 62.2 306.4307 4 13.35 2 3719 AEV_1_3_RA2_01_1232.d 2.76E5 2 2 1814 1824
R.GLLDFDFEQR.I Y 18.10 1238.5931 10 -74.9 620.2574 2 88.17 1 48241 AEV 2_3_RA2_01_1224.d 5.97E4 1 1 906 915
R.NFAAGMSGGIAYVLDVNQDFHSK.I Y 18.03 2440.1482 23 11.3 814.3992 3 85.01 2 44325 AEV_1_3_RA2_01_1232.d 9.28E4 1 1 1465 1487
R.A(+42.01)LGATLSYQIS(+79.97)R.R Y 17.99 1400.6700 12 100.0 351.2098 4 60.31 3 32644 AEV_3_3_RA3_01_1233.d 0 1 1 1324 1335 Acetylation (N-term); Phosphorylation (STY)
K.G(+42.01)FPSR.H N 17.95 604.2969 5 -98.5 605.2446 1 74.53 1 37489 AEV 2_3_RA2_01_1224.d 0 1 1 839 843 Acetylation (N-term)
R.G(+42.01)VAAER.F Y 17.87 643.3289 6 -19.9 644.3234 1 64.28 3 35717 AEV_3_3_RA3_01_1233.d 4.65E4 1 1 1423 1428 Acetylation (N-term)
R.VDYGHTEVK(+27.99)THMGKDPR.E Y 17.78 1996.9425 17 36.0 500.2609 4 30.68 3 13790 AEV_3_3_RA3_01_1233.d 0 1 1 1955 1971 Formylation
K.MR(+14.02)DDLPSSK(+21.98).M Y 17.75 1083.4995 9 4.4 362.1754 3 57.30 1 24617 AEV 2_3_RA2_01_1224.d 0 1 1 1250 1258 Methylation(KR); Sodium adduct
K.TAASKKAEFS(+79.97)LPFSSGNPAK(+42.01).K Y 17.74 2159.0300 20 30.6 540.7813 4 69.36 3 39737 AEV_3_3_RA3_01_1233.d 3.19E5 1 1 1556 1575 Phosphorylation (STY); Acetylation (K)
R.IGGLLM(+15.99)YGIPNMK.L Y 17.72 1421.7411 13 46.1 711.9106 2 78.43 2 39312 AEV_1_3_RA2_01_1232.d 3.52E4 1 1 1793 1805 Oxidation (M)
R.ATS(-18.01)ANR(+14.02).V Y 17.67 614.3136 6 9.3 615.3266 1 68.29 2 31575 AEV_1_3_RA2_01_1232.d 0 1 1 683 688 Dehydration; Methylation(KR)
R.ILLDF(+31.99)TR.A Y 17.54 908.4967 7 -47.5 455.2341 2 11.15 3 3084 AEV_3_3_RA3_01_1233.d 0 2 2 1526 1532 Dihydroxy
K.TAASK(+43.01).K Y 17.53 519.2653 5 -101.1 520.2200 1 60.01 1 26500 AEV 2_3_RA2_01_1224.d 8.64E4 1 1 1556 1560 Carbamylation
K.GLS(-18.01)GGR(+14.02).L Y 17.51 541.2972 6 -18.0 542.2948 1 58.77 3 31500 AEV_3_3_RA3_01_1233.d 0 1 1 1382 1387 Dehydration; Methylation(KR)
K.VSAEIGK(+114.04).T Y 17.49 816.4341 7 -11.8 817.4317 1 78.62 2 39457 AEV_1_3_RA2_01_1232.d 0 1 1 1029 1035 Ubiquitin
K.C(+57.02)SNPR(+14.02).S Y 17.46 646.2857 5 -11.3 324.1465 2 37.08 1 12754 AEV 2_3_RA2_01_1224.d 5.03E4 1 1 1069 1073 Carbamidomethylation; Methylation(KR)
R.NTKSLLDSELSDGQYISAK(+87.07).D Y 17.40 2155.1008 19 -16.7 719.3622 3 83.97 3 50997 AEV_3_3_RA3_01_1233.d 9.39E4 1 1 1881 1899 Hypusine
K.SNTGEGGEDAT(-18.01)RSK.L Y 17.33 1389.6121 14 -35.1 695.7889 2 65.48 1 30488 AEV 2_3_RA2_01_1224.d 4.59E4 1 1 962 975 Dehydration
K.MLLVD(-18.01)TIAGR.I Y 17.27 1069.5953 10 35.7 357.5518 3 58.53 2 24955 AEV_1_3_RA2_01_1232.d 4.51E4 1 1 454 463 Dehydration
R.RFVTGAM(+15.99)SYGSISM(+15.99)ESHSTLAIAM(+15.99)NR.L Y 17.22 2864.3254 26 -24.7 955.7589 3 98.16 1 55071 AEV 2_3_RA2_01_1224.d 0 1 1 932 957 Oxidation (M)
K.LVS(+79.97)EVGVGIVASGVAKAK(+21.98).A Y 17.16 1784.9413 18 -3.7 447.2410 4 70.95 3 40969 AEV_3_3_RA3_01_1233.d 0 1 1 1080 1097 Phosphorylation (STY); Sodium adduct
R.DALNR.L N 17.15 587.3027 5 3.5 588.3121 1 98.50 2 50517 AEV_1_3_RA2_01_1232.d 2.96E4 1 1 1693 1697
R.GLLDFD(+21.98)FEQR.I Y 17.15 1260.5751 10 -36.6 631.2717 2 67.21 1 31806 AEV 2_3_RA2_01_1224.d 8.08E4 1 1 906 915 Sodium adduct
R.ILLDFTR(+21.98)(+14.02).A Y 17.09 912.5045 7 -2.8 457.2582 2 75.28 3 44349 AEV_3_3_RA3_01_1233.d 0 1 1 1526 1532 Sodium adduct; Methylation(KR)
K.LMENGDT(+79.97)MR(+14.02).S Y 17.03 1159.4403 9 -16.4 580.7179 2 38.66 1 13626 AEV 2_3_RA2_01_1224.d 0 1 1 976 984 Phosphorylation (STY); Methylation(KR)
R.FSTN(+.98)T(+79.97)FPSWDR.A Y 17.01 1437.5602 11 49.7 480.2178 3 58.16 1 25199 AEV 2_3_RA2_01_1224.d 0 1 1 274 284 Deamidation (NQ); Phosphorylation (STY)
K.VLPT(-18.01)DYK(+42.01)R.V Y 16.98 1014.5498 8 -22.4 508.2708 2 16.79 2 5103 AEV_1_3_RA2_01_1232.d 0 1 1 1540 1547 Dehydration; Acetylation (K)
K.M(+15.99)GISTLQSYK.G Y 16.95 1142.5642 10 -35.1 572.2693 2 70.66 1 34467 AEV 2_3_RA2_01_1224.d 0 1 1 785 794 Oxidation (M)
K.VLPTDYK(+21.98).R Y 16.94 856.4307 7 10.5 429.2271 2 12.57 3 3798 AEV_3_3_RA3_01_1233.d 0 1 1 1540 1546 Sodium adduct
R.VLILGPT(-18.01)GR.N Y 16.91 906.5651 9 -2.0 303.1950 3 48.54 2 19719 AEV_1_3_RA2_01_1232.d 0 1 1 1456 1464 Dehydration
K.VHEHR.D Y 16.87 676.3405 5 131.9 677.4370 1 99.49 2 50853 AEV_1_3_RA2_01_1232.d 0 1 1 1581 1585
K.G(+71.04)LSGGRLIVYPPR.S Y 16.85 1454.8357 13 4.0 364.7177 4 65.90 2 29878 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 1382 1394 Propionamide (K, X@N-term)
K.AEFS(-18.01)LPFSSGN(+.98)PAK.K Y 16.85 1433.6826 14 -46.8 478.8791 3 78.45 1 40606 AEV 2_3_RA2_01_1224.d 1.16E5 1 1 1562 1575 Dehydration; Deamidation (NQ)
R.VLEDEAAKTAAS(+79.97)K.K Y 16.82 1411.6595 13 -49.1 706.8024 2 88.78 1 48717 AEV 2_3_RA2_01_1224.d 6.33E4 1 1 1548 1560 Phosphorylation (STY)
K.QIASGR(+21.98).F Y 16.81 652.3268 6 -67.3 653.2902 1 93.57 1 52174 AEV 2_3_RA2_01_1224.d 4.26E4 1 1 989 994 Sodium adduct
R.Q(+42.01)GLYNPELEK.D Y 16.78 1231.6084 10 18.7 411.5511 3 37.47 2 14264 AEV_1_3_RA2_01_1232.d 4.24E5 2 2 39 48 Acetylation (N-term)
R.N(+42.01)LLC(+57.02)NMT(-18.01)HR.G Y 16.77 1181.5435 9 -77.4 591.7333 2 74.61 1 37557 AEV 2_3_RA2_01_1224.d 1.08E5 1 1 73 81 Acetylation (N-term); Carbamidomethylation; Dehydration
R.LTEDELK(+27.99).Y Y 16.73 874.4283 7 28.4 438.2339 2 59.07 3 31727 AEV_3_3_RA3_01_1233.d 3.32E5 1 1 1647 1653 Formylation
R.WT(+79.97)GIK(+226.08).Y Y 16.62 909.3820 5 25.9 304.1425 3 51.68 1 21160 AEV 2_3_RA2_01_1224.d 0 1 1 1115 1119 Phosphorylation (STY); Biotinylation
K.RVLEDEAAKTAASK.K Y 16.59 1487.7943 14 -21.9 496.9279 3 60.05 3 32455 AEV_3_3_RA3_01_1233.d 9.61E4 1 1 1547 1560
K.LSDEKIIENYK(+21.98).A Y 16.59 1372.6849 11 -14.7 687.3397 2 75.47 2 36975 AEV_1_3_RA2_01_1232.d 9.31E4 1 1 761 771 Sodium adduct
K.YQ(+.98)SAR.C Y 16.59 624.2867 5 16.8 625.3045 1 54.57 3 28728 AEV_3_3_RA3_01_1233.d 3.92E5 1 1 1654 1658 Deamidation (NQ)
K.G(+42.01)INTTR(+14.02).V Y 16.50 716.3817 6 -27.2 717.3695 1 89.58 3 54487 AEV_3_3_RA3_01_1233.d 7.52E4 1 1 1989 1994 Acetylation (N-term); Methylation(KR)
K.IIENYK(+27.99)ASVDGGILKVMSK.M Y 16.46 2092.1238 19 -28.3 524.0234 4 34.48 2 12820 AEV_1_3_RA2_01_1232.d 8.18E4 1 1 766 784 Formylation
K.THM(+15.99)GKDPREYC(+57.02)VM(+15.99)SK.E Y 16.45 1869.8171 15 -42.3 624.2533 3 49.74 1 20107 AEV 2_3_RA2_01_1224.d 0 1 1 1964 1978 Oxidation (M); Carbamidomethylation
R.AQAVGA(-.98) Y 16.44 514.2863 6 -22.1 515.2822 1 50.40 2 20638 AEV_1_3_RA2_01_1232.d 0 1 1 2120 2125 Amidation
K.T(+43.01)AASK(+42.01).K Y 16.44 561.2758 5 20.1 562.2944 1 38.36 3 18411 AEV_3_3_RA3_01_1233.d 9.63E4 1 1 1556 1560 Carbamylation; Acetylation (K)
K.TAQKVHEHRDEP(+31.99)KK(+42.01).S Y 16.44 1775.8914 14 48.4 445.0016 4 19.42 2 6166 AEV_1_3_RA2_01_1232.d 0 1 1 1577 1590 Dihydroxy; Acetylation (K)
R.NIVYK(-.98).G Y 16.44 634.3802 5 -12.6 635.3795 1 99.18 2 50747 AEV_1_3_RA2_01_1232.d 1.94E4 1 1 239 243 Amidation
K.SLLDSELSDGQYISAKDK.H Y 16.41 1967.9688 18 14.8 657.0066 3 73.37 3 42880 AEV_3_3_RA3_01_1233.d 1.77E4 1 1 1884 1901
R.VLEDEAAK.T Y 16.40 873.4443 8 -36.2 437.7137 2 64.41 1 29846 AEV 2_3_RA2_01_1224.d 1.78E5 1 1 1548 1555
R.N(+42.01)DAVVIATGATVAR.D Y 16.39 1398.7467 14 11.9 467.2617 3 74.18 2 36010 AEV_1_3_RA2_01_1232.d 9.62E4 1 1 1846 1859 Acetylation (N-term)
R.ATS(+79.97)AN(+.98)RVPVSSLLAT(+79.97)GLVHHHLVR.N Y 16.27 2695.3359 24 20.2 674.8549 4 77.72 3 46281 AEV_3_3_RA3_01_1233.d 0 1 1 683 706 Phosphorylation (STY); Deamidation (NQ)
K.NDKSYEAYAR(+.98).S Y 16.23 1216.5360 10 -35.1 609.2539 2 86.30 1 46802 AEV 2_3_RA2_01_1224.d 7.99E4 1 1 884 893 Deamidation (R)
R.V(+43.01)LEDEAAK(+14.02).T Y 16.23 930.4658 8 -79.2 311.1380 3 30.69 1 9337 AEV 2_3_RA2_01_1224.d 4.34E5 1 1 1548 1555 Carbamylation; Methylation(KR)
K.VHE(+21.98)HR.D Y 16.15 698.3224 5 -66.5 699.2833 1 56.03 1 23849 AEV 2_3_RA2_01_1224.d 7.15E4 1 1 1581 1585 Sodium adduct
R.SEKY(-18.01)RNAK.L Y 16.06 976.5090 8 1.2 489.2623 2 19.03 2 6009 AEV_1_3_RA2_01_1232.d 4.86E3 1 1 1627 1634 Dehydration
R.VDYGHTEVK(+42.01)THMGKDPR.E Y 16.04 2010.9581 17 -68.5 671.2808 3 89.09 1 48947 AEV 2_3_RA2_01_1224.d 6.14E4 1 1 1955 1971 Acetylation (K)
K.ASVDGGILKVM(+15.99)SK.M Y 16.03 1319.7119 13 -25.9 440.8999 3 48.45 3 24729 AEV_3_3_RA3_01_1233.d 1.48E4 1 1 772 784 Oxidation (M)
R.NLLC(+57.02)NMTHR(-.98).G Y 15.98 1156.5593 9 -69.3 579.2469 2 89.13 1 48981 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 73 81 Carbamidomethylation; Amidation
R.LDNK(+42.01)LIAES(+79.97)ELALEK(+14.02).G Y 15.94 1820.9172 15 23.8 607.9941 3 85.41 2 44591 AEV_1_3_RA2_01_1232.d 3.52E4 1 1 1294 1308 Acetylation (K); Phosphorylation (STY); Methylation(KR)
R.AIMAK(+21.98).L Y 15.92 554.2863 5 -26.0 555.2791 1 38.30 2 14664 AEV_1_3_RA2_01_1232.d 4.12E4 1 1 1228 1232 Sodium adduct
K.C(+57.02)SNPRS(+79.97)R.V Y 15.88 955.3695 7 76.2 319.4880 3 50.98 1 20767 AEV 2_3_RA2_01_1224.d 6.55E4 1 1 1069 1075 Carbamidomethylation; Phosphorylation (STY)
R.LLMTNNFPEFT(-18.01)GR.V Y 15.87 1520.7445 13 40.3 381.2087 4 48.10 3 24515 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 1698 1710 Dehydration
R.NLLC(+57.02)NMT(+79.97)HR.G Y 15.84 1237.5098 9 -27.5 413.4992 3 54.08 1 22609 AEV 2_3_RA2_01_1224.d 8.45E4 1 1 73 81 Carbamidomethylation; Phosphorylation (STY)
R.SKLM(+15.99)ENGDTM(+15.99)R.S Y 15.82 1312.5752 11 -44.4 657.2657 2 60.39 1 26770 AEV 2_3_RA2_01_1224.d 8.07E4 1 1 974 984 Oxidation (M)
R.ALGATLSY(+108.00)QISR.R Y 15.75 1386.6908 12 -2.6 463.2363 3 64.20 3 35656 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 1324 1335 O-Ethylphosphorylation
R.S(+114.04)LAAIIVETAEAR.E Y 15.70 1456.7886 13 -30.7 365.1932 4 49.63 2 20258 AEV_1_3_RA2_01_1232.d 0 1 1 711 723 Ubiquitin
K.SLLDSELS(+79.97)DGQYIS(+79.97)AK.D Y 15.69 1884.7794 16 17.0 629.2778 3 87.98 1 48094 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 1884 1899 Phosphorylation (STY)
K.KLSDEK(+226.08).I Y 15.69 944.4637 6 -60.9 473.2104 2 61.47 1 27583 AEV 2_3_RA2_01_1224.d 0 1 1 760 765 Biotinylation
K.S(+42.01)TVAS(-18.01)R.Q Y 15.61 643.3289 6 -15.8 644.3260 1 50.32 3 25932 AEV_3_3_RA3_01_1233.d 0 1 1 472 477 Acetylation (N-term); Dehydration
K.GINTTRVEWT(-18.01)K.S Y 15.59 1285.6779 11 17.0 643.8571 2 78.95 2 39732 AEV_1_3_RA2_01_1232.d 0 1 1 1989 1999 Dehydration
R.N(+42.01)K(+14.02)WRSLAAIIVETAEAR.E Y 15.58 1983.0901 17 -8.0 496.7758 4 66.76 3 37661 AEV_3_3_RA3_01_1233.d 9.07E4 1 1 707 723 Acetylation (N-term); Methylation(KR)
R.D(+164.06)DLPSSK.M Y 15.57 924.4205 7 -25.6 309.1396 3 35.71 1 12043 AEV 2_3_RA2_01_1224.d 0 1 1 1252 1258 O-Diisopropylphosphorylation
R.IIDDTE(+21.98)LK(+42.01)STVASRQDFR.S Y 15.56 2157.0679 18 -6.8 540.2706 4 48.36 3 24674 AEV_3_3_RA3_01_1233.d 0 1 1 464 481 Sodium adduct; Acetylation (K)
K.V(+42.01)SAEIGK(+42.01)TR.H Y 15.54 1043.5610 9 18.4 348.8673 3 53.17 3 27821 AEV_3_3_RA3_01_1233.d 3.67E4 1 1 1029 1037 Acetylation (N-term); Acetylation (K)
K.MRDDLPSSK.M Y 15.53 1047.5018 9 -5.2 524.7555 2 24.62 3 10416 AEV_3_3_RA3_01_1233.d 5.73E4 1 1 1250 1258
K.TAASK(+14.02).K Y 15.42 490.2751 5 -60.8 491.2525 1 52.27 2 21611 AEV_1_3_RA2_01_1232.d 0 1 1 1556 1560 Methylation(KR)
K.AS(+87.05)VDGGILK.V Y 15.39 945.5317 9 -15.3 316.1797 3 57.09 1 24472 AEV 2_3_RA2_01_1224.d 7.6E5 1 1 772 780 Phosphorylation to amine thiol
K.MGISTLQSYK(+14.02).G Y 15.38 1140.5848 10 3.1 381.2034 3 43.32 3 21487 AEV_3_3_RA3_01_1233.d 0 1 1 785 794 Methylation(KR)
K.T(+79.96)HMGKDPR.E Y 15.38 1020.4117 8 19.8 341.1512 3 50.61 1 20544 AEV 2_3_RA2_01_1224.d 5.32E5 1 1 1964 1971 Sulfation
K.GLPCR(+14.02).I Y 15.36 558.2948 5 29.8 559.3187 1 32.51 2 11886 AEV_1_3_RA2_01_1232.d 0 1 1 1309 1313 Methylation(KR)
K.LIAESELALEK(+27.99)GLPC(+57.02)R(+14.02).I Y 15.33 1839.9763 16 -8.7 614.3274 3 76.90 3 45620 AEV_3_3_RA3_01_1233.d 8.46E4 1 1 1298 1313 Formylation; Carbamidomethylation; Methylation(KR)
K.VSAEIGK(+70.04).T Y 15.32 772.4330 7 -27.1 387.2133 2 33.62 2 12420 AEV_1_3_RA2_01_1232.d 2.94E4 1 1 1029 1035 Crotonaldehyde
K.VSAEIGK(+43.01).T Y 15.24 745.3970 7 -58.3 746.3608 1 48.19 3 24569 AEV_3_3_RA3_01_1233.d 2.63E4 1 1 1029 1035 Carbamylation
K.SPILSLS(+79.97)EFNAIK(+42.01).N Y 15.21 1539.7585 13 10.4 385.9509 4 57.66 3 30710 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 616 628 Phosphorylation (STY); Acetylation (K)
R.T(+42.01)INEMVGR(+14.02).A Y 15.20 974.4855 8 -42.0 325.8221 3 44.71 1 17122 AEV 2_3_RA2_01_1224.d 1E6 1 1 1237 1244 Acetylation (N-term); Methylation(KR)
R.NLLCNMTHR(+14.02).G Y 15.17 1114.5376 9 -54.8 558.2455 2 85.01 1 45856 AEV 2_3_RA2_01_1224.d 0 1 1 73 81 Methylation(KR)
R.IIDDTELK(+43.99)S(+79.97)TVASR.Q Y 15.14 1670.7764 14 -42.7 557.9089 3 67.77 1 32248 AEV 2_3_RA2_01_1224.d 5.72E4 1 1 464 477 Carboxylation (DKW); Phosphorylation (STY)
R.ATSAN(+.98)R(+28.03).V Y 15.11 647.3239 6 8.4 648.3365 1 74.25 2 36069 AEV_1_3_RA2_01_1232.d 0 1 1 683 688 Deamidation (NQ); Dimethylation(KR)
R.K(+27.99)Q(+.98)DHRLHVR.L Y 15.10 1216.6425 9 -5.4 609.3252 2 28.53 3 12541 AEV_3_3_RA3_01_1233.d 1.55E5 1 1 1285 1293 Formylation; Deamidation (NQ)
K.KR(+14.02)NALILDKT(+79.97)K.G Y 15.09 1392.7854 11 -93.9 465.2255 3 80.71 1 42452 AEV 2_3_RA2_01_1224.d 0 1 1 1608 1618 Methylation(KR); Phosphorylation (STY)
R.DEPKKS(+86.00)DILDIEDTISDLK.T Y 15.08 2259.1006 19 15.0 565.7909 4 78.15 3 46618 AEV_3_3_RA3_01_1233.d 5.16E4 1 1 1586 1604 Malonylation
K.SAS(+79.97)GGWDMK.T Y 15.06 1017.3627 9 79.0 340.1550 3 30.14 1 9036 AEV 2_3_RA2_01_1224.d 0 1 1 2000 2008 Phosphorylation (STY)
R.EGVLR.S N 15.05 572.3282 5 11.5 573.3420 1 100.50 1 55874 AEV 2_3_RA2_01_1224.d 1.85E5 1 1 311 315
K.GK(+27.99)ASHK.I Y 15.00 654.3449 6 -74.3 655.3036 1 66.32 1 31119 AEV 2_3_RA2_01_1224.d 5.72E4 1 1 61 66 Formylation
total 261 peptides
C1G002
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IAIIHVGAPAGGMNPATR.A Y 152.34 1744.9407 18 1.7 582.6552 3 70.90 2 33561 AEV_1_3_RA2_01_1232.d 5.06E5 4 4 406 423
R.MSIHC(+57.02)GC(+57.02)EAYAVHEGYEGLVR.G Y 121.36 2437.0613 21 1.7 610.2736 4 69.27 3 39682 AEV_3_3_RA3_01_1233.d 6.87E4 1 1 40 60 Carbamidomethylation
R.SKNEIAADPMSSVVIGIK.G Y 119.92 1857.9869 18 1.4 620.3371 3 76.36 2 37677 AEV_1_3_RA2_01_1232.d 2.38E5 2 2 708 725
K.AVLEAKPGDPSPLITLR.E Y 113.05 1776.0144 17 0.4 593.0123 3 75.09 3 44188 AEV_3_3_RA3_01_1233.d 9.52E4 1 1 323 339
R.GGTAC(+57.02)AYDRWLGTLQGIEAVK.A Y 112.75 2265.1211 21 0.9 756.0483 3 82.46 3 49921 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 302 322 Carbamidomethylation
R.IAIIHVGAPAGGM(+15.99)NPATR.A Y 112.04 1760.9355 18 6.3 587.9895 3 66.19 2 30083 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 406 423 Oxidation (M)
R.GHTPIAIYNGFPGLC(+57.02)R.H Y 109.98 1771.8828 16 -1.2 591.6342 3 76.98 3 45677 AEV_3_3_RA3_01_1233.d 4.42E5 4 4 433 448 Carbamidomethylation
K.TYTTQVVADMIKEEAK.G Y 105.19 1825.9131 16 9.5 609.6508 3 78.09 2 39044 AEV_1_3_RA2_01_1232.d 1.75E5 2 2 648 663
R.IC(+57.02)EAVDEVFDTAASHQR.G Y 101.09 1946.8792 17 -30.0 649.9475 3 72.77 3 42404 AEV_3_3_RA3_01_1233.d 9.97E4 3 3 185 201 Carbamidomethylation
R.GIDALVVC(+57.02)GGDGSLTGADIFR.S Y 97.61 2092.0259 21 1.1 1047.0214 2 85.98 3 52358 AEV_3_3_RA3_01_1233.d 5.13E5 4 4 109 129 Carbamidomethylation
K.WLESDSWVNEGGSEIGTNR.G Y 95.52 2134.9556 19 2.4 1068.4877 2 78.22 3 46675 AEV_3_3_RA3_01_1233.d 1.37E5 2 2 463 481
R.VAVLTSGGDAPGMNGVVR.A Y 88.99 1698.8723 18 1.4 850.4446 2 71.35 2 33860 AEV_1_3_RA2_01_1232.d 1.69E5 3 3 18 35
R.AYINTATPHHPK.M Y 88.50 1348.6887 12 3.0 675.3536 2 30.41 2 10894 AEV_1_3_RA2_01_1232.d 1.69E6 5 5 384 395
R.AAVAYC(+57.02)LAR.G Y 80.59 993.5065 9 -1.7 497.7597 2 54.60 3 28794 AEV_3_3_RA3_01_1233.d 1.45E6 4 4 424 432 Carbamidomethylation
K.C(+57.02)VQHIEQFQGR.S Y 79.51 1400.6619 11 3.5 467.8962 3 44.08 2 17480 AEV_1_3_RA2_01_1232.d 1.01E5 2 2 697 707 Carbamidomethylation
K.TVGQALKDRDFATALSMR.D Y 77.76 1979.0258 18 4.8 495.7661 4 72.11 3 41880 AEV_3_3_RA3_01_1233.d 1.88E5 2 2 357 374
R.GHTPIAIYN(+.98)GFPGLC(+57.02)R.H Y 76.24 1772.8668 16 3.7 591.9651 3 77.76 3 46336 AEV_3_3_RA3_01_1233.d 1.78E5 2 2 433 448 Deamidation (NQ); Carbamidomethylation
K.IPLVILPATISNNVPGTEYSLGSDTC(+57.02)LNTLVNFC(+57.02)DVIR.Q Y 75.79 4175.1284 38 -0.7 1392.7158 3 96.45 3 57825 AEV_3_3_RA3_01_1233.d 8.34E4 2 2 530 567 Carbamidomethylation
K.NDFWLTLK.S Y 70.43 1035.5389 8 -1.4 518.7760 2 80.18 3 48240 AEV_3_3_RA3_01_1233.d 2.99E5 2 2 754 761
R.VTVLGHTQR.G Y 69.50 1009.5669 9 -15.3 505.7830 2 31.00 2 11213 AEV_1_3_RA2_01_1232.d 1.4E6 9 9 293 301
R.VFVIETQGGR.S Y 67.73 1104.5928 10 0.1 553.3037 2 62.41 2 27474 AEV_1_3_RA2_01_1232.d 3.65E5 3 3 577 586
R.SEWPGLLDELVK.R Y 64.40 1384.7238 12 0.2 693.3693 2 86.60 3 52776 AEV_3_3_RA3_01_1233.d 1.5E5 2 2 130 141
R.VAVLTSGGDAPGM(+15.99)NGVVR.A Y 64.40 1714.8672 18 -1.8 858.4393 2 64.48 3 35862 AEV_3_3_RA3_01_1233.d 3.79E4 1 1 18 35 Oxidation (M)
M.A(+42.01)NVTNMSPVSQSK.R Y 64.16 1403.6715 13 -9.2 702.8365 2 66.85 3 37806 AEV_3_3_RA3_01_1233.d 1.87E5 2 2 2 14 Acetylation (Protein N-term)
K.ISSSSVKDVLNNRLK.L Y 62.84 1658.9315 15 -3.3 415.7388 4 63.51 3 35139 AEV_3_3_RA3_01_1233.d 8.6E4 1 1 274 288
R.SKN(+.98)EIAADPMSSVVIGIK.G Y 60.39 1858.9709 18 12.4 620.6719 3 76.39 2 37702 AEV_1_3_RA2_01_1232.d 4.04E4 1 1 708 725 Deamidation (NQ)
R.HHADTPIGSVR.E Y 56.27 1188.6000 11 2.8 595.3089 2 29.13 2 10319 AEV_1_3_RA2_01_1232.d 1.15E6 7 7 449 459
K.TAEC(+57.02)FELYKFDALFVIGGFEAFTAVSQLRK.A Y 53.98 3456.7427 30 -8.7 865.1854 4 97.47 2 50158 AEV_1_3_RA2_01_1232.d 0 1 1 491 520 Carbamidomethylation
R.IC(+57.02)EAVDE(+14.02)VFDTAASHQR.G Y 51.44 1960.8949 17 -7.8 654.6338 3 75.04 3 44150 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 185 201 Carbamidomethylation; Methylation(others)
R.VAVLTSGGDAPGMN(+.98)GVVR.A Y 49.18 1699.8563 18 1.1 850.9364 2 71.78 2 34183 AEV_1_3_RA2_01_1232.d 2.27E5 1 1 18 35 Deamidation (NQ)
R.WLGTLQGIEAVK.A Y 48.23 1313.7343 12 -1.8 657.8732 2 78.92 3 47226 AEV_3_3_RA3_01_1233.d 3.3E4 1 1 311 322
R.GGTLIGSAR.C Y 47.88 830.4610 9 -2.5 416.2367 2 32.93 3 15102 AEV_3_3_RA3_01_1233.d 6.42E5 3 3 80 88
K.IILRNETVSK.T Y 47.70 1171.6924 10 -7.6 586.8490 2 40.46 3 19671 AEV_3_3_RA3_01_1233.d 6.57E4 2 2 638 647
R.AAVAYC(+57.02)LAR(+14.02).G Y 46.88 1007.5222 9 -0.5 504.7681 2 60.75 3 33064 AEV_3_3_RA3_01_1233.d 2.49E5 1 1 424 432 Carbamidomethylation; Methylation(KR)
R.SSLVEAVR.V Y 46.52 859.4763 8 -1.2 430.7449 2 47.23 3 23955 AEV_3_3_RA3_01_1233.d 5.51E5 7 7 346 353
K.TYTTQVVADMIKEEAK(+14.02).G Y 46.21 1839.9288 16 0.4 614.3171 3 79.05 3 47324 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 648 663 Methylation(KR)
R.GFVIEVMGR.N Y 44.89 1006.5270 9 0.5 504.2710 2 76.48 3 45284 AEV_3_3_RA3_01_1233.d 4.17E5 4 4 202 210
M.A(+42.01)NVTNM(+15.99)SPVSQSK.R Y 44.60 1419.6664 13 -2.0 710.8391 2 55.59 3 29279 AEV_3_3_RA3_01_1233.d 1.49E5 3 3 2 14 Acetylation (Protein N-term); Oxidation (M)
M.A(+42.01)NVTNMSPVSQSKR.R Y 43.26 1559.7726 14 1.7 780.8949 2 61.77 2 27042 AEV_1_3_RA2_01_1232.d 1.31E5 2 2 2 15 Acetylation (Protein N-term)
M.A(+42.01)NVTNM(+15.99)SPVSQSKR.R Y 41.79 1575.7675 14 -3.3 788.8884 2 46.24 3 23345 AEV_3_3_RA3_01_1233.d 7.99E4 2 2 2 15 Acetylation (Protein N-term); Oxidation (M)
R.IAIIHVGAPAGGMNPAT(-2.02)R.A Y 38.76 1742.9249 18 -26.4 581.9669 3 70.08 3 40285 AEV_3_3_RA3_01_1233.d 8.62E4 1 1 406 423 2-amino-3-oxo-butanoic_acid
R.GLPSADMAK.T Y 37.49 888.4375 9 7.4 445.2293 2 44.84 3 22458 AEV_3_3_RA3_01_1233.d 4.59E5 2 2 482 490
R.EQYPAFK.I Y 37.20 881.4283 7 0.1 441.7215 2 46.45 3 23465 AEV_3_3_RA3_01_1233.d 7.61E5 4 4 523 529
K.TVGQ(+.98)ALKDRDFATALSMR.D Y 36.81 1980.0098 18 6.0 496.0127 4 73.23 2 35299 AEV_1_3_RA2_01_1232.d 9.88E4 1 1 357 374 Deamidation (NQ)
R.SKNEIAADPM(-4.99)SSVVIGIK.G Y 35.66 1853.0006 18 -45.2 618.6462 3 75.83 3 44785 AEV_3_3_RA3_01_1233.d 7.73E4 1 1 708 725 Methionine replacement by azido homoalanine
R.DIEYLR.H N 34.84 807.4127 6 -1.7 404.7129 2 59.01 3 31675 AEV_3_3_RA3_01_1233.d 6.31E5 4 4 618 623
R.GLPSADM(+15.99)AK.T Y 33.58 904.4324 9 -79.9 453.1873 2 49.06 1 19693 AEV 2_3_RA2_01_1224.d 7.22E5 6 6 482 490 Oxidation (M)
R.WLGTLQGIEAVK(+21.98)(+42.01).A Y 31.77 1377.7268 12 0.7 460.2499 3 59.79 2 25739 AEV_1_3_RA2_01_1232.d 3.9E4 1 1 311 322 Sodium adduct; Acetylation (K)
K.M(+15.99)QLPENMR.M Y 31.71 1033.4685 8 25.7 517.7548 2 40.54 3 19719 AEV_3_3_RA3_01_1233.d 1.49E5 2 2 396 403 Oxidation (M)
R.DFATALSMR.D Y 30.12 1010.4855 9 -74.3 506.2125 2 68.43 1 32833 AEV 2_3_RA2_01_1224.d 2.21E5 4 4 366 374
R.HNFATDRGASHAGK.I Y 28.99 1467.6967 14 12.8 490.2458 3 14.05 3 4639 AEV_3_3_RA3_01_1233.d 4.58E4 1 1 624 637
R.A(+43.01)AVAYC(+57.02)LAR.G Y 27.85 1036.5123 9 42.4 519.2854 2 24.53 3 10307 AEV_3_3_RA3_01_1233.d 1.73E4 1 1 424 432 Carbamylation; Carbamidomethylation
R.GGT(+79.96)LIGSAR(+14.02).C Y 27.09 924.4335 9 69.2 309.1731 3 22.43 2 7409 AEV_1_3_RA2_01_1232.d 0 1 1 80 88 Sulfation; Methylation(KR)
R.SKNEIAAD(+6.01)PMSSVVIGIK.G Y 26.88 1863.9951 18 -35.5 622.3169 3 75.96 3 44889 AEV_3_3_RA3_01_1233.d 2.14E5 1 1 708 725 Replacement of proton by lithium
K.ISSSSVKDVLNNR(+14.02).L Y 26.48 1431.7682 13 0.9 478.2638 3 63.94 2 28516 AEV_1_3_RA2_01_1232.d 5.37E4 1 1 274 286 Methylation(KR)
K.ISSSSVK(+42.01).D Y 24.78 748.3967 7 -33.6 375.1931 2 47.38 1 18715 AEV 2_3_RA2_01_1224.d 2.74E5 4 4 274 280 Acetylation (K)
R.C(+57.02)(+226.08)KSFMERDGR.L Y 23.93 1510.6479 10 -58.6 504.5271 3 63.17 1 28908 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 89 98 Carbamidomethylation; Biotinylation
R.GGTLIGSARC(+57.02)K(+43.01)SFMER.D Y 22.76 1811.8771 16 -84.9 604.9150 3 94.25 1 52642 AEV 2_3_RA2_01_1224.d 3.49E5 1 1 80 95 Carbamidomethylation; Carbamylation
R.QS(+79.97)ASSS(+162.05)R.R Y 21.71 963.3546 7 51.5 322.1420 3 26.73 1 7331 AEV 2_3_RA2_01_1224.d 3.77E5 1 1 568 574 Phosphorylation (STY); Hexose (NSY)
R.QSASSSR(-.98).R Y 21.45 720.3514 7 -85.5 721.2971 1 19.41 1 4620 AEV 2_3_RA2_01_1224.d 5.04E4 1 1 568 574 Amidation
R.N(+27.99)ETVSK.T Y 20.76 704.3340 6 -68.6 705.2930 1 55.29 1 23348 AEV 2_3_RA2_01_1224.d 1.02E5 1 1 642 647 Formylation
K.DRDFATALSM(+31.99)R(+14.02).D Y 20.36 1327.6190 11 17.4 332.9178 4 32.80 1 10524 AEV 2_3_RA2_01_1224.d 4.99E5 1 1 364 374 Sulphone; Methylation(KR)
R.D(+43.99)FATALSMRDAEFK.A Y 20.03 1644.7454 14 -11.1 823.3708 2 89.84 1 49570 AEV 2_3_RA2_01_1224.d 0 1 1 366 379 Carboxylation (DKW)
R.HNFATDR.G Y 19.82 859.3937 7 33.8 430.7186 2 14.76 3 4986 AEV_3_3_RA3_01_1233.d 2.59E4 1 1 624 630
K.M(+15.99)QLPENM(+15.99)R.M Y 19.60 1049.4634 8 -40.3 525.7178 2 57.10 1 24481 AEV 2_3_RA2_01_1224.d 1.74E5 1 1 396 403 Oxidation (M)
MANVT(+79.97)NMS(+79.97)PVSQS(+79.97)K.R Y 19.49 1732.6003 14 42.4 434.1757 4 36.80 1 12604 AEV 2_3_RA2_01_1224.d 8.69E4 1 1 1 14 Phosphorylation (STY)
R.GWLSR.G Y 19.48 617.3286 5 7.7 618.3406 1 53.04 3 27735 AEV_3_3_RA3_01_1233.d 0 1 1 75 79
R.EQ(+.98)YPAFK.I Y 19.27 882.4123 7 -50.3 442.1912 2 59.87 1 26391 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 523 529 Deamidation (NQ)
R.Q(+43.01)S(+79.97)ASSSR.R Y 19.25 844.3076 7 31.2 845.3412 1 91.59 1 50775 AEV 2_3_RA2_01_1224.d 2.2E4 1 1 568 574 Carbamylation; Phosphorylation (STY)
R.AAKNM(+15.99)VLR.G Y 19.12 917.5117 8 -128.1 306.8053 3 57.69 1 24881 AEV 2_3_RA2_01_1224.d 1.11E5 1 1 101 108 Oxidation (M)
R.V(+27.99)FVIETQGGR.S Y 19.02 1132.5876 10 3.5 378.5378 3 53.63 2 22310 AEV_1_3_RA2_01_1232.d 8.24E4 1 1 577 586 Formylation
R.DFATALSMR(+14.02)DAEFK(+27.99).A Y 18.87 1642.7661 14 -41.5 411.6818 4 52.84 1 21871 AEV 2_3_RA2_01_1224.d 0 1 1 366 379 Methylation(KR); Formylation
K.WLESDSWVNEGGSE(+14.02)IGTNR.G Y 18.80 2148.9712 19 45.7 717.3638 3 79.94 3 48020 AEV_3_3_RA3_01_1233.d 0 1 1 463 481 Methylation(others)
K.MQLPENMR.M Y 18.70 1017.4736 8 -81.9 509.7024 2 67.40 1 31955 AEV 2_3_RA2_01_1224.d 7.95E4 1 1 396 403
K.TYTTQVVADM(+15.99)IK.E Y 18.55 1384.6908 12 -41.3 693.3241 2 32.82 3 15050 AEV_3_3_RA3_01_1233.d 0 1 1 648 659 Oxidation (M)
K.AVLEAKPGDP(+31.99)SPLIT(+79.97)LR.E Y 18.45 1887.9706 17 -7.2 630.3263 3 76.60 3 45377 AEV_3_3_RA3_01_1233.d 0 1 1 323 339 Dihydroxy; Phosphorylation (STY)
R.G(+42.01)GTLIGSAR.C Y 18.44 872.4716 9 -35.7 873.4477 1 92.77 3 56194 AEV_3_3_RA3_01_1233.d 0 1 1 80 88 Acetylation (N-term)
R.ALR(+31.99)M(+15.99)AIK.C Y 18.43 849.4742 7 -18.4 425.7365 2 60.89 3 33099 AEV_3_3_RA3_01_1233.d 9.85E5 1 1 690 696 Dihydroxy; Oxidation (M)
R.ICEAVDEVFDTAAS(+79.97)HQR.G Y 18.05 1969.8241 17 -28.1 657.5969 3 77.75 1 40052 AEV 2_3_RA2_01_1224.d 7.19E4 1 1 185 201 Phosphorylation (STY)
K.I(+42.01)SSSSVK.D Y 17.96 748.3967 7 -2.7 749.4019 1 82.93 2 42822 AEV_1_3_RA2_01_1232.d 3.56E4 1 1 274 280 Acetylation (N-term)
R.AAVAYCLAR(+14.02).G Y 17.90 950.5007 9 -17.2 476.2495 2 27.48 3 11959 AEV_3_3_RA3_01_1233.d 0 2 2 424 432 Methylation(KR)
K.SFMER.D N 17.79 668.2952 5 11.2 669.3099 1 63.81 2 28428 AEV_1_3_RA2_01_1232.d 1.1E4 1 1 91 95
K.AVLEAK(-1.03)PGDPSPLITLR.E Y 17.45 1774.9828 17 1.7 592.6692 3 75.63 2 37099 AEV_1_3_RA2_01_1232.d 0 1 1 323 339 Lysine oxidation to aminoadipic semialdehyde
R.EVK(-1.03)WLESDSWVNEGGSEIGTNR.G Y 17.40 2490.1299 22 14.5 831.0626 3 78.69 3 47051 AEV_3_3_RA3_01_1233.d 5.31E4 1 1 460 481 Lysine oxidation to aminoadipic semialdehyde
R.GFVIEVMGR(+14.02).N Y 17.34 1020.5426 9 -24.0 341.1800 3 29.12 3 12878 AEV_3_3_RA3_01_1233.d 3.22E5 1 1 202 210 Methylation(KR)
R.AYINT(-18.01)ATPHHPK.M Y 17.32 1330.6782 12 5.5 333.6786 4 27.68 3 12059 AEV_3_3_RA3_01_1233.d 4.02E5 1 1 384 395 Dehydration
MANVTN(+.98)MSPVSQSK(+42.01).R Y 17.13 1535.6960 14 -15.6 384.9253 4 52.96 1 22011 AEV 2_3_RA2_01_1224.d 1.31E6 1 1 1 14 Deamidation (NQ); Acetylation (K)
R.NETVSKTYTTQVVADMIK(+42.01).E Y 17.02 2069.0352 18 0.1 518.2661 4 58.67 2 25038 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 642 659 Acetylation (K)
R.GAS(+162.05)HAGK.I Y 16.81 788.3664 7 -18.8 395.1830 2 32.69 1 10469 AEV 2_3_RA2_01_1224.d 9.92E5 1 1 631 637 Hexose (NSY)
R.G(+28.03)ASHAGK.I Y 16.61 654.3449 7 10.1 655.3588 1 87.54 2 45937 AEV_1_3_RA2_01_1232.d 2.1E4 1 1 631 637 Ethylation
R.GWLSR(+.98).G Y 16.60 618.3126 5 25.5 619.3356 1 76.24 3 45098 AEV_3_3_RA3_01_1233.d 6.96E4 1 1 75 79 Deamidation (R)
R.W(+42.01)LGTLQGIEAVK(+226.08).A Y 16.54 1581.8225 12 6.8 528.2850 3 79.30 3 47521 AEV_3_3_RA3_01_1233.d 0 1 1 311 322 Acetylation (N-term); Biotinylation
R.K(+43.99)AREQYPAFK(+14.02).I Y 16.53 1294.6669 10 2.1 648.3420 2 56.71 3 30021 AEV_3_3_RA3_01_1233.d 0 1 1 520 529 Carboxylation (DKW); Methylation(KR)
R.QSASSSR.R Y 16.44 721.3354 7 -20.7 722.3278 1 44.10 3 21985 AEV_3_3_RA3_01_1233.d 0 1 1 568 574
R.G(+27.99)GTLIGSARC(+57.02)K(+42.01).S Y 16.42 1188.5920 11 -13.7 595.2952 2 21.94 3 8861 AEV_3_3_RA3_01_1233.d 4.28E4 1 1 80 90 Formylation; Carbamidomethylation; Acetylation (K)
R.GASHAGK.I Y 16.24 626.3136 7 24.6 627.3363 1 29.63 2 10538 AEV_1_3_RA2_01_1232.d 0 1 1 631 637
K.DRDF(+31.99)ATALSMR.D Y 16.23 1313.6034 11 -27.1 438.8632 3 83.73 1 44780 AEV 2_3_RA2_01_1224.d 5.21E4 1 1 364 374 Dihydroxy
K.TVGQ(+.98)ALK(+21.98).D Y 16.21 738.3888 7 3.6 739.3987 1 88.20 3 53712 AEV_3_3_RA3_01_1233.d 6.14E3 1 1 357 363 Deamidation (NQ); Sodium adduct
K.RGDLTDEQVMHFK.T Y 16.13 1574.7511 13 -1.1 394.6946 4 71.28 1 34944 AEV 2_3_RA2_01_1224.d 0 1 1 142 154
R.V(+42.01)TVLGHT(+79.97)QR.G Y 16.10 1131.5438 9 -64.6 378.1642 3 46.62 1 18233 AEV 2_3_RA2_01_1224.d 5.78E5 1 1 293 301 Acetylation (N-term); Phosphorylation (STY)
R.G(+42.01)GTLIGSARC(+57.02)K.S Y 16.06 1160.5972 11 -28.9 387.8618 3 14.67 3 4920 AEV_3_3_RA3_01_1233.d 9.7E4 1 1 80 90 Acetylation (N-term); Carbamidomethylation
R.AAVPGHFQQGGKPSPMDR.V Y 15.86 1878.9159 18 -3.0 627.3107 3 47.82 3 24336 AEV_3_3_RA3_01_1233.d 4.73E4 1 1 670 687
R.AY(+79.97)INTATPHHP(+31.99)K.M Y 15.75 1460.6449 12 -53.0 731.2910 2 48.43 1 19349 AEV 2_3_RA2_01_1224.d 2.72E5 1 1 384 395 Phosphorylation (STY); Dihydroxy
R.GGTLIGSARC(+57.02)K(+71.04).S Y 15.71 1189.6238 11 6.7 397.5512 3 76.16 2 37517 AEV_1_3_RA2_01_1232.d 4.55E4 1 1 80 90 Carbamidomethylation; Propionamide (K, X@N-term)
R.GGTLIGSARC(+57.02)K.S Y 15.69 1118.5865 11 -71.4 373.8428 3 9.39 3 2304 AEV_3_3_RA3_01_1233.d 0 1 1 80 90 Carbamidomethylation
K.ISSSSVK(+42.02).D Y 15.60 748.4079 7 15.5 375.2170 2 61.80 3 33817 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 274 280 Guanidination
K.T(+226.08)VGQALKDR.D Y 15.30 1212.6284 9 -8.4 304.1618 4 9.23 2 2226 AEV_1_3_RA2_01_1232.d 0 1 1 357 365 Biotinylation
R.Q(+.98)SASSSR(+14.02).R Y 15.23 736.3351 7 -65.7 737.2940 1 43.51 1 16422 AEV 2_3_RA2_01_1224.d 6.82E4 1 1 568 574 Deamidation (NQ); Methylation(KR)
K.I(+27.99)SSSSVK.D Y 15.23 734.3810 7 16.8 368.2039 2 24.94 2 8467 AEV_1_3_RA2_01_1232.d 0 1 1 274 280 Formylation
K.M(+226.08)QLPEN(+.98)MRMR.I Y 15.19 1531.6768 10 -16.9 766.8327 2 81.06 1 42660 AEV 2_3_RA2_01_1224.d 2.93E4 1 1 396 405 Biotinylation; Deamidation (NQ)
R.Q(+42.01)SASSSR(+14.02).R Y 15.19 777.3617 7 -26.0 778.3488 1 80.60 1 42307 AEV 2_3_RA2_01_1224.d 4.31E4 1 1 568 574 Acetylation (N-term); Methylation(KR)
R.HHAD(+43.99)TPIGSVR.E Y 15.19 1232.5897 11 -54.9 617.2683 2 80.84 1 42534 AEV 2_3_RA2_01_1224.d 2.89E1 1 1 449 459 Carboxylation (DKW)
K.ISSSSVK.D Y 15.18 706.3861 7 -33.4 354.1885 2 10.18 2 2551 AEV_1_3_RA2_01_1232.d 1.37E4 1 1 274 280
R.VFVIET(-18.01)QGGR.S Y 15.15 1086.5822 10 -0.7 544.2980 2 40.43 3 19652 AEV_3_3_RA3_01_1233.d 0 1 1 577 586 Dehydration
K.I(+42.01)SSSSVK(+14.02).D Y 15.12 762.4123 7 -29.1 382.2023 2 54.38 2 22692 AEV_1_3_RA2_01_1232.d 0 1 1 274 280 Acetylation (N-term); Methylation(KR)
R.WLGT(+79.96)LQ(+.98)GIEAVK.A Y 15.06 1394.6752 12 -5.7 465.8963 3 45.32 2 18093 AEV_1_3_RA2_01_1232.d 1.93E5 1 1 311 322 Sulfation; Deamidation (NQ)
total 116 peptides
C1G989
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.SLFDENYNLANTQQR.K Y 131.65 1811.8438 15 0.9 906.9300 2 75.47 2 36985 AEV_1_3_RA2_01_1232.d 1.07E6 6 6 633 647
R.SFDMFVPC(+57.02)GGRPESIDLSNVSR.L Y 128.67 2469.1416 22 12.6 824.0648 3 81.19 2 41520 AEV_1_3_RA2_01_1232.d 3.6E5 2 2 881 902 Carbamidomethylation
R.SASSLPDNHEQQLR.C Y 123.90 1580.7543 14 6.5 527.9288 3 40.10 2 15542 AEV_1_3_RA2_01_1232.d 3.33E6 11 11 243 256
R.TPGRQPSPQPTHLGIPGGTHR.V Y 112.57 2190.1406 21 0.7 439.0357 5 49.49 3 25414 AEV_3_3_RA3_01_1233.d 1.07E6 4 4 81 101
R.VLSEEGPGYVAAK.F Y 103.93 1318.6769 13 2.9 660.3477 2 58.45 2 24933 AEV_1_3_RA2_01_1232.d 4.65E5 4 4 102 114
R.VLVDESNVVLPSGEVVHNGTVFR.N Y 103.18 2465.2915 23 1.0 822.7719 3 79.05 2 39801 AEV_1_3_RA2_01_1232.d 1.63E5 2 2 849 871
K.YC(+57.02)AIVDGSGVIVDPQGLDHDELVR.L Y 99.38 2626.2698 24 0.4 876.4309 3 80.51 2 40970 AEV_1_3_RA2_01_1232.d 3.82E5 2 2 803 826 Carbamidomethylation
R.LQVDEPLDQEGLDKLVSK.T Y 97.77 2025.0630 18 0.3 676.0284 3 77.97 3 46476 AEV_3_3_RA3_01_1233.d 4.07E5 4 4 521 538
K.C(+57.02)HFN(-17.03)EPHPDPEETNIEIVGEKR.F Y 94.70 2629.1868 22 3.7 658.3064 4 70.82 2 33460 AEV_1_3_RA2_01_1232.d 1.27E5 1 1 263 284 Carbamidomethylation; Ammonia-loss (N)
K.AIYQEIIINAVAR.S Y 93.18 1472.8351 13 1.1 737.4257 2 82.29 2 42340 AEV_1_3_RA2_01_1232.d 6.47E5 6 6 295 307
R.SLFDENYNLANTQQRK.N Y 92.00 1939.9387 16 0.1 647.6536 3 69.08 3 39549 AEV_3_3_RA3_01_1233.d 3.6E5 2 2 633 648
K.TTIPYIVEGANLFLTQDSK.L Y 90.94 2109.0994 19 16.7 704.0521 3 88.29 3 53763 AEV_3_3_RA3_01_1233.d 0 1 1 909 927
R.VLSEEGPGYVAAKFEGK.K Y 90.16 1779.9043 17 10.5 594.3149 3 70.93 2 33541 AEV_1_3_RA2_01_1232.d 4.14E5 3 3 102 118
K.EGSGTGTPTTGFQRPPLINK.Q Y 85.22 2057.0542 20 5.4 686.6957 3 66.07 2 29996 AEV_1_3_RA2_01_1232.d 4.21E5 2 2 54 73
R.TETFTSDYILEIINKYPQLIHK.L Y 82.14 2665.4001 22 2.9 667.3593 4 87.66 2 46004 AEV_1_3_RA2_01_1232.d 4.45E4 1 1 470 491
R.KMQTGGPDGDLGSNEILLGNEK.Y Y 79.24 2272.1006 22 -2.7 758.3721 3 69.76 3 40047 AEV_3_3_RA3_01_1233.d 2.32E5 2 2 781 802
K.TNFYTPTK.V Y 77.29 970.4760 8 2.5 486.2465 2 44.74 3 22389 AEV_3_3_RA3_01_1233.d 2.16E6 10 10 562 569
K.IGLETILERVPISYLR.S Y 75.18 1871.0880 16 -5.3 624.7000 3 88.18 2 46289 AEV_1_3_RA2_01_1232.d 1.42E5 2 2 1061 1076
R.DKEAYAINAR.S Y 66.94 1149.5778 10 2.6 575.7977 2 33.94 2 12561 AEV_1_3_RA2_01_1232.d 7.02E5 4 4 623 632
R.SASSLPDNHE(+14.02)QQLR.C Y 65.48 1594.7699 14 5.4 532.6001 3 50.15 2 20525 AEV_1_3_RA2_01_1232.d 5.11E5 2 2 243 256 Methylation(others)
K.GVILLDVNHQNK.A Y 65.40 1348.7463 12 5.5 450.5919 3 63.76 2 28396 AEV_1_3_RA2_01_1232.d 2.97E4 2 2 659 670
R.SASSLPDNHEQQLR(+14.02).C Y 63.31 1594.7699 14 4.9 532.5999 3 50.53 2 20711 AEV_1_3_RA2_01_1232.d 1.74E5 2 2 243 256 Methylation(KR)
R.VLVDESNVVLPSGEVVHN(+.98)GTVFR.N Y 61.84 2466.2754 23 11.6 823.1086 3 81.01 2 41361 AEV_1_3_RA2_01_1232.d 1.21E5 1 1 849 871 Deamidation (NQ)
K.NAYRVETFR.S Y 61.46 1154.5833 9 2.8 385.8694 3 46.02 3 23202 AEV_3_3_RA3_01_1233.d 2.15E6 8 8 234 242
R.SLFDE(+14.02)NYNLANTQQR.K Y 61.21 1825.8595 15 -0.5 913.9365 2 78.74 2 39553 AEV_1_3_RA2_01_1232.d 8.08E4 2 2 633 647 Methylation(others)
K.TVVSENDEMVMNSFR.I Y 59.95 1756.7760 15 37.9 879.4285 2 75.59 3 44593 AEV_3_3_RA3_01_1233.d 1.45E5 4 4 539 553
K.NKDIPEGGAK.G Y 59.41 1027.5298 10 3.4 514.7739 2 13.51 2 3787 AEV_1_3_RA2_01_1232.d 3.04E5 3 3 649 658
K.TNFYTPTKVALSFR.L Y 55.68 1643.8671 14 6.8 548.9667 3 75.67 3 44655 AEV_3_3_RA3_01_1233.d 3.45E5 2 2 562 575
K.IGLETILER.V Y 54.86 1042.6022 9 -4.1 522.3062 2 78.37 3 46794 AEV_3_3_RA3_01_1233.d 2.23E4 1 1 1061 1069
R.SIFGSYLASR.F Y 54.17 1099.5662 10 12.7 550.7974 2 75.58 3 44586 AEV_3_3_RA3_01_1233.d 2.15E5 2 2 1077 1086
K.SFFTGKSPK.L Y 53.36 997.5233 9 -23.6 499.7571 2 38.23 3 18323 AEV_3_3_RA3_01_1233.d 3.15E5 2 2 737 745
K.AGC(+57.02)VIFKDASVNK.G Y 51.18 1407.7180 13 6.3 704.8707 2 56.49 3 29860 AEV_3_3_RA3_01_1233.d 2.66E4 1 1 933 945 Carbamidomethylation
K.LGGIPHDR.Y Y 50.54 863.4613 8 1.4 432.7385 2 27.84 3 12147 AEV_3_3_RA3_01_1233.d 2.91E5 3 3 746 753
K.AGC(+57.02)VIFK.D Y 47.76 793.4156 7 0.4 397.7152 2 47.46 3 24110 AEV_3_3_RA3_01_1233.d 1.73E5 2 2 933 939 Carbamidomethylation
R.VLSE(+14.02)EGPGYVAAK.F Y 46.73 1332.6925 13 -5.3 667.3500 2 63.48 3 35103 AEV_3_3_RA3_01_1233.d 5.66E4 2 2 102 114 Methylation(others)
K.LSPEGYR.V Y 46.66 820.4079 7 11.8 411.2161 2 34.12 2 12645 AEV_1_3_RA2_01_1232.d 9.12E5 4 4 842 848
R.AMIVEFDKSKLSPEGYR.V Y 46.31 1968.9978 17 5.8 493.2596 4 72.35 2 34617 AEV_1_3_RA2_01_1232.d 8.89E4 1 1 832 848
R.GAPWWKSFFTGK.S Y 45.58 1410.7084 12 3.7 471.2451 3 82.04 3 49621 AEV_3_3_RA3_01_1233.d 2.82E4 1 1 731 742
R.YGMTTLSVR.Q Y 45.33 1026.5168 9 1.9 514.2667 2 63.98 3 35485 AEV_3_3_RA3_01_1233.d 1.8E5 2 2 754 762
R.SLFDENYNLANTQQ(+.98)R.K Y 44.94 1812.8279 15 2.1 907.4231 2 76.21 2 37560 AEV_1_3_RA2_01_1232.d 5.83E4 1 1 633 647 Deamidation (NQ)
R.IDEKYIN(+.98)GC(+57.02)TPK.N Y 44.71 1437.6809 12 36.9 480.2519 3 50.16 2 20519 AEV_1_3_RA2_01_1232.d 2.25E5 4 4 222 233 Deamidation (NQ); Carbamidomethylation
R.S(-2.02)LFDENYNLANTQQR.K Y 41.03 1809.8281 15 55.1 604.3165 3 75.20 3 44281 AEV_3_3_RA3_01_1233.d 7.42E3 1 1 633 647 2-amino-3-oxo-butanoic_acid
K.VALSFR.L Y 40.34 691.4017 6 1.1 346.7085 2 57.73 3 30751 AEV_3_3_RA3_01_1233.d 6.85E5 4 4 570 575
R.SLFDENYNLANTQQR(+14.02).K Y 39.95 1825.8595 15 6.5 913.9430 2 76.19 2 37548 AEV_1_3_RA2_01_1232.d 8.02E4 1 1 633 647 Methylation(KR)
R.EVQEIIQR.N Y 38.69 1013.5505 8 -3.8 507.7806 2 48.23 3 24599 AEV_3_3_RA3_01_1233.d 1.06E5 3 3 988 995
K.SFFTGK.S Y 38.59 685.3435 6 9.0 686.3569 1 46.52 2 18688 AEV_1_3_RA2_01_1232.d 4.81E4 1 1 737 742
R.Q(-17.03)YVLGIYRK.L Y 38.29 1121.6233 9 1.8 561.8199 2 74.12 2 35963 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 763 771 Pyro-glu from Q
R.S(+43.01)FDMFVPC(+57.02)GGR(+14.02)PESIDLSNVSR.L Y 33.92 2526.1631 22 0.7 632.5485 4 74.67 3 43873 AEV_3_3_RA3_01_1233.d 1.67E5 1 1 881 902 Carbamylation; Carbamidomethylation; Methylation(KR)
R.IFNNAVLK.T Y 33.92 917.5334 8 -89.2 459.7331 2 71.70 1 35262 AEV 2_3_RA2_01_1224.d 3.14E5 1 1 554 561
K.LGIDPSTVR.K Y 30.82 956.5291 9 -4.5 479.2697 2 61.44 3 33539 AEV_3_3_RA3_01_1233.d 7.25E4 3 3 772 780
K.SRDKEAYAINAR.S Y 30.59 1392.7109 12 3.8 349.1863 4 27.05 2 9393 AEV_1_3_RA2_01_1232.d 4.77E5 5 5 621 632
K.YIN(+.98)GC(+57.02)TPK.N Y 29.85 952.4324 8 3.0 477.2249 2 28.96 2 10233 AEV_1_3_RA2_01_1232.d 6.47E5 6 6 226 233 Deamidation (NQ); Carbamidomethylation
R.QYVLGIYR.K Y 29.78 1010.5549 8 -92.3 506.2381 2 77.65 1 39972 AEV 2_3_RA2_01_1224.d 9.65E4 2 2 763 770
R.T(-18.01)PGR(+14.02)QPSPQPTHLGIPGGTHR.V Y 29.76 2186.1458 21 5.4 438.2388 5 53.11 2 22040 AEV_1_3_RA2_01_1232.d 0 1 1 81 101 Dehydration; Methylation(KR)
K.YINGC(+57.02)TPK.N Y 29.53 951.4484 8 -88.7 476.6893 2 35.15 1 11763 AEV 2_3_RA2_01_1224.d 3.04E5 3 3 226 233 Carbamidomethylation
K.NKDIPEGGAK(+43.01).G Y 28.84 1070.5356 10 3.3 536.2769 2 53.34 2 22163 AEV_1_3_RA2_01_1232.d 7.46E4 1 1 649 658 Carbamylation
K.LLLEK.I N 28.15 614.4003 5 -132.0 615.3264 1 60.84 1 27101 AEV 2_3_RA2_01_1224.d 4.3E5 4 4 1056 1060
R.SASSLPDN(+.98)HEQQLR.C Y 27.67 1581.7383 14 6.7 528.2569 3 44.79 2 17833 AEV_1_3_RA2_01_1232.d 0 1 1 243 256 Deamidation (NQ)
K.ATANTK(+27.99).A Y 27.13 632.3129 6 -11.0 633.3132 1 32.45 3 14838 AEV_3_3_RA3_01_1233.d 0 2 2 289 294 Formylation
K.ATAN(-17.03)TK.A Y 26.72 587.2915 6 -100.7 588.2396 1 63.82 1 29410 AEV 2_3_RA2_01_1224.d 9.17E3 1 1 289 294 Ammonia-loss (N)
R.VAFEK.Y Y 26.49 592.3220 5 -98.0 593.2712 1 33.82 1 11098 AEV 2_3_RA2_01_1224.d 5.89E4 2 2 673 677
R.LQVDEPLDQEGLDK.L Y 25.79 1597.7834 14 0.7 799.8996 2 71.00 2 33594 AEV_1_3_RA2_01_1232.d 5.23E4 1 1 521 534
K.V(+42.01)ALSFR.L Y 24.78 733.4122 6 11.3 367.7175 2 59.35 2 25460 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 570 575 Acetylation (N-term)
K.RFLQKATANTK.A Y 24.44 1276.7251 11 -6.7 320.1864 4 22.86 3 9365 AEV_3_3_RA3_01_1233.d 0 1 1 284 294
K.LDEELQ(+.98)K.T Y 23.88 874.4283 7 -86.9 438.1835 2 40.93 1 14989 AEV 2_3_RA2_01_1224.d 0 1 1 1029 1035 Deamidation (NQ)
R.EVQEIIQRNAR(+14.02).L Y 23.78 1368.7473 11 -4.4 457.2544 3 54.92 2 22966 AEV_1_3_RA2_01_1232.d 6.69E4 1 1 988 998 Methylation(KR)
K.DIPEGGAK.G Y 23.40 785.3919 8 -84.6 393.6700 2 26.03 1 7004 AEV 2_3_RA2_01_1224.d 6.42E4 1 1 651 658
R.NTFHLR.E Y 23.29 786.4136 6 -1.1 394.2137 2 30.07 3 13426 AEV_3_3_RA3_01_1233.d 1.75E5 1 1 872 877
K.KQMEAVMDELEEK(+188.03).G Y 22.93 1766.7599 13 -78.8 589.8809 3 33.07 1 10664 AEV 2_3_RA2_01_1224.d 5.53E4 1 1 120 132 Lipoyl
K.SR(+14.02)DKEAY(+31.99)AINAR.S Y 22.73 1438.7164 12 -48.7 360.6689 4 68.80 1 33046 AEV 2_3_RA2_01_1224.d 0 1 1 621 632 Methylation(KR); Dihydroxy
R.LYGMFLVISSEFR.G Y 22.50 1560.8010 13 -68.9 391.1807 4 65.42 1 30441 AEV 2_3_RA2_01_1224.d 0 1 1 590 602
R.EVQ(+.98)EIIQR.N Y 22.15 1014.5345 8 -5.8 508.2716 2 49.51 2 20199 AEV_1_3_RA2_01_1232.d 0 2 2 988 995 Deamidation (NQ)
R.YGM(+15.99)TTLSVR.Q Y 21.78 1042.5117 9 31.0 522.2793 2 49.22 3 25289 AEV_3_3_RA3_01_1233.d 5.23E4 2 2 754 762 Oxidation (M)
K.Y(+226.08)INGC(+57.02)TPK.N Y 21.76 1177.5260 8 15.2 393.5219 3 43.99 1 16684 AEV 2_3_RA2_01_1224.d 2.63E5 1 1 226 233 Biotinylation; Carbamidomethylation
K.SFFTGK(+21.98).S Y 21.67 707.3254 6 -16.2 708.3213 1 19.98 2 6397 AEV_1_3_RA2_01_1232.d 5.64E4 1 1 737 742 Sodium adduct
K.LRLEK.A N 21.66 657.4174 5 -24.3 658.4087 1 35.51 3 16643 AEV_3_3_RA3_01_1233.d 6.46E5 1 1 928 932
K.QLEM(+31.99)VIR.T Y 21.60 919.4797 7 -103.2 307.4689 3 57.89 1 25024 AEV 2_3_RA2_01_1224.d 7.84E4 1 1 74 80 Sulphone
R.LEFE(+14.02)AIWR.E Y 21.53 1076.5654 8 -115.8 359.8209 3 40.90 1 14934 AEV 2_3_RA2_01_1224.d 5.76E5 1 1 999 1006 Methylation(others)
K.Y(+42.01)INGCTPK.N Y 21.51 936.4375 8 13.8 469.2325 2 20.11 2 6454 AEV_1_3_RA2_01_1232.d 3.58E4 1 1 226 233 Acetylation (N-term)
K.ATANTK(+145.02)AIYQEIIINAVAR.S Y 21.49 2204.1624 19 -53.6 735.6887 3 81.90 3 49575 AEV_3_3_RA3_01_1233.d 2.93E4 1 1 289 307 3-(carbamidomethylthio)propanoyl
R.LTSS(-18.01)R.K Y 21.20 544.2969 5 -9.4 545.2990 1 67.39 3 38165 AEV_3_3_RA3_01_1233.d 0 1 1 350 354 Dehydration
R.VETFR.S Y 21.13 650.3387 5 -103.5 651.2787 1 35.00 1 11688 AEV 2_3_RA2_01_1224.d 5.19E4 2 2 238 242
R.LVIAYR.Q Y 21.05 733.4486 6 -7.0 367.7290 2 58.91 2 25176 AEV_1_3_RA2_01_1232.d 3.09E5 3 3 325 330
K.C(+57.02)HFNEPHPD(-18.01)PEETNIEIVGEKR.F Y 20.92 2628.2026 22 15.7 658.0682 4 70.14 3 40334 AEV_3_3_RA3_01_1233.d 0 1 1 263 284 Carbamidomethylation; Dehydration
R.VLSEEGPGY(-18.01)VAAK.F Y 20.73 1300.6663 13 1.0 651.3411 2 63.82 2 28434 AEV_1_3_RA2_01_1232.d 0 1 1 102 114 Dehydration
K.Q(+42.01)LEM(+15.99)VIR.T Y 20.70 945.4954 7 -40.9 316.1595 3 51.61 1 21109 AEV 2_3_RA2_01_1224.d 2.12E6 1 1 74 80 Acetylation (N-term); Oxidation (M)
K.SRDKEAY(-18.01)AINAR.S Y 20.39 1374.7003 12 -72.9 344.6573 4 63.82 1 29412 AEV 2_3_RA2_01_1224.d 1.47E5 1 1 621 632 Dehydration
R.Q(-17.03)GSAMGMFSALSDLYHYYR.L Y 20.19 2178.9502 19 6.8 1090.4897 2 93.41 2 48747 AEV_1_3_RA2_01_1232.d 4.03E4 1 1 331 349 Pyro-glu from Q
R.SMLSD(-18.01)K.L Y 20.17 661.3105 6 -65.4 662.2745 1 84.77 1 45597 AEV 2_3_RA2_01_1224.d 8.85E4 1 1 1016 1021 Dehydration
K.ATANTKAIYQEIIINAVAR(+14.02).S Y 19.83 2073.1582 19 -39.2 519.2765 4 76.56 2 37833 AEV_1_3_RA2_01_1232.d 8.66E4 1 1 289 307 Methylation(KR)
R.TETFTSDY(+162.05)ILEIIN(+.98)K.Y Y 19.76 1948.9404 15 20.2 488.2522 4 26.01 1 6989 AEV 2_3_RA2_01_1224.d 0 1 1 470 484 Hexose (NSY); Deamidation (NQ)
R.LAADFLPEHEYPQR.L Y 19.70 1684.8208 14 31.0 562.6316 3 70.85 2 33482 AEV_1_3_RA2_01_1232.d 5E4 2 2 576 589
K.L(+42.01)GIDPST(+79.97)VR.K Y 19.68 1078.5060 9 -58.2 540.2289 2 61.43 1 27549 AEV 2_3_RA2_01_1224.d 0 1 1 772 780 Acetylation (N-term); Phosphorylation (STY)
R.QYVLGIY(+79.97)R(+14.02)KLGIDPSTVR.K Y 19.40 2171.1504 18 -17.7 435.2297 5 64.19 3 35650 AEV_3_3_RA3_01_1233.d 0 1 1 763 780 Phosphorylation (STY); Methylation(KR)
K.ATANT(-18.01)K.A Y 19.38 586.3075 6 -18.2 587.3041 1 98.63 3 58607 AEV_3_3_RA3_01_1233.d 0 1 1 289 294 Dehydration
K.ATAN(+.98)T(-18.01)K.A Y 19.03 587.2915 6 -78.3 588.2528 1 95.31 1 53329 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 289 294 Deamidation (NQ); Dehydration
R.SGPVIEMFEIEGSREK.R Y 19.00 1806.8821 16 10.0 603.3073 3 62.94 2 27846 AEV_1_3_RA2_01_1232.d 6.22E4 1 1 308 323
R.QYVLGIYRK.L Y 18.68 1138.6499 9 -10.2 380.5534 3 60.80 3 33025 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 763 771
K.RAMIVEFD(-18.01)K(+14.02)SK.L Y 18.58 1318.7067 11 -29.5 330.6742 4 25.66 2 8822 AEV_1_3_RA2_01_1232.d 0 1 1 831 841 Dehydration; Methylation(KR)
R.QY(+79.97)VLGIY(+79.97)R.K Y 18.55 1170.4875 8 -41.0 586.2271 2 52.84 1 21873 AEV 2_3_RA2_01_1224.d 1.06E5 1 1 763 770 Phosphorylation (STY)
R.VLSEEGPGYVAAKFEGK(+21.98).K Y 18.52 1801.8862 17 -8.6 601.6309 3 61.67 3 33715 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 102 118 Sodium adduct
R.IDEKYIN(+.98)GCTPK.N Y 18.34 1380.6594 12 -3.0 346.1711 4 12.64 3 3831 AEV_3_3_RA3_01_1233.d 5.6E4 1 1 222 233 Deamidation (NQ)
K.ATANT(+79.97)K.A Y 18.32 684.2844 6 -25.8 685.2740 1 77.31 1 39704 AEV 2_3_RA2_01_1224.d 7.36E4 1 1 289 294 Phosphorylation (STY)
R.Q(+43.01)YVLGIYRKLGIDPS(+79.97)TVR.K Y 18.22 2200.1404 18 7.3 441.0386 5 64.98 2 29243 AEV_1_3_RA2_01_1232.d 4.73E4 1 1 763 780 Carbamylation; Phosphorylation (STY)
K.L(+226.08)DEELQ(+.98)K.T Y 18.16 1100.5060 7 -34.6 551.2412 2 84.72 1 45553 AEV 2_3_RA2_01_1224.d 1.14E5 1 1 1029 1035 Biotinylation; Deamidation (NQ)
R.K(+226.08)(+42.01)LGIDPSTVR.K Y 18.13 1352.7122 10 7.3 339.1878 4 22.53 3 9186 AEV_3_3_RA3_01_1233.d 0 1 1 771 780 Biotinylation; Acetylation (K)
K.V(+42.01)AAYAR.D Y 18.09 691.3653 6 -68.6 346.6662 2 78.57 1 40713 AEV 2_3_RA2_01_1224.d 0 1 1 178 183 Acetylation (N-term)
R.KLGIDPSTVR.K Y 17.99 1084.6240 10 -85.2 362.5178 3 65.85 1 30755 AEV 2_3_RA2_01_1224.d 9.51E4 1 1 771 780
R.Q(+.98)YVLGIYR.K Y 17.63 1011.5389 8 -30.0 338.1768 3 13.25 2 3686 AEV_1_3_RA2_01_1232.d 0 1 1 763 770 Deamidation (NQ)
R.S(+79.96)GPVIEMFEIEGSREK.R Y 17.56 1886.8390 16 58.7 472.7447 4 41.94 2 16431 AEV_1_3_RA2_01_1232.d 1.19E5 1 1 308 323 Sulfation
K.YINGC(+57.02)T(+79.97)PK(+28.03).N Y 17.49 1059.4460 8 7.4 354.1586 3 30.79 1 9389 AEV 2_3_RA2_01_1224.d 5.4E5 1 1 226 233 Carbamidomethylation; Phosphorylation (STY); Dimethylation(KR)
K.Y(+226.08)IN(+.98)GC(+57.02)TPK.N Y 17.12 1178.5100 8 -30.8 393.8318 3 51.66 1 21139 AEV 2_3_RA2_01_1224.d 0 1 1 226 233 Biotinylation; Deamidation (NQ); Carbamidomethylation
R.SMLSDKLSIAITKLDEELQK.T Y 17.04 2261.2188 20 10.5 566.3179 4 86.79 2 45490 AEV_1_3_RA2_01_1232.d 5.03E4 1 1 1016 1035
R.SLFDENYNLANTQ(+.98)QR.K Y 17.02 1812.8279 15 -87.8 907.3417 2 80.08 1 41908 AEV 2_3_RA2_01_1224.d 1.06E5 1 1 633 647 Deamidation (NQ)
R.DK(+14.02)EAYAINAR.S Y 17.01 1163.5934 10 31.8 388.8841 3 67.80 1 32272 AEV 2_3_RA2_01_1224.d 0 1 1 623 632 Methylation(KR)
K.A(+42.01)TANTK(+43.01).A Y 16.81 689.3344 6 -7.8 690.3363 1 56.98 3 30208 AEV_3_3_RA3_01_1233.d 0 1 1 289 294 Acetylation (N-term); Carbamylation
R.E(+42.01)HEETGMPR(+14.02)SMLS(+79.97)DK.L Y 16.80 1881.7638 15 23.9 628.2769 3 67.95 1 32398 AEV 2_3_RA2_01_1224.d 4.92E4 1 1 1007 1021 Acetylation (N-term); Methylation(KR); Phosphorylation (STY)
K.LSIAITKLDEELQK(+14.02).T Y 16.68 1613.9240 14 -31.1 404.4757 4 60.14 2 25980 AEV_1_3_RA2_01_1232.d 3.35E5 1 1 1022 1035 Methylation(KR)
K.DASVNK(+42.01).G Y 16.60 674.3235 6 41.2 675.3585 1 23.29 3 9590 AEV_3_3_RA3_01_1233.d 0 1 1 940 945 Acetylation (K)
R.DALPK.L N 16.37 542.3064 5 -43.8 543.2899 1 39.61 1 14185 AEV 2_3_RA2_01_1224.d 0 2 2 1051 1055
K.C(+57.02)HFNEPHPD(-18.01)PEETNIEIVGEK.R Y 16.29 2472.1016 21 8.2 825.0479 3 74.07 2 35930 AEV_1_3_RA2_01_1232.d 0 1 1 263 283 Carbamidomethylation; Dehydration
R.DIARGGIR.I Y 16.28 856.4879 8 29.3 429.2638 2 70.11 2 32928 AEV_1_3_RA2_01_1232.d 0 1 1 610 617
R.LE(+14.02)FEAIWR.E Y 16.25 1076.5654 8 7.6 359.8651 3 11.05 2 2866 AEV_1_3_RA2_01_1232.d 2.38E4 1 1 999 1006 Methylation(others)
K.SRDKEAYAIN(+.98)AR.S Y 16.19 1393.6949 12 -94.9 465.5282 3 67.49 1 32025 AEV 2_3_RA2_01_1224.d 9.74E4 1 1 621 632 Deamidation (NQ)
R.LIENGK(+42.01).T Y 16.15 714.3912 6 1.2 358.2033 2 14.90 2 4333 AEV_1_3_RA2_01_1232.d 0 1 1 903 908 Acetylation (K)
R.DKEAY(+44.99)AINAR.S Y 16.14 1194.5629 10 7.3 399.1978 3 46.33 1 18073 AEV 2_3_RA2_01_1224.d 0 1 1 623 632 Oxidation to nitro
K.LSIAIT(+79.97)K.L Y 16.05 824.4409 7 -30.5 413.2151 2 43.96 2 17424 AEV_1_3_RA2_01_1232.d 0 1 1 1022 1028 Phosphorylation (STY)
R.F(+42.01)LQKATAN(+.98)TK.A Y 15.90 1163.6187 10 -5.3 388.8781 3 54.74 2 22872 AEV_1_3_RA2_01_1232.d 8.93E5 1 1 285 294 Acetylation (N-term); Deamidation (NQ)
K.C(+27.99)HFNEPHPDPEETNIEIVGEKR.F Y 15.86 2617.1868 22 77.7 655.3548 4 70.82 2 33465 AEV_1_3_RA2_01_1232.d 0 1 1 263 284 Formylation
R.L(+27.99)EKAGC(+57.02)VIFK.D Y 15.86 1191.6321 10 -7.4 398.2150 3 47.87 3 24368 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 930 939 Formylation; Carbamidomethylation
R.N(+.98)TFHLR.E Y 15.74 787.3976 6 43.3 394.7231 2 30.38 3 13610 AEV_3_3_RA3_01_1233.d 2.14E5 1 1 872 877 Deamidation (NQ)
K.G(+42.01)GVTSSSLEVLASLSFDDK(+42.01).G Y 15.63 1994.9684 19 0.0 665.9967 3 68.90 2 32025 AEV_1_3_RA2_01_1232.d 1.58E4 1 1 946 964 Acetylation (N-term); Acetylation (K)
R.VLSEEGPGYVAAK(+226.08).F Y 15.63 1544.7544 13 -22.5 387.1872 4 66.36 1 31151 AEV 2_3_RA2_01_1224.d 0 1 1 102 114 Biotinylation
K.QMEAVMDELEEK(+14.02).G Y 15.62 1464.6476 12 6.9 367.1717 4 51.81 1 21243 AEV 2_3_RA2_01_1224.d 0 1 1 121 132 Methylation(KR)
K.TNFYTPTK(+14.02).V Y 15.59 984.4916 8 27.3 493.2665 2 54.95 2 22980 AEV_1_3_RA2_01_1232.d 0 1 1 562 569 Methylation(KR)
K.QLEM(+15.99)VIRTPGR.Q Y 15.53 1314.7078 11 -103.5 439.1978 3 61.05 1 27257 AEV 2_3_RA2_01_1224.d 1.02E4 2 2 74 84 Oxidation (M)
K.DAS(+79.97)VNK.G Y 15.41 712.2793 6 63.9 357.1697 2 28.18 1 8032 AEV 2_3_RA2_01_1224.d 0 1 1 940 945 Phosphorylation (STY)
R.K(+42.01)(+31.99)LGIDPSTVR.K Y 15.31 1158.6244 10 8.2 387.2186 3 42.09 3 20712 AEV_3_3_RA3_01_1233.d 0 1 1 771 780 Acetylation (N-term); Dihydroxy
K.DIPEGGAK(+123.01).G Y 15.29 908.4004 8 -1.5 455.2068 2 49.98 1 20234 AEV 2_3_RA2_01_1224.d 1.38E5 1 1 651 658 glycosylphosphatidylinositol
K.VALS(+114.04)FR.L Y 15.28 805.4446 6 16.6 403.7363 2 63.18 3 34874 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 570 575 Ubiquitin
K.QMEAVMDELEE(+614.16)K.G Y 15.28 2064.7935 12 12.3 689.2802 3 68.89 1 33107 AEV 2_3_RA2_01_1224.d 2.06E4 1 1 121 132 Hydroxyheme
K.L(+226.08)SPEGYR.V Y 15.24 1046.4855 7 18.2 524.2595 2 20.11 3 7885 AEV_3_3_RA3_01_1233.d 0 1 1 842 848 Biotinylation
K.LVANGLSSTHFSMSTRPGLSPFSSK.E Y 15.08 2607.3115 25 3.4 652.8374 4 91.81 3 55708 AEV_3_3_RA3_01_1233.d 0 1 1 29 53
total 143 peptides
C1G283
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.YKDVIETFIANEGMYTGQFIYAGK.N Y 170.44 2757.3359 24 3.8 920.1227 3 89.05 2 46769 AEV_1_3_RA2_01_1232.d 6.38E5 2 2 69 92
K.NAALTVGNILPLGSVPEGTVVTNVEEK.I Y 166.43 2720.4595 27 1.7 1361.2393 2 86.30 2 45195 AEV_1_3_RA2_01_1232.d 3.02E6 11 11 93 119
R.TSGNYVTVIGHNPEEGKTR.V Y 153.53 2058.0129 19 3.1 515.5121 4 56.35 2 23753 AEV_1_3_RA2_01_1232.d 9.69E6 21 21 129 147
R.TSGNYVTVIGHNPEEGK.T Y 111.78 1800.8643 17 2.7 601.2970 3 60.58 2 26277 AEV_1_3_RA2_01_1232.d 1.82E6 8 8 129 145
K.NAALTVGNILPLGSVPEGTVVTNVEEK(+14.02).I Y 99.12 2734.4753 27 -0.3 912.4988 3 87.47 3 53301 AEV_3_3_RA3_01_1233.d 2.02E6 14 14 93 119 Methylation(KR)
R.TSGNYVTVIGHNPEEGKTR(+14.02).V Y 86.66 2072.0286 19 -1.4 519.0137 4 57.05 3 30263 AEV_3_3_RA3_01_1233.d 9.75E5 4 4 129 147 Methylation(KR)
R.TSGNYVTVIGHNPEEGK(+14.02)TR.V Y 83.12 2072.0286 19 -1.4 691.6825 3 58.18 3 31071 AEV_3_3_RA3_01_1233.d 7.57E5 6 6 129 147 Methylation(KR)
R.GMVGIVAGGGRTDKPLLK.A Y 82.97 1768.0029 18 -15.3 590.3326 3 66.77 2 30562 AEV_1_3_RA2_01_1232.d 6.95E5 3 3 164 181
R.LNKAPAQFR.T Y 80.53 1043.5875 9 -0.4 348.8696 3 30.07 3 13423 AEV_3_3_RA3_01_1233.d 5.48E6 12 12 22 30
R.GM(+15.99)VGIVAGGGR.T Y 79.04 988.5124 11 4.0 495.2655 2 39.52 2 15236 AEV_1_3_RA2_01_1232.d 6.31E5 7 7 164 174 Oxidation (M)
R.TLDYAER.H Y 75.82 866.4134 7 4.1 434.2158 2 32.61 3 14975 AEV_3_3_RA3_01_1233.d 3.39E6 11 11 31 37
R.TSGN(+.98)YVTVIGHNPEEGKTR.V Y 74.41 2058.9971 19 8.4 515.7609 4 54.38 3 28602 AEV_3_3_RA3_01_1233.d 1.37E6 4 4 129 147 Deamidation (NQ)
K.NAALTVGNILPLGSVPEGTVVTNVEEKIGDR.G Y 74.36 3161.6931 31 -2.7 1054.9021 3 87.12 3 53070 AEV_3_3_RA3_01_1233.d 1.23E5 2 2 93 123
K.NAALTVGN(+.98)ILPLGSVPEGTVVTNVEEK.I Y 74.24 2721.4436 27 6.0 908.1606 3 86.11 3 52448 AEV_3_3_RA3_01_1233.d 3.31E5 2 2 93 119 Deamidation (NQ)
R.GMVGIVAGGGR.T Y 72.48 972.5175 11 2.2 487.2671 2 60.93 2 26484 AEV_1_3_RA2_01_1232.d 1.3E6 6 6 164 174
K.Q(-17.03)IVHDPGRGAPLAK.V Y 72.38 1440.7837 14 3.8 481.2703 3 58.83 2 25160 AEV_1_3_RA2_01_1232.d 1.19E6 5 5 47 60 Pyro-glu from Q
K.Q(-17.03)IVHDPGR.G Y 66.60 903.4562 8 0.3 452.7355 2 38.88 3 18735 AEV_3_3_RA3_01_1233.d 3.69E6 12 12 47 54 Pyro-glu from Q
R.TSGNYVTVIGHNPE(+14.02)EGKTR.V Y 66.41 2072.0286 19 -18.5 519.0048 4 60.17 3 32533 AEV_3_3_RA3_01_1233.d 0 1 1 129 147 Methylation(others)
R.GM(+15.99)VGIVAGGGRTDKPLLK.A Y 64.37 1783.9978 18 0.5 447.0069 4 58.65 3 31402 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 164 181 Oxidation (M)
R.TSGN(+.98)YVTVIGHN(+.98)PEEGKTR.V Y 63.54 2059.9810 19 21.6 687.6824 3 56.44 2 23785 AEV_1_3_RA2_01_1232.d 2.73E4 1 1 129 147 Deamidation (NQ)
K.QIVHDPGRGAPLAK.V Y 59.81 1457.8103 14 6.0 486.9470 3 39.19 3 18905 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 47 60
K.QIVHDPGR.G Y 59.68 920.4828 8 3.6 461.2503 2 20.35 2 6554 AEV_1_3_RA2_01_1232.d 2.07E6 12 12 47 54
R.TDKPLLK.A Y 57.54 813.4960 7 0.4 407.7554 2 18.21 3 6871 AEV_3_3_RA3_01_1233.d 1.49E6 6 6 175 181
K.N(+.98)AALTVGNILPLGSVPEGTVVTNVEEK.I Y 57.39 2721.4436 27 0.9 908.1559 3 89.77 2 47115 AEV_1_3_RA2_01_1232.d 2.21E5 3 3 93 119 Deamidation (NQ)
R.ARGM(+15.99)VGIVAGGGR.T Y 56.18 1215.6506 13 -10.3 406.2200 3 33.82 2 12510 AEV_1_3_RA2_01_1232.d 3.79E5 5 5 162 174 Oxidation (M)
R.GMVGIVAGGGR(+14.02).T Y 54.66 986.5331 11 -0.1 494.2738 2 63.79 2 28416 AEV_1_3_RA2_01_1232.d 8.32E4 1 1 164 174 Methylation(KR)
R.TLDYAERHGYIR.G Y 52.69 1492.7422 12 -1.0 498.5875 3 51.17 3 26489 AEV_3_3_RA3_01_1233.d 9.06E5 7 7 31 42
K.NAALTVGNILPLGSVPE(+14.02)GTVVTNVEEK.I Y 52.50 2734.4753 27 2.3 912.5012 3 88.03 2 46205 AEV_1_3_RA2_01_1232.d 6.45E5 1 1 93 119 Methylation(others)
K.NAALTVGNILPLGSVPEGTVVTN(+.98)VEEK.I Y 50.93 2721.4436 27 3.4 908.1583 3 87.24 2 45763 AEV_1_3_RA2_01_1232.d 1.18E5 1 1 93 119 Deamidation (NQ)
K.YKDVIETFIANE(+14.02)GMYTGQFIYAGK.N Y 47.94 2771.3516 24 14.5 924.8046 3 93.27 2 48691 AEV_1_3_RA2_01_1232.d 6.45E4 1 1 69 92 Methylation(others)
K.NAALTVGNILPLGSVPEGTVVTNVEEK(+28.03).I Y 46.19 2748.4910 27 -9.6 1375.2396 2 88.25 2 46323 AEV_1_3_RA2_01_1232.d 5.91E4 1 1 93 119 Dimethylation(KR)
R.VKLPSGAK.K Y 44.82 798.4963 8 -97.4 400.2165 2 41.23 1 15180 AEV 2_3_RA2_01_1224.d 1.27E6 6 6 148 155
R.L(+42.01)NKAPAQFR.T Y 44.61 1085.5981 9 -5.3 362.8714 3 32.13 2 11705 AEV_1_3_RA2_01_1232.d 7.72E4 1 1 22 30 Acetylation (N-term)
K.IGDRGALGR.T Y 44.23 913.5093 9 -87.0 457.7222 2 42.27 1 15773 AEV 2_3_RA2_01_1224.d 6.47E6 14 14 120 128
K.AGLIAAR.R Y 44.16 670.4126 7 -89.8 336.1835 2 49.49 1 20015 AEV 2_3_RA2_01_1224.d 2.56E6 8 8 235 241
R.TSGNYVTVIGHNPEEGK(+14.02).T Y 43.30 1814.8799 17 6.8 605.9714 3 62.87 2 27797 AEV_1_3_RA2_01_1232.d 6.04E3 2 2 129 145 Methylation(KR)
K.APAQFR.T Y 42.62 688.3656 6 -0.3 345.1900 2 19.19 3 7395 AEV_3_3_RA3_01_1233.d 1.89E6 5 5 25 30
K.VSFRHPYK.Y Y 41.52 1032.5504 8 3.8 517.2844 2 33.15 2 12187 AEV_1_3_RA2_01_1232.d 1.03E6 3 3 61 68
R.TSGNYVTVIGHNPEE(+258.09)GK.T Y 41.41 2058.9495 17 -59.5 515.7140 4 65.89 1 30786 AEV 2_3_RA2_01_1224.d 1.63E6 1 1 129 145 Diglutamyl
R.GVAMNPVDHPHGGGNHQHIGK.A Y 41.11 2158.0239 21 3.5 540.5151 4 34.92 3 16287 AEV_3_3_RA3_01_1233.d 5.09E5 2 2 201 221
R.TGLLRGTQK.T Y 40.66 972.5716 9 -9.0 487.2887 2 22.67 3 9253 AEV_3_3_RA3_01_1233.d 7.45E4 3 3 243 251
R.TLDYAER(+14.02).H Y 39.53 880.4290 7 3.7 441.2234 2 45.91 2 18381 AEV_1_3_RA2_01_1232.d 2.04E6 7 7 31 37 Methylation(KR)
K.Q(-17.03)IVHDPGR(+14.02).G Y 38.12 917.4719 8 -86.6 459.7035 2 59.56 1 26171 AEV 2_3_RA2_01_1224.d 2.28E5 1 1 47 54 Pyro-glu from Q; Methylation(KR)
R.VKLPSGAKK.V Y 37.25 926.5912 9 3.2 464.3044 2 17.60 2 5400 AEV_1_3_RA2_01_1232.d 2.38E6 8 8 148 156
R.TSGNYVTVIGHNP(+13.98)EEGKTR.V Y 36.76 2071.9922 19 -72.7 518.9677 4 67.76 1 32239 AEV 2_3_RA2_01_1224.d 1.18E6 2 2 129 147 Proline oxidation to pyroglutamic acid
K.NAALTVGNILPLGSVPEGTVVTNVE(+28.03)EK.I Y 35.72 2748.4910 27 -1.6 917.1694 3 88.27 2 46338 AEV_1_3_RA2_01_1232.d 1.48E5 1 1 93 119 Ethylation
R.LNKAPAQFR(+14.02).T Y 35.55 1057.6033 9 -5.1 353.5399 3 39.63 3 19170 AEV_3_3_RA3_01_1233.d 4.96E5 3 3 22 30 Methylation(KR)
R.HGYIR.G Y 35.49 644.3394 5 5.7 323.1788 2 13.80 2 3908 AEV_1_3_RA2_01_1232.d 5.16E5 2 2 38 42
K.Q(-17.03)IVHDPGRGAPLAK(+14.02).V Y 34.89 1454.7993 14 4.1 485.9424 3 61.74 2 27017 AEV_1_3_RA2_01_1232.d 4.9E4 1 1 47 60 Pyro-glu from Q; Methylation(KR)
R.LNKAPAQ(+.98)FR.T Y 34.38 1044.5715 9 -21.9 523.2816 2 35.03 2 13094 AEV_1_3_RA2_01_1232.d 5.61E5 3 3 22 30 Deamidation (NQ)
R.ARGMVGIVAGGGR.T Y 34.28 1199.6556 13 6.6 400.8951 3 56.04 2 23574 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 162 174
K.NAALTVGNILPLGSVPEGTVVTNVEEKIGDRGALGR(-.98).T Y 33.28 3614.9744 36 15.2 904.7646 4 86.19 3 52504 AEV_3_3_RA3_01_1233.d 0 1 1 93 128 Amidation
R.GM(-48.00)VGIVAGGGRTDKPLLK.A Y 31.08 1719.9995 18 0.7 431.0074 4 49.18 3 25202 AEV_3_3_RA3_01_1233.d 3.57E5 1 1 164 181 Dethiomethyl
K.AGLIAARR.T Y 30.30 826.5137 8 -1.1 414.2637 2 26.80 2 9284 AEV_1_3_RA2_01_1232.d 2.68E5 2 2 235 242
R.GAPLAK(+14.02).V Y 30.21 569.3536 6 -46.1 570.3347 1 18.89 2 5941 AEV_1_3_RA2_01_1232.d 0 2 2 55 60 Methylation(KR)
R.AKHKFAVK.R Y 30.07 927.5654 8 -39.9 310.1834 3 29.07 3 12855 AEV_3_3_RA3_01_1233.d 4.05E5 3 3 185 192
K.NAALTVGNILPLGSVPEGT(-18.01)VVTNVEEK(+14.02).I Y 29.52 2716.4646 27 -12.5 906.4841 3 86.25 2 45146 AEV_1_3_RA2_01_1232.d 0 1 1 93 119 Dehydration; Methylation(KR)
R.L(+42.01)NK(+43.01)APAQFR.T Y 26.62 1128.6040 9 30.0 377.2199 3 32.00 2 11688 AEV_1_3_RA2_01_1232.d 0 1 1 22 30 Acetylation (N-term); Carbamylation
R.LNK(+43.99)APAQFR.T Y 26.51 1087.5774 9 -99.1 363.4972 3 50.22 1 20351 AEV 2_3_RA2_01_1224.d 3.2E6 1 1 22 30 Carboxylation (DKW)
R.TGLLR(+14.02)GT(+79.97)QKTKD Y 26.15 1410.7231 12 -17.9 353.6818 4 62.40 3 34271 AEV_3_3_RA3_01_1233.d 4.9E4 1 1 243 254 Methylation(KR); Phosphorylation (STY)
R.GM(-48.00)VGIVAGGGR.T Y 25.97 924.5141 11 -84.8 309.1525 3 45.26 1 17418 AEV 2_3_RA2_01_1224.d 4.5E5 4 4 164 174 Dethiomethyl
K.IGD(+43.99)RGALGR.T Y 25.41 957.4991 9 -36.3 320.1621 3 42.39 1 15818 AEV 2_3_RA2_01_1224.d 0 1 1 120 128 Carboxylation (DKW)
R.A(+43.01)RGMVGIVAGGGR.T Y 24.52 1242.6615 13 -12.4 415.2227 3 65.94 3 37013 AEV_3_3_RA3_01_1233.d 1.32E5 1 1 162 174 Carbamylation
R.RTGLLR.G Y 24.27 714.4500 6 -0.3 358.2322 2 25.33 2 8654 AEV_1_3_RA2_01_1232.d 9.21E5 3 3 242 247
R.GVAM(+15.99)NPVDHPHGGGNHQHIGK.A Y 24.03 2174.0188 21 -5.3 435.8087 5 27.22 3 11806 AEV_3_3_RA3_01_1233.d 3.37E5 2 2 201 221 Oxidation (M)
R.LN(+.98)KAPAQFR.T Y 22.86 1044.5715 9 6.2 523.2963 2 79.73 2 40345 AEV_1_3_RA2_01_1232.d 8.78E4 2 2 22 30 Deamidation (NQ)
K.LPSGAK.K Y 22.55 571.3329 6 -144.0 572.2579 1 43.73 1 16542 AEV 2_3_RA2_01_1224.d 9.53E4 2 2 150 155
K.RQITAANTRLNK(+27.99).A Y 22.08 1412.7848 12 -30.4 471.9212 3 57.10 3 30294 AEV_3_3_RA3_01_1233.d 5.69E4 1 1 13 24 Formylation
R.QITAANT(+79.97)R(+14.02)LNK.A Y 21.29 1322.6708 11 -33.9 662.3203 2 65.69 3 36831 AEV_3_3_RA3_01_1233.d 0 1 1 14 24 Phosphorylation (STY); Methylation(KR)
K.ASTISRYASAGQK(+27.99).A Y 21.07 1366.6841 13 -106.1 456.5203 3 41.20 1 15111 AEV 2_3_RA2_01_1224.d 2.65E5 1 1 222 234 Formylation
R.QIT(+79.96)AANTRLNK.A Y 20.66 1308.6456 11 48.2 437.2435 3 71.63 3 41507 AEV_3_3_RA3_01_1233.d 2.04E4 1 1 14 24 Sulfation
R.T(+42.01)GLLR.G Y 20.60 600.3595 5 -3.3 301.1860 2 27.88 3 12175 AEV_3_3_RA3_01_1233.d 1.76E5 1 1 243 247 Acetylation (N-term)
K.AST(+79.97)IS(-18.01)R.Y Y 20.49 695.3004 6 6.1 696.3119 1 112.53 3 62682 AEV_3_3_RA3_01_1233.d 0 1 1 222 227 Phosphorylation (STY); Dehydration
R.G(+56.06)MVGIVAGGGR.T Y 20.46 1028.5801 11 -18.4 515.2878 2 23.11 3 9502 AEV_3_3_RA3_01_1233.d 2.43E5 2 2 164 174 Diethylation
K.APAQ(+.98)FR.T Y 20.25 689.3496 6 -82.4 345.6537 2 35.98 1 12206 AEV 2_3_RA2_01_1224.d 8.41E4 1 1 25 30 Deamidation (NQ)
K.IGDR(+44.03)GALGR.T Y 19.93 957.5355 9 16.3 320.1910 3 24.10 3 10082 AEV_3_3_RA3_01_1233.d 7.38E5 1 1 120 128 Ethanolation (KR)
R.Q(+27.99)ITAANTR.L Y 19.78 901.4617 8 -98.8 902.3799 1 95.72 1 53601 AEV 2_3_RA2_01_1224.d 3.98E4 1 1 14 21 Formylation (Protein N-term)
R.Q(+42.01)ITAANTR.L Y 19.73 915.4774 8 -84.0 306.1408 3 25.49 1 6754 AEV 2_3_RA2_01_1224.d 1.06E5 1 1 14 21 Acetylation (Protein N-term)
K.APAQFR(+21.98)(+14.02).T Y 19.63 724.3632 6 -104.3 725.2949 1 86.38 1 46868 AEV 2_3_RA2_01_1224.d 0 1 1 25 30 Sodium adduct; Methylation(KR)
R.QITAANTR.L Y 19.60 873.4668 8 -11.3 437.7357 2 15.66 3 5493 AEV_3_3_RA3_01_1233.d 2.98E4 1 1 14 21
R.T(+119.04)DKPLLK.A Y 19.53 932.5331 7 -70.0 311.8299 3 19.59 2 6234 AEV_1_3_RA2_01_1232.d 1.83E5 1 1 175 181 Pyridylacetyl
R.TSGNYVTVIGHNPEEGK(+68.03).T Y 19.45 1868.8904 17 -6.7 468.2267 4 10.50 3 2764 AEV_3_3_RA3_01_1233.d 1.24E4 1 1 129 145 Crotonylation
R.L(+43.01)NK(+42.01)APAQFR.T Y 19.31 1128.6040 9 -4.2 377.2070 3 29.72 3 13223 AEV_3_3_RA3_01_1233.d 0 1 1 22 30 Carbamylation; Acetylation (K)
K.AGLIAAR(+14.02).R Y 19.28 684.4282 7 -8.4 343.2185 2 44.43 3 22184 AEV_3_3_RA3_01_1233.d 9.16E4 1 1 235 241 Methylation(KR)
R.QITAANTR(+14.02).L Y 19.24 887.4825 8 -0.6 888.4892 1 94.56 2 49179 AEV_1_3_RA2_01_1232.d 0 1 1 14 21 Methylation(KR)
R.G(+42.01)M(+15.99)VGIVAGGGR.T Y 18.60 1030.5229 11 36.1 516.2874 2 42.59 2 16758 AEV_1_3_RA2_01_1232.d 8.02E4 3 3 164 174 Acetylation (N-term); Oxidation (M)
K.RNSWPK.T Y 18.50 786.4136 6 0.9 394.2144 2 15.30 3 5278 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 193 198
R.Q(+42.01)(+.98)ITAANTR.L Y 18.46 916.4614 8 -2.7 459.2368 2 13.99 2 3964 AEV_1_3_RA2_01_1232.d 0 1 1 14 21 Acetylation (Protein N-term); Deamidation (NQ)
K.SR(+28.03)AR(+14.02)GMVGIVAGGGR.T Y 18.43 1484.8358 15 -13.8 372.2111 4 40.38 3 19628 AEV_3_3_RA3_01_1233.d 0 1 1 160 174 Dimethylation(KR); Methylation(KR)
R.QIT(+79.97)AANTR.L Y 18.31 953.4332 8 0.3 477.7240 2 47.56 1 18837 AEV 2_3_RA2_01_1224.d 0 1 1 14 21 Phosphorylation (STY)
R.ARGMVGIVAGGGRTDKPLLK.A Y 18.22 1995.1411 20 6.0 400.0379 5 64.09 2 28629 AEV_1_3_RA2_01_1232.d 9.65E4 1 1 162 181
R.TDKPLLK(+21.98).A Y 17.69 835.4779 7 -52.0 836.4418 1 103.47 1 56851 AEV 2_3_RA2_01_1224.d 7E5 1 1 175 181 Sodium adduct
K.QIVHDPGR(+28.03).G Y 17.61 948.5141 8 -19.1 475.2552 2 43.90 3 21849 AEV_3_3_RA3_01_1233.d 0 1 1 47 54 Dimethylation(KR)
R.ARGM(+15.99)VGIVAGGGRTDKPLLK.A Y 17.60 2011.1360 20 -1.4 403.2339 5 53.41 3 27980 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 162 181 Oxidation (M)
K.TRGVAMNPVDHPHGGGNHQ(+.98)HIGK.A Y 17.56 2416.1567 23 1.0 484.2391 5 12.25 3 3628 AEV_3_3_RA3_01_1233.d 1.68E4 1 1 199 221 Deamidation (NQ)
R.GAPLAK(+21.98).V Y 17.49 577.3199 6 -47.3 578.2999 1 49.95 2 20421 AEV_1_3_RA2_01_1232.d 0 1 1 55 60 Sodium adduct
K.ASTISR(+.98).Y Y 17.47 634.3286 6 -30.4 635.3166 1 59.21 3 31829 AEV_3_3_RA3_01_1233.d 0 1 1 222 227 Deamidation (R)
R.Q(-17.03)ITAANTR.L Y 17.35 856.4402 8 -58.3 429.2025 2 8.35 2 1969 AEV_1_3_RA2_01_1232.d 3.2E3 1 1 14 21 Pyro-glu from Q
R.T(+79.97)LDYAER.H Y 17.06 946.3797 7 42.5 474.2173 2 41.01 1 15005 AEV 2_3_RA2_01_1224.d 0 1 1 31 37 Phosphorylation (STY)
R.Q(+27.99)ITAANTRLNK.A Y 17.06 1256.6837 11 5.6 315.1800 4 28.60 3 12586 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 14 24 Formylation (Protein N-term)
R.VKLPSGAK(+14.02).K Y 16.89 812.5120 8 -24.7 407.2532 2 34.21 2 12693 AEV_1_3_RA2_01_1232.d 0 1 1 148 155 Methylation(KR)
K.NAALTVGNILPLGSVPEGTVVTNVEEK(-.98)(+14.02).I Y 16.67 2733.4912 27 19.0 684.3931 4 86.63 2 45384 AEV_1_3_RA2_01_1232.d 0 1 1 93 119 Amidation; Methylation(KR)
K.FAVK(+14.02)R.N Y 16.62 633.3962 5 5.3 317.7070 2 23.15 2 7710 AEV_1_3_RA2_01_1232.d 4.18E4 1 1 189 193 Methylation(KR)
K.A(+42.01)GLIAAR.R Y 16.40 712.4232 7 -21.4 357.2112 2 52.25 3 27216 AEV_3_3_RA3_01_1233.d 0 1 1 235 241 Acetylation (N-term)
R.NSWPK.T Y 16.28 630.3126 5 -6.1 631.3160 1 14.42 3 4788 AEV_3_3_RA3_01_1233.d 2.26E4 1 1 194 198
R.Y(+42.01)AS(-18.01)AGQK.A Y 16.26 747.3551 7 14.8 748.3734 1 111.91 3 62503 AEV_3_3_RA3_01_1233.d 1.78E3 1 1 228 234 Acetylation (N-term); Dehydration
K.I(+41.03)GDRGALGR.T Y 16.01 954.5359 9 44.6 319.2001 3 24.09 3 10124 AEV_3_3_RA3_01_1233.d 0 1 1 120 128 Amidination of lysines or N-terminal amines with methyl acetimidate
K.FAVKR.N Y 16.00 619.3806 5 2.3 310.6983 2 15.18 3 5210 AEV_3_3_RA3_01_1233.d 5.41E5 2 2 189 193
R.QITAANT(+42.01)R.L Y 15.93 915.4774 8 -35.0 306.1557 3 30.50 1 9221 AEV 2_3_RA2_01_1224.d 1.01E6 1 1 14 21 Acetylation (TSCYH)
K.LPSGAK(+42.01).K Y 15.80 613.3435 6 -52.7 614.3185 1 69.33 3 39714 AEV_3_3_RA3_01_1233.d 2.97E5 1 1 150 155 Acetylation (K)
K.YKDVIETFIANEGMY(+15.01)TGQFIYAGK.N Y 15.63 2772.3469 24 3.3 925.1260 3 87.44 3 53269 AEV_3_3_RA3_01_1233.d 4.72E4 1 1 69 92 Tyrosine oxidation to 2-aminotyrosine
K.KVVKSRAR.G Y 15.61 942.6086 8 -110.7 943.5116 1 110.20 1 58816 AEV 2_3_RA2_01_1224.d 0 1 1 156 163
K.Q(+27.99)IVHDPGR.G Y 15.18 948.4777 8 -2.8 475.2448 2 46.47 2 18664 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 47 54 Formylation
R.Q(+42.01)ITAAN(+.98)TR.L Y 15.14 916.4614 8 -2.7 917.4662 1 91.48 2 47983 AEV_1_3_RA2_01_1232.d 0 1 1 14 21 Acetylation (Protein N-term); Deamidation (NQ)
R.QITAANTR(+14.02)LNK(+42.01).A Y 15.09 1284.7150 11 -8.8 322.1832 4 61.45 3 33546 AEV_3_3_RA3_01_1233.d 2.35E4 1 1 14 24 Methylation(KR); Acetylation (K)
R.ARGM(+31.99)VGIVAGGGR.T Y 15.04 1231.6455 13 4.3 308.9200 4 9.33 2 2277 AEV_1_3_RA2_01_1232.d 4.31E4 1 1 162 174 Sulphone
R.N(+42.01)SWPK.T Y 15.01 672.3231 5 -27.5 337.1596 2 33.57 1 10956 AEV 2_3_RA2_01_1224.d 1.77E4 1 1 194 198 Acetylation (N-term)
total 117 peptides
A0A0A0HWK8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.SYELPDGQVITIGNER.F Y 155.95 1789.8846 16 1.3 895.9507 2 79.35 2 40070 AEV_1_3_RA2_01_1232.d 3.08E6 12 12 196 211
R.TTGIVLDSGDGVTHVVPIYEGFALPHAISR.I Y 146.10 3120.6243 30 -2.1 781.1617 4 84.24 2 43808 AEV_1_3_RA2_01_1232.d 1.81E6 8 8 105 134
R.VAPEEHPVLLTEAPINPK.S Y 145.00 1953.0570 18 0.9 652.0269 3 71.54 2 34001 AEV_1_3_RA2_01_1232.d 3.29E6 9 9 53 70
K.LC(+57.02)YVALDFQQEIQTASQSSTLEK.S Y 125.59 2658.2847 23 3.2 887.1050 3 85.16 2 44417 AEV_1_3_RA2_01_1232.d 2.51E5 3 3 173 195 Carbamidomethylation
R.MQKEITALAPSSMK.V Y 111.60 1533.7894 14 -0.7 512.2701 3 63.46 2 28258 AEV_1_3_RA2_01_1232.d 5.42E5 2 2 270 283
R.FRAPEALFQPSVLGLESGGIHATTYNAIMK.C Y 110.75 3217.6594 30 -9.1 805.4148 4 84.43 2 43914 AEV_1_3_RA2_01_1232.d 2.48E5 2 2 212 241
K.DLYGNIVMSGGTTMYPGISDR.M Y 104.36 2246.0347 21 1.6 1124.0264 2 84.19 2 43749 AEV_1_3_RA2_01_1232.d 2.25E5 3 3 249 269
K.DSYVGDEAQSKR.G N 98.10 1353.6160 12 -0.6 677.8149 2 25.05 3 10633 AEV_3_3_RA3_01_1233.d 2.58E6 13 13 8 19
R.GYSFSTTAER.E Y 96.34 1117.5040 10 14.8 559.7676 2 53.09 2 22116 AEV_1_3_RA2_01_1232.d 2.71E6 6 6 154 163
K.Q(-17.03)EYDESGPSIVHR.K Y 93.65 1498.6688 13 -0.8 750.3411 2 62.85 3 34615 AEV_3_3_RA3_01_1233.d 4.4E5 3 3 317 329 Pyro-glu from Q
K.SYELPDGQVITIGNER(+14.02).F Y 92.66 1803.9003 16 15.3 902.9713 2 79.46 2 40157 AEV_1_3_RA2_01_1232.d 6.88E5 7 7 196 211 Methylation(KR)
K.ILAERGYSFSTTAER.E Y 91.15 1699.8529 15 -3.3 567.6230 3 63.56 3 35183 AEV_3_3_RA3_01_1233.d 9.26E4 1 1 149 163
K.SYE(+14.02)LPDGQVITIGNER.F Y 86.26 1803.9003 16 0.9 902.9583 2 79.91 2 40490 AEV_1_3_RA2_01_1232.d 2.93E5 2 2 196 211 Methylation(others)
R.VAPE(+14.02)EHPVLLTEAPINPK.S Y 85.97 1967.0728 18 3.7 656.7006 3 73.71 2 35661 AEV_1_3_RA2_01_1232.d 3.6E5 3 3 53 70 Methylation(others)
R.TTGIVLDSGDGVTHVVPIYE(+14.02)GFALPHAISR.I Y 80.29 3134.6399 30 5.3 784.6714 4 85.44 2 44607 AEV_1_3_RA2_01_1232.d 2.5E5 3 3 105 134 Methylation(others)
K.DSYVGDEAQSK.R N 80.05 1197.5149 11 4.4 599.7673 2 29.57 2 10549 AEV_1_3_RA2_01_1232.d 6.27E5 7 7 8 18
R.VAPEEHPVLLTE(+14.02)APINPK.S Y 74.80 1967.0728 18 3.3 656.7004 3 74.73 2 36416 AEV_1_3_RA2_01_1232.d 8.73E5 2 2 53 70 Methylation(others)
K.EITALAPSSM(+15.99)K.V Y 74.62 1162.5903 11 3.9 582.3047 2 51.77 2 21342 AEV_1_3_RA2_01_1232.d 1.19E6 9 9 273 283 Oxidation (M)
R.VAPEEH(+156.12)PVLLTEAPINPK.S Y 74.57 2109.1721 18 -4.7 528.2979 4 68.39 2 31652 AEV_1_3_RA2_01_1232.d 4.3E5 4 4 53 70 4-hydroxynonenal (HNE)
R.IDMAGRDLTNYLMK.I Y 73.15 1639.8062 14 0.4 820.9107 2 77.87 2 38866 AEV_1_3_RA2_01_1232.d 1.98E5 3 3 135 148
K.EITALAPSSMK.V Y 70.94 1146.5955 11 -8.6 574.3000 2 63.54 3 35199 AEV_3_3_RA3_01_1233.d 9.63E5 4 4 273 283
K.SYELPDGQVITIGN(+.98)ER.F Y 70.50 1790.8687 16 2.9 896.4442 2 81.02 2 41379 AEV_1_3_RA2_01_1232.d 3.2E5 3 3 196 211 Deamidation (NQ)
R.MQKEITALAPSSM(+15.99)K.V Y 69.40 1549.7844 14 2.7 517.6035 3 55.91 2 23489 AEV_1_3_RA2_01_1232.d 1.68E5 2 2 270 283 Oxidation (M)
R.M(+15.99)QKEITALAPSSMK.V Y 63.88 1549.7844 14 6.1 517.6052 3 59.71 2 25693 AEV_1_3_RA2_01_1232.d 9.18E4 1 1 270 283 Oxidation (M)
K.VKIIAPPER.K Y 63.35 1021.6284 9 -11.4 511.8156 2 50.21 2 20550 AEV_1_3_RA2_01_1232.d 0 1 1 284 292
R.DLTNYLMK.I Y 60.02 996.4950 8 1.6 499.2556 2 75.59 2 37070 AEV_1_3_RA2_01_1232.d 4.17E5 4 4 141 148
K.DSYVGDEAQSK(+14.02).R N 55.29 1211.5305 11 4.4 606.7752 2 38.99 3 18794 AEV_3_3_RA3_01_1233.d 1.54E5 2 2 8 18 Methylation(KR)
K.C(+57.02)DVDVRKDLYGN(-17.03)IVMSGGTTMYPGISDR.M Y 54.79 3101.4255 28 -0.2 1034.8156 3 83.90 2 43546 AEV_1_3_RA2_01_1232.d 3.3E4 1 1 242 269 Carbamidomethylation; Ammonia-loss (N)
R.VAPEEHPVLLTEAPINPK(+14.02).S Y 50.33 1967.0728 18 1.2 656.6990 3 73.31 2 35348 AEV_1_3_RA2_01_1232.d 2.14E5 2 2 53 70 Methylation(KR)
K.IIAPPERK.Y Y 50.22 922.5599 8 -21.2 462.2775 2 25.89 3 11078 AEV_3_3_RA3_01_1233.d 1.31E6 10 10 286 293
R.VAPEEHPVLLTEAPIN(+.98)PK.S Y 50.18 1954.0410 18 -0.6 652.3539 3 72.99 2 35116 AEV_1_3_RA2_01_1232.d 4.23E4 1 1 53 70 Deamidation (NQ)
K.IIAPPER.K Y 47.80 794.4650 7 -87.0 398.2052 2 53.09 1 22010 AEV 2_3_RA2_01_1224.d 1.17E6 5 5 286 292
R.TTGIVLDSGDGVTHVVPIYEGFALPHAISR(+14.02).I Y 47.33 3134.6399 30 27.7 784.6890 4 83.83 3 50896 AEV_3_3_RA3_01_1233.d 0 1 1 105 134 Methylation(KR)
R.MQ(+.98)KEITALAPSSMK.V Y 47.01 1534.7734 14 17.6 512.6074 3 63.35 2 28115 AEV_1_3_RA2_01_1232.d 1.48E4 1 1 270 283 Deamidation (NQ)
K.DSYVGDEAQSK(+14.02)R.G N 40.73 1367.6317 12 2.7 684.8250 2 34.20 2 12684 AEV_1_3_RA2_01_1232.d 7.13E4 2 2 8 19 Methylation(KR)
K.SYELPDGQVITIGNER(+28.03).F Y 38.17 1817.9159 16 0.8 606.9797 3 81.35 2 41630 AEV_1_3_RA2_01_1232.d 2.07E5 2 2 196 211 Dimethylation(KR)
R.VAPEE(+28.03)HPVLLTEAPINPK.S Y 38.11 1981.0884 18 -22.8 661.3550 3 75.90 2 37324 AEV_1_3_RA2_01_1232.d 0 1 1 53 70 Ethylation
K.DSYVGDEAQ(+.98)SK.R N 36.75 1198.4989 11 -82.9 600.2070 2 39.31 1 14006 AEV 2_3_RA2_01_1224.d 5.77E4 1 1 8 18 Deamidation (NQ)
R.DLTNYLM(+15.99)K.I Y 36.57 1012.4899 8 6.7 507.2556 2 68.18 3 38816 AEV_3_3_RA3_01_1233.d 1.37E5 1 1 141 148 Oxidation (M)
K.DSYVGDEAQSKR(+14.02).G N 34.52 1367.6317 12 0.4 684.8234 2 32.80 3 15042 AEV_3_3_RA3_01_1233.d 5.2E4 1 1 8 19 Methylation(KR)
K.DSYVGDE(+14.02)AQSK.R N 33.00 1211.5305 11 2.1 606.7738 2 42.10 3 20720 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 8 18 Methylation(others)
R.VAPEEHPVLLT(-2.02)EAPINPK.S Y 31.29 1951.0414 18 -34.6 651.3319 3 71.64 2 34077 AEV_1_3_RA2_01_1232.d 1.22E5 2 2 53 70 2-amino-3-oxo-butanoic_acid
K.QEYD(-18.01)ESGPSIVHRK.C Y 30.22 1625.7798 14 18.6 542.9440 3 53.03 3 27731 AEV_3_3_RA3_01_1233.d 1.17E5 1 1 317 330 Dehydration
R.GILTLR.Y N 28.17 671.4330 6 -3.2 336.7227 2 62.74 3 34547 AEV_3_3_RA3_01_1233.d 1.63E6 7 7 20 25
K.RGILTLR.Y N 28.16 827.5341 7 -1.1 414.7739 2 53.09 3 27765 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 19 25
K.SYELPDGQ(+.98)VITIGNER(+14.02).F Y 28.15 1804.8843 16 7.0 903.4557 2 81.13 2 41462 AEV_1_3_RA2_01_1232.d 2.42E5 1 1 196 211 Deamidation (NQ); Methylation(KR)
K.ILAER.G N 27.25 600.3595 5 -87.1 301.1609 2 32.27 1 10230 AEV 2_3_RA2_01_1224.d 7.51E5 3 3 149 153
K.IIAPPER(+14.02).K Y 25.04 808.4807 7 -0.4 405.2474 2 52.24 2 21593 AEV_1_3_RA2_01_1232.d 7.86E4 1 1 286 292 Methylation(KR)
R.VAPE(+21.98)EHPVLLTEAPINPK.S Y 24.85 1975.0391 18 -9.6 659.3473 3 73.69 2 35648 AEV_1_3_RA2_01_1232.d 0 1 1 53 70 Sodium adduct
K.DSYVGDE(+14.02)AQSKR.G N 24.77 1367.6317 12 0.2 456.8846 3 35.50 3 16638 AEV_3_3_RA3_01_1233.d 2.89E5 3 3 8 19 Methylation(others)
R.IDMAGR.D Y 24.74 661.3217 6 -8.5 662.3234 1 99.36 1 55455 AEV 2_3_RA2_01_1224.d 0 1 1 135 140
K.IIAPPER(+14.02)K.Y Y 23.54 936.5756 8 -34.0 313.1885 3 33.46 2 12339 AEV_1_3_RA2_01_1232.d 0 1 1 286 293 Methylation(KR)
K.DS(+79.97)YVGDEAQSK(+42.01).R N 23.28 1319.4918 11 27.2 440.8499 3 52.49 1 21661 AEV 2_3_RA2_01_1224.d 7.22E4 1 1 8 18 Phosphorylation (STY); Acetylation (K)
M(+27.99)IGMGQKDSYVGDEAQSK.R Y 23.22 1970.8713 18 -38.7 657.9390 3 66.18 1 31002 AEV 2_3_RA2_01_1224.d 3.04E5 1 1 1 18 Formylation (Protein N-term)
K.EIT(-2.02)ALAPSSMK.V Y 22.50 1144.5798 11 -5.0 573.2943 2 64.28 2 28751 AEV_1_3_RA2_01_1232.d 4.79E5 1 1 273 283 2-amino-3-oxo-butanoic_acid
R.MQKEITALAPSSM(-48.00)K.V Y 22.40 1485.7861 14 4.8 496.2717 3 45.13 2 18002 AEV_1_3_RA2_01_1232.d 1.04E5 1 1 270 283 Dethiomethyl
R.MQKEIT(-2.02)ALAPSSMK.V Y 22.38 1531.7738 14 -17.9 766.8805 2 62.34 3 34229 AEV_3_3_RA3_01_1233.d 3.07E4 1 1 270 283 2-amino-3-oxo-butanoic_acid
K.QEYDESGPSIVHR.K Y 21.25 1515.6953 13 -87.0 758.7890 2 60.98 1 27207 AEV 2_3_RA2_01_1224.d 3.98E4 1 1 317 329
R.M(+42.01)QKEITALAPS(+79.97)SMK.V Y 20.12 1655.7664 14 18.0 828.9053 2 82.86 2 42777 AEV_1_3_RA2_01_1232.d 0 1 1 270 283 Acetylation (N-term); Phosphorylation (STY)
R.DIK(+14.02)EKLC(+57.02)YVALD(-18.01)FQQEIQTASQSSTLEK.S Y 19.92 3267.6333 28 1.8 817.9171 4 87.44 2 45882 AEV_1_3_RA2_01_1232.d 8.17E4 1 1 168 195 Methylation(KR); Carbamidomethylation; Dehydration
K.QEY(-18.01)DESGPSIVHRK.C Y 19.60 1625.7798 14 -5.1 542.9311 3 55.63 2 23337 AEV_1_3_RA2_01_1232.d 4.94E4 1 1 317 330 Dehydration
K.E(+14.02)ITALAPSSMK.V Y 18.61 1160.6111 11 -10.6 581.3066 2 66.11 2 30097 AEV_1_3_RA2_01_1232.d 0 1 1 273 283 Methylation(others)
R.GILTLR(+14.02).Y N 18.48 685.4487 6 -87.6 343.7016 2 79.58 1 41510 AEV 2_3_RA2_01_1224.d 2.67E4 1 1 20 25 Methylation(KR)
K.E(+21.98)ITALAPSSMK.V Y 18.42 1168.5774 11 9.5 585.3015 2 47.10 3 23873 AEV_3_3_RA3_01_1233.d 0 1 1 273 283 Sodium adduct
K.RGILT(+79.97)LR.Y N 18.11 907.5004 7 5.6 303.5091 3 36.00 2 13585 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 19 25 Phosphorylation (STY)
K.I(+43.01)IAPPERK.Y Y 17.72 965.5658 8 26.8 322.8712 3 25.78 3 11019 AEV_3_3_RA3_01_1233.d 1.32E5 1 1 286 293 Carbamylation
R.GYSFSTT(+79.97)AER(+14.02).E Y 17.69 1211.4860 10 7.7 404.8391 3 31.08 1 9572 AEV 2_3_RA2_01_1224.d 2.41E4 1 1 154 163 Phosphorylation (STY); Methylation(KR)
R.IDM(+15.99)AGR.D Y 17.39 677.3167 6 -79.5 339.6387 2 21.11 1 5089 AEV 2_3_RA2_01_1224.d 2.23E5 1 1 135 140 Oxidation (M)
R.GILT(-18.01)LR.Y N 17.29 653.4224 6 14.4 654.4391 1 102.44 1 56528 AEV 2_3_RA2_01_1224.d 5.25E3 1 1 20 25 Dehydration
K.SYELPDGQVIT(+79.97)IGNERFR(+14.02).A Y 16.81 2187.0361 18 10.7 730.0271 3 71.52 3 41425 AEV_3_3_RA3_01_1233.d 1.16E4 1 1 196 213 Phosphorylation (STY); Methylation(KR)
R.MQ(+.98)KEITALAPSSMK(+42.01).V Y 16.75 1576.7841 14 -2.8 526.6005 3 74.41 3 43671 AEV_3_3_RA3_01_1233.d 0 1 1 270 283 Deamidation (NQ); Acetylation (K)
R.MQKEITALAPS(+79.97)SMK(+42.01).V Y 16.46 1655.7664 14 -36.7 414.9337 4 69.98 1 33941 AEV 2_3_RA2_01_1224.d 2.37E5 1 1 270 283 Phosphorylation (STY); Acetylation (K)
R.GYSFST(+79.97)TAER.E Y 15.74 1197.4703 10 -11.4 599.7356 2 79.17 1 41181 AEV 2_3_RA2_01_1224.d 0 1 1 154 163 Phosphorylation (STY)
K.EIT(+79.97)ALAPS(-18.01)SMK.V Y 15.35 1208.5511 11 13.1 605.2908 2 17.64 3 6563 AEV_3_3_RA3_01_1233.d 3.6E4 1 1 273 283 Phosphorylation (STY); Dehydration
R.IDM(+15.99)AGRDLTNYLM(+15.99)K.I Y 15.19 1671.7960 14 43.5 558.2969 3 68.52 2 31744 AEV_1_3_RA2_01_1232.d 0 1 1 135 148 Oxidation (M)
R.MQK(+14.02)EITALAPSSMK.V Y 15.08 1547.8052 14 1.3 516.9430 3 65.00 3 36271 AEV_3_3_RA3_01_1233.d 2.53E4 1 1 270 283 Methylation(KR)
R.VAPEE(+14.02)HPVLLTEAPINPK.S Y 15.02 1967.0728 18 -36.9 492.7573 4 45.36 2 18108 AEV_1_3_RA2_01_1232.d 0 1 1 53 70 Methylation(others)
total 77 peptides
C1GBT0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.LADLMEQHVDTLAAIEALDNGKAYSIAR.I Y 134.73 3027.5334 28 5.5 757.8948 4 84.21 2 43767 AEV_1_3_RA2_01_1232.d 2.71E5 3 3 87 114
K.LVVEAGFPPGVINIISGFGR.V Y 134.10 2041.1360 20 -1.3 681.3851 3 92.85 2 48535 AEV_1_3_RA2_01_1232.d 9.81E5 8 8 202 221
R.VAGAAISSHMDIDKVAFTGSTLVGR.Q Y 131.57 2502.2900 25 4.2 626.5824 4 78.52 2 39380 AEV_1_3_RA2_01_1232.d 6.25E5 3 3 222 246
R.ILVEEGIYDTFLER.F Y 128.83 1695.8719 14 2.3 848.9452 2 85.37 2 44564 AEV_1_3_RA2_01_1232.d 9.71E5 6 6 303 316
R.ELGEYALDNYTQVK.A Y 123.54 1641.7886 14 1.2 821.9025 2 75.32 2 36857 AEV_1_3_RA2_01_1232.d 9.12E5 5 5 449 462
K.IGPVVATGNTVVLK.S Y 122.19 1366.8184 14 -3.1 684.4143 2 72.05 2 34380 AEV_1_3_RA2_01_1232.d 9.49E5 3 3 174 187
K.VIDTDTDSFNYTR.H Y 119.22 1545.6947 13 3.3 773.8572 2 66.23 2 30116 AEV_1_3_RA2_01_1232.d 2.2E6 5 5 138 150
R.TFESINPHNEKPIVAVYEATEKDVDIAVAAAR.A Y 116.72 3496.7837 32 0.9 700.3646 5 84.45 2 43937 AEV_1_3_RA2_01_1232.d 2.6E5 2 2 34 65
K.SAEQTPLSALYAAK.L Y 115.21 1448.7511 14 1.1 725.3836 2 74.84 2 36542 AEV_1_3_RA2_01_1232.d 2.09E6 6 6 188 201
K.VGDPFHQDTFQGPQVSQLQFDR.I Y 111.68 2545.1985 22 2.0 849.4084 3 79.55 2 40204 AEV_1_3_RA2_01_1232.d 1.61E5 3 3 326 347
R.IDVANAAGC(+57.02)IR.Y Y 93.52 1158.5815 11 7.8 580.3026 2 63.51 2 28268 AEV_1_3_RA2_01_1232.d 1.93E6 7 7 115 125 Carbamidomethylation
R.LGDALFG Y 92.73 691.3541 7 -0.2 692.3612 1 76.68 3 45446 AEV_3_3_RA3_01_1233.d 6.9E5 6 6 468 474
R.IRLGDALFG Y 86.61 960.5392 9 1.6 481.2777 2 79.36 2 40049 AEV_1_3_RA2_01_1232.d 1.11E6 4 4 466 474
M.A(+42.01)LFQQITTPTITYEQPLGLFINNEFVK.G Y 80.64 3166.6589 27 3.5 1056.5640 3 97.77 2 50297 AEV_1_3_RA2_01_1232.d 3.67E5 5 5 2 28 Acetylation (Protein N-term)
K.LVVEAGFPPGVINIISGFGR(+14.02).V Y 73.45 2055.1516 20 -7.9 686.0524 3 93.41 2 48749 AEV_1_3_RA2_01_1232.d 7.95E4 2 2 202 221 Methylation(KR)
K.LVVE(+14.02)AGFPPGVINIISGFGR.V Y 70.41 2055.1516 20 -3.8 686.0552 3 94.01 2 48977 AEV_1_3_RA2_01_1232.d 2.36E5 4 4 202 221 Methylation(others)
R.ILVEEGIYDTFLERFK.A Y 63.99 1971.0353 16 -0.2 658.0189 3 87.07 2 45664 AEV_1_3_RA2_01_1232.d 5.41E4 1 1 303 318
R.QILQAAAK.S Y 63.93 841.5021 8 -88.2 842.4352 1 47.97 1 19068 AEV 2_3_RA2_01_1224.d 6.25E5 5 5 247 254
R.IDVANAAGC(+57.02)IR(+14.02).Y Y 59.40 1172.5972 11 -1.4 587.3051 2 68.92 2 32052 AEV_1_3_RA2_01_1232.d 1.63E5 3 3 115 125 Carbamidomethylation; Methylation(KR)
K.LADLMEQHVDTLAAIEALDNGK.A Y 59.23 2366.1787 22 -9.4 789.7261 3 84.11 2 43692 AEV_1_3_RA2_01_1232.d 5.14E4 3 3 87 108
K.VIDTDTD(+14.02)SFNYTR.H Y 56.00 1559.7103 13 2.5 780.8644 2 68.55 2 31821 AEV_1_3_RA2_01_1232.d 1.61E5 1 1 138 150 Methylation(others)
M.A(+42.01)LFQQITTPTITYEQ(+.98)PLGLFINNEFVK.G Y 53.85 3167.6431 27 8.8 1056.8976 3 97.78 2 50301 AEV_1_3_RA2_01_1232.d 9.81E4 1 1 2 28 Acetylation (Protein N-term); Deamidation (NQ)
K.HVTPTNR.G Y 48.56 823.4301 7 -85.8 412.6870 2 22.23 1 5463 AEV 2_3_RA2_01_1224.d 1.75E5 4 4 74 80
K.SAEQTPLSALYAAK(+14.02).L Y 48.06 1462.7667 14 -7.0 732.3855 2 77.18 3 45842 AEV_3_3_RA3_01_1233.d 1.43E5 2 2 188 201 Methylation(KR)
K.VAFTGSTLVGR.Q Y 46.44 1106.6084 11 7.1 554.3154 2 67.42 2 30960 AEV_1_3_RA2_01_1232.d 7.86E4 2 2 236 246
R.ILVEEGIYDTFLER(+14.02).F Y 45.17 1709.8876 14 2.3 855.9530 2 86.70 2 45427 AEV_1_3_RA2_01_1232.d 1.97E4 1 1 303 316 Methylation(KR)
R.YYGGWADKIHGK.V Y 41.64 1393.6779 12 7.3 465.5699 3 58.64 2 25021 AEV_1_3_RA2_01_1232.d 9.32E4 1 1 126 137
R.Q(-17.03)ILQAAAK.S Y 40.51 824.4756 8 -103.4 825.3976 1 68.86 1 33092 AEV 2_3_RA2_01_1224.d 3.18E5 1 1 247 254 Pyro-glu from Q
K.VTLELGGK.S Y 39.33 815.4752 8 -0.2 408.7448 2 57.19 2 24195 AEV_1_3_RA2_01_1232.d 3.79E5 2 2 260 267
R.AAFKGPWK.H Y 35.19 903.4966 8 0.9 452.7560 2 50.17 2 20526 AEV_1_3_RA2_01_1232.d 5.63E5 4 4 66 73
R.E(+14.02)LGEYALDNYTQVK.A Y 34.19 1655.8042 14 -1.2 828.9084 2 76.00 3 44919 AEV_3_3_RA3_01_1233.d 2.18E4 1 1 449 462 Methylation(others)
K.VIDTDTDSFNYTR(+14.02).H Y 33.32 1559.7103 13 0.2 780.8626 2 68.08 3 38716 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 138 150 Methylation(KR)
R.ILVE(+14.02)EGIYDTFLER.F Y 32.50 1709.8876 14 2.3 855.9531 2 88.03 2 46206 AEV_1_3_RA2_01_1232.d 1.97E5 1 1 303 316 Methylation(others)
K.SAEQTPLSALY(-18.01)AAK(+14.02).L Y 30.75 1444.7561 14 -12.8 723.3761 2 74.90 2 36596 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 188 201 Dehydration; Methylation(KR)
K.SAE(+14.02)QTPLSALYAAK.L Y 29.42 1462.7667 14 -3.4 732.3881 2 77.39 2 38485 AEV_1_3_RA2_01_1232.d 1.22E5 1 1 188 201 Methylation(others)
K.E(+42.01)SGLGR(-.98).E Y 28.70 658.3398 6 -10.5 659.3402 1 92.63 3 56119 AEV_3_3_RA3_01_1233.d 0 1 1 443 448 Acetylation (N-term); Amidation
R.VAGAAISSHM(+15.99)D(-18.01)IDKVAFTGSTLVGR.Q Y 26.06 2500.2744 25 -0.7 834.4315 3 77.87 3 46397 AEV_3_3_RA3_01_1233.d 0 1 1 222 246 Oxidation (M); Dehydration
M.A(+42.01)LFQQITTPTITYEQPLGLFINNEFVK(+14.02).G Y 24.66 3180.6746 27 2.7 1591.3489 2 97.83 2 50320 AEV_1_3_RA2_01_1232.d 3.89E4 1 1 2 28 Acetylation (Protein N-term); Methylation(KR)
K.LADLMEQHVDTLAAIEALD(-18.01)NGK(+14.02)AYSIAR.I Y 24.24 3023.5386 28 32.5 756.9165 4 84.22 2 43775 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 87 114 Dehydration; Methylation(KR)
R.QILQAAAKSNLK(+145.02)K.V Y 24.20 1556.8708 13 -20.1 390.2172 4 59.78 2 25735 AEV_1_3_RA2_01_1232.d 0 1 1 247 259 3-(carbamidomethylthio)propanoyl
R.VSNELK(+42.01).A Y 24.18 730.3861 6 -72.1 366.1740 2 62.16 1 28126 AEV 2_3_RA2_01_1224.d 0 1 1 415 420 Acetylation (K)
R.EGKAAGAK(+42.01)VEIGGER.L Y 22.41 1512.7896 15 -80.2 379.1743 4 41.82 1 15466 AEV 2_3_RA2_01_1224.d 1.07E5 1 1 354 368 Acetylation (K)
R.GHEDR.Q Y 21.72 612.2616 5 -28.8 307.1293 2 54.02 1 22573 AEV 2_3_RA2_01_1224.d 0 1 1 387 391
R.E(+27.99)GKAAGAK(+14.02)VEIGGER.L Y 21.69 1512.7896 15 8.6 505.2748 3 46.70 2 18782 AEV_1_3_RA2_01_1232.d 3.6E4 1 1 354 368 Formylation; Methylation(KR)
K.AAGAK.V N 21.58 416.2383 5 -62.4 417.2196 1 20.96 3 8347 AEV_3_3_RA3_01_1233.d 7.74E3 3 3 357 361
R.HEPIGVC(+57.02)GQIIPWNFPLLMWSWK.I Y 21.50 2807.4080 23 16.9 936.8257 3 89.67 2 47066 AEV_1_3_RA2_01_1232.d 3.95E5 1 1 151 173 Carbamidomethylation
R.IDVAN(+.98)AAGC(+57.02)IR.Y Y 21.50 1159.5656 11 -2.2 1160.5703 1 77.65 3 46221 AEV_3_3_RA3_01_1233.d 4.37E3 1 1 115 125 Deamidation (NQ); Carbamidomethylation
K.A(+42.01)AGAK.V N 21.05 458.2489 5 -24.5 459.2449 1 27.72 3 12085 AEV_3_3_RA3_01_1233.d 0 1 1 357 361 Acetylation (N-term)
K.VEIGGER.L Y 20.90 758.3922 7 -86.6 380.1705 2 34.47 1 11410 AEV 2_3_RA2_01_1224.d 5.1E5 3 3 362 368
K.G(+27.99)VEGR.T Y 20.84 544.2605 5 31.9 545.2852 1 32.29 2 11779 AEV_1_3_RA2_01_1232.d 7.8E4 2 2 29 33 Formylation
R.HRGHE(+43.99)DR.Q Y 20.75 949.4114 7 -76.8 475.6765 2 22.38 1 5520 AEV 2_3_RA2_01_1224.d 4.1E4 1 1 385 391 Carboxylation (E)
K.HVTPTNR(+14.02).G Y 20.66 837.4457 7 -86.3 419.6940 2 30.57 1 9267 AEV 2_3_RA2_01_1224.d 6.35E4 1 1 74 80 Methylation(KR)
K.GPWKHVTPTNR(+28.03).G Y 20.47 1319.7098 11 -5.5 440.9081 3 86.51 3 52715 AEV_3_3_RA3_01_1233.d 4.6E4 1 1 70 80 Dimethylation(KR)
K.AYSIAR(+14.02)IDVANAAGC(+57.02)IR(-.98).Y Y 20.05 1832.9679 17 31.1 459.2635 4 74.34 2 36135 AEV_1_3_RA2_01_1232.d 0 1 1 109 125 Methylation(KR); Carbamidomethylation; Amidation
K.SAEQ(+.98)TPLSALYAAK.L Y 19.85 1449.7351 14 -86.0 725.8125 2 81.14 1 42833 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 188 201 Deamidation (NQ)
K.AYSIARID(-18.01)VANAAGC(+57.02)IR.Y Y 19.77 1801.9257 17 -61.7 451.4609 4 71.44 1 35056 AEV 2_3_RA2_01_1224.d 2.58E5 1 1 109 125 Dehydration; Carbamidomethylation
K.DVDIAVAAARAAFK(+143.06).G Y 19.64 1559.8307 14 -1.4 390.9644 4 25.49 2 8722 AEV_1_3_RA2_01_1232.d 5.32E4 1 1 56 69 Nethylmaleimidehydrolysis
K.GVEGR(+.98).T Y 18.61 517.2496 5 17.7 518.2660 1 10.40 2 2624 AEV_1_3_RA2_01_1232.d 0 1 1 29 33 Deamidation (R)
K.ESGLGR.E Y 18.54 617.3132 6 -60.2 309.6453 2 63.26 1 28976 AEV 2_3_RA2_01_1224.d 0 1 1 443 448
K.S(+13.03)AEQTPLSALYAAK.L Y 18.11 1461.7827 14 -61.7 731.8535 2 77.09 2 38253 AEV_1_3_RA2_01_1232.d 0 1 1 188 201 Michael addition with methylamine
K.KVTLELGGK(+27.99).S Y 17.99 971.5651 9 -30.5 324.8524 3 29.71 2 10576 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 259 267 Formylation
R.VSNELK(+97.02).A Y 17.38 785.3919 6 15.2 786.4111 1 84.98 2 44307 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 415 420 Maleimide
R.QILQAAAK(-.98)(+42.01).S Y 17.05 882.5287 8 -14.8 442.2651 2 79.26 1 41250 AEV 2_3_RA2_01_1224.d 1.03E5 1 1 247 254 Amidation; Acetylation (K)
K.VAFTGS(-18.01)TLVGR.Q Y 16.74 1088.5978 11 -39.2 545.2849 2 76.80 3 45542 AEV_3_3_RA3_01_1233.d 8.86E4 1 1 236 246 Dehydration
R.IDVAN(+.98)AAGC(+57.02)IR(+31.99).Y Y 16.59 1191.5554 11 -82.2 398.1598 3 21.47 1 5213 AEV 2_3_RA2_01_1224.d 0 1 1 115 125 Deamidation (NQ); Carbamidomethylation; Dihydroxy
R.TFESINPH(+125.90)NEKPIVAVYEATEK.D Y 16.48 2641.1560 22 17.0 661.3075 4 89.05 1 48913 AEV 2_3_RA2_01_1224.d 0 1 1 34 55 Iodination
K.HVTPTNRGR(+28.03).M Y 16.00 1064.5839 9 11.1 355.8725 3 49.29 3 25267 AEV_3_3_RA3_01_1233.d 0 1 1 74 82 Dimethylation(KR)
K.GPWKHVTPTNRGR.M Y 15.92 1504.8011 13 -83.3 377.1762 4 73.78 1 36912 AEV 2_3_RA2_01_1224.d 7.18E4 1 1 70 82
K.A(+226.08)AGAK.V N 15.76 642.3159 5 -13.0 643.3148 1 63.68 2 28347 AEV_1_3_RA2_01_1232.d 5.87E4 1 1 357 361 Biotinylation
R.ELGEYALDN(+.98)YTQ(+.98)VK.A Y 15.67 1643.7566 14 -4.8 822.8816 2 82.67 1 43923 AEV 2_3_RA2_01_1224.d 0 1 1 449 462 Deamidation (NQ)
K.AAGAK(+21.98).V N 15.66 438.2202 5 2.1 439.2285 1 9.20 3 2235 AEV_3_3_RA3_01_1233.d 0 1 1 357 361 Sodium adduct
R.GHE(+105.90)DR.Q Y 15.54 718.1588 5 46.5 719.1995 1 1.70 3 394 AEV_3_3_RA3_01_1233.d 0 1 1 387 391 Replacement of proton by silver
K.S(+79.97)AEQTPLSALY(+79.97)AAK.L Y 15.53 1608.6837 14 5.7 403.1805 4 67.30 1 31874 AEV 2_3_RA2_01_1224.d 0 1 1 188 201 Phosphorylation (STY)
R.EGK(+14.02)AAGAK(+42.01)VEIGGER(+14.02).L Y 15.50 1540.8208 15 59.9 386.2355 4 46.12 2 18494 AEV_1_3_RA2_01_1232.d 0 1 1 354 368 Methylation(KR); Acetylation (K)
R.L(+42.01)AAAVHTTDLN(+.98)TAIR.V Y 15.37 1608.8472 15 -27.5 403.2080 4 53.01 3 27713 AEV_3_3_RA3_01_1233.d 8.58E4 1 1 400 414 Acetylation (N-term); Deamidation (NQ)
K.AYSIAR.I Y 15.21 679.3653 6 7.1 340.6923 2 28.01 2 9816 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 109 114
R.EGK(+14.02)AAGAK(+27.99)VEIGGER.L Y 15.15 1512.7896 15 -20.1 505.2603 3 91.26 2 47836 AEV_1_3_RA2_01_1232.d 0 1 1 354 368 Methylation(KR); Formylation
K.DVDIAVAAAR(+28.03).A Y 15.14 1027.5662 10 3.6 343.5306 3 36.95 2 13996 AEV_1_3_RA2_01_1232.d 0 1 1 56 65 Dimethylation(KR)
K.A(+42.01)YS(-18.01)IAR.I Y 15.13 703.3653 6 8.3 704.3784 1 49.17 3 25200 AEV_3_3_RA3_01_1233.d 0 1 1 109 114 Acetylation (N-term); Dehydration
total 79 peptides
C1GAM9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TTGFALIYDSTEALKKFEPR.Y Y 138.20 2286.1895 20 2.0 763.0720 3 84.97 2 44294 AEV_1_3_RA2_01_1232.d 3.41E6 9 9 161 180
R.KQIVVDILHPNR.A Y 125.83 1430.8357 12 0.0 477.9525 3 64.60 2 29003 AEV_1_3_RA2_01_1232.d 4.41E6 9 9 113 124
K.TTGFALIYDSTEALK.K Y 124.09 1628.8297 15 1.7 815.4235 2 83.44 2 43199 AEV_1_3_RA2_01_1232.d 3.51E6 9 9 161 175
R.GKLSELYKSNKEQVSVFGLR.T Y 123.59 2281.2429 20 -2.4 571.3167 4 71.75 3 41606 AEV_3_3_RA3_01_1233.d 6.81E5 3 3 134 153
K.TTGFALIYDSTEALKK.F Y 119.45 1756.9247 16 2.2 586.6501 3 79.44 2 40112 AEV_1_3_RA2_01_1232.d 2.27E6 6 6 161 176
K.SNKEQVSVFGLR.T Y 114.05 1362.7256 12 3.1 455.2505 3 64.56 2 28961 AEV_1_3_RA2_01_1232.d 7.77E6 11 11 142 153
R.KQIVVDILHPNRANISKDELR.G Y 112.59 2457.3816 21 1.0 492.4841 5 66.64 3 37572 AEV_3_3_RA3_01_1233.d 7.51E5 3 3 113 133
K.LSELYKSNKEQVSVFGLR.T Y 106.16 2096.1265 18 -4.1 525.0367 4 71.00 3 41036 AEV_3_3_RA3_01_1233.d 1.04E6 5 5 136 153
R.THYGGGKTTGFALIYDSTEALK.K Y 104.44 2329.1589 22 3.8 777.3965 3 76.33 3 45195 AEV_3_3_RA3_01_1233.d 1.19E6 4 4 154 175
K.FIRNPLLAR.K Y 92.91 1098.6661 9 3.4 367.2306 3 66.95 2 30662 AEV_1_3_RA2_01_1232.d 5.52E6 10 10 104 112
R.THYGGGKTTGFALIYDSTEALKK.F Y 92.70 2457.2539 23 -6.8 820.0863 3 72.68 3 42334 AEV_3_3_RA3_01_1233.d 1.06E5 2 2 154 176
K.Q(-17.03)IVVDILHPNR.A Y 92.48 1285.7142 11 2.6 643.8661 2 81.84 2 42023 AEV_1_3_RA2_01_1232.d 1.99E6 5 5 114 124 Pyro-glu from Q
K.QIVVDILHPNR.A Y 88.38 1302.7408 11 -2.7 435.2531 3 70.32 3 40511 AEV_3_3_RA3_01_1233.d 1.35E6 5 5 114 124
K.Q(-17.03)IVVDILHPNRANISKDELR.G Y 88.10 2312.2600 20 6.3 579.0759 4 78.62 2 39466 AEV_1_3_RA2_01_1232.d 5.4E5 3 3 114 133 Pyro-glu from Q
K.TTGFALIYDSTEALKKFEPR(+14.02).Y Y 84.43 2300.2051 20 0.1 576.0586 4 87.07 2 45658 AEV_1_3_RA2_01_1232.d 7.21E5 3 3 161 180 Methylation(KR)
K.TTGFALIYDSTEALK(+14.02).K Y 79.21 1642.8453 15 -1.3 822.4289 2 85.08 3 51747 AEV_3_3_RA3_01_1233.d 7.8E5 4 4 161 175 Methylation(KR)
K.SNKEQ(+.98)VSVFGLR.T Y 74.47 1363.7096 12 -1.4 455.5765 3 65.36 3 36565 AEV_3_3_RA3_01_1233.d 8.18E5 5 5 142 153 Deamidation (NQ)
R.GKLSELYK.S Y 74.01 936.5280 8 2.2 469.2723 2 46.10 2 18483 AEV_1_3_RA2_01_1232.d 3.53E6 9 9 134 141
K.TTGFALIYDSTEALKK(+14.02).F Y 72.78 1770.9403 16 3.7 591.3229 3 80.39 2 40869 AEV_1_3_RA2_01_1232.d 3.82E5 2 2 161 176 Methylation(KR)
K.EQVSVFGLR.T Y 69.52 1033.5557 9 1.9 517.7861 2 72.53 2 34757 AEV_1_3_RA2_01_1232.d 8.4E5 2 2 145 153
K.FIRNPLLAR(+14.02).K Y 68.63 1112.6818 9 -3.2 371.9000 3 66.89 3 37764 AEV_3_3_RA3_01_1233.d 3.46E5 3 3 104 112 Methylation(KR)
K.TTGFALIYDSTE(+14.02)ALKKFEPR.Y Y 68.08 2300.2051 20 -0.6 576.0582 4 84.68 3 51475 AEV_3_3_RA3_01_1233.d 8.86E4 1 1 161 180 Methylation(others)
R.IGAAEKVEKASR.Q Y 67.14 1257.7041 12 2.8 629.8611 2 20.79 3 8240 AEV_3_3_RA3_01_1233.d 9.49E5 5 5 186 197
K.T(-2.02)TGFALIYDSTEALKKFEPR.Y Y 66.85 2284.1738 20 -11.4 762.3899 3 84.72 3 51509 AEV_3_3_RA3_01_1233.d 9.78E4 1 1 161 180 2-amino-3-oxo-butanoic_acid
R.ANISKDELR.G Y 66.09 1044.5564 9 0.2 523.2856 2 26.29 3 11301 AEV_3_3_RA3_01_1233.d 8.7E6 17 17 125 133
K.TTGFALIYDST(+14.02)EALK.K Y 65.00 1642.8453 15 0.9 822.4307 2 84.44 3 51327 AEV_3_3_RA3_01_1233.d 2.89E5 1 1 161 175 Methylation(others)
K.SNKE(+14.02)QVSVFGLR.T Y 64.92 1376.7412 12 -3.3 459.9195 3 67.06 3 37929 AEV_3_3_RA3_01_1233.d 5.8E5 2 2 142 153 Methylation(others)
R.THYGGGKTTGFALIYDSTEALKKFEPR(+14.02).Y Y 64.86 3000.5344 27 9.7 601.1200 5 81.93 3 49538 AEV_3_3_RA3_01_1233.d 8.67E4 1 1 154 180 Methylation(KR)
K.LSE(+14.02)LYKSNKEQVSVFGLR.T Y 64.08 2110.1421 18 29.7 528.5585 4 72.78 3 42408 AEV_3_3_RA3_01_1233.d 0 1 1 136 153 Methylation(others)
K.SNK(+14.02)EQVSVFGLR.T Y 61.08 1376.7412 12 2.9 459.9223 3 68.11 2 31442 AEV_1_3_RA2_01_1232.d 7.68E5 2 2 142 153 Methylation(KR)
R.IGAAEKVEK.A Y 59.94 943.5338 9 4.4 472.7762 2 17.66 2 5421 AEV_1_3_RA2_01_1232.d 8.51E6 14 14 186 194
K.TTGFALIYDSTEALK(+14.02)K.F Y 57.90 1770.9403 16 -0.8 886.4767 2 79.97 3 48048 AEV_3_3_RA3_01_1233.d 5.18E4 1 1 161 176 Methylation(KR)
R.KFIRNPLLAR.K Y 57.28 1226.7611 10 3.7 409.9291 3 64.16 2 28669 AEV_1_3_RA2_01_1232.d 2.91E6 8 8 103 112
R.ANISKDELRGK.L Y 56.57 1229.6727 11 5.9 615.8473 2 23.27 2 7764 AEV_1_3_RA2_01_1232.d 9.6E5 5 5 125 135
K.T(+43.01)TGFALIYDSTEALKKFEPR.Y Y 56.16 2329.1953 20 67.6 583.3455 4 84.94 2 44274 AEV_1_3_RA2_01_1232.d 0 2 2 161 180 Carbamylation
K.Q(-17.03)IVVDILHPNRANISK(+14.02)DELR.G Y 55.01 2326.2756 20 3.8 582.5784 4 79.55 3 47717 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 114 133 Pyro-glu from Q; Methylation(KR)
K.Q(-17.03)IVVDILHPNRANISKDELR(+14.02).G Y 52.44 2326.2756 20 16.8 582.5859 4 80.00 2 40559 AEV_1_3_RA2_01_1232.d 7.65E4 1 1 114 133 Pyro-glu from Q; Methylation(KR)
R.KQ(+.98)IVVDILHPN(+.98)R.A Y 51.61 1432.8038 12 23.9 478.6200 3 63.20 3 34894 AEV_3_3_RA3_01_1233.d 3.18E4 1 1 113 124 Deamidation (NQ)
K.SN(-17.03)KEQVSVFGLR.T Y 49.80 1345.6990 12 3.3 673.8590 2 72.27 2 34559 AEV_1_3_RA2_01_1232.d 1.41E5 2 2 142 153 Ammonia-loss (N)
K.SNK(+14.02)EQVSVFGLR(+14.02).T Y 47.81 1390.7568 12 -9.1 464.5887 3 70.69 3 40766 AEV_3_3_RA3_01_1233.d 2.93E5 3 3 142 153 Methylation(KR)
K.LS(+14.02)ELYKSNKEQVSVFGLR.T Y 47.62 2110.1421 18 12.1 528.5492 4 73.94 2 35833 AEV_1_3_RA2_01_1232.d 5.29E4 1 1 136 153 Methylation(others)
R.KQIVVDILHPNR(+14.02).A Y 45.85 1444.8514 12 -20.0 362.2129 4 63.56 3 35223 AEV_3_3_RA3_01_1233.d 0 1 1 113 124 Methylation(KR)
K.LSELYK.S Y 42.81 751.4116 6 -2.9 376.7120 2 38.77 3 18671 AEV_3_3_RA3_01_1233.d 4.35E6 11 11 136 141
R.NPLLAR.K Y 42.33 682.4126 6 -90.3 342.1828 2 55.02 1 23186 AEV 2_3_RA2_01_1224.d 2.93E6 9 9 107 112
R.IGAAEKVEK(+14.02).A Y 41.89 957.5494 9 0.2 479.7821 2 23.03 3 9476 AEV_3_3_RA3_01_1233.d 1.28E6 5 5 186 194 Methylation(KR)
R.L(+43.01)VR(+14.02)IGAAEKVEK.A Y 41.40 1368.8088 12 -15.6 343.2041 4 16.20 3 5777 AEV_3_3_RA3_01_1233.d 0 1 1 183 194 Carbamylation; Methylation(KR)
R.ANISKDELR(+14.02).G Y 40.93 1058.5720 9 1.6 353.8652 3 36.95 3 17558 AEV_3_3_RA3_01_1233.d 1.95E6 8 8 125 133 Methylation(KR)
R.THYGGGK(-1.03)TTGFALIYDSTEALKKFEPR.Y Y 40.45 2985.4871 27 14.6 598.1134 5 80.22 3 48242 AEV_3_3_RA3_01_1233.d 0 1 1 154 180 Lysine oxidation to aminoadipic semialdehyde
K.L(+41.03)SELYKSNKEQVSVFGLR.T Y 39.88 2137.1531 18 4.1 535.2977 4 72.09 2 34418 AEV_1_3_RA2_01_1232.d 0 1 1 136 153 Amidination of lysines or N-terminal amines with methyl acetimidate
R.THYGGGKTTGFALIYDST(+14.02)EALK.K Y 39.57 2343.1746 22 -6.1 586.7974 4 77.50 3 46099 AEV_3_3_RA3_01_1233.d 1.33E5 1 1 154 175 Methylation(others)
K.FIRNPLLARK.Q Y 39.48 1226.7611 10 -0.8 307.6973 4 57.88 3 30894 AEV_3_3_RA3_01_1233.d 1.42E6 3 3 104 113
R.IGAAE(+14.02)KVEK.A Y 38.94 957.5494 9 0.9 479.7824 2 24.08 3 10043 AEV_3_3_RA3_01_1233.d 2.07E5 1 1 186 194 Methylation(others)
R.KQIVVDILHP(+13.98)NR.A Y 38.15 1444.8151 12 -69.4 362.1860 4 77.68 1 39995 AEV 2_3_RA2_01_1224.d 5.76E5 1 1 113 124 Proline oxidation to pyroglutamic acid
R.KQ(+.98)IVVDILHPNR.A Y 38.05 1431.8197 12 -2.3 358.9614 4 65.19 3 36428 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 113 124 Deamidation (NQ)
K.Q(+.98)IVVDILHPNR.A Y 36.84 1303.7249 11 -19.3 435.5738 3 72.26 3 42000 AEV_3_3_RA3_01_1233.d 0 1 1 114 124 Deamidation (NQ)
R.KFIRNPLLAR(+14.02).K Y 36.72 1240.7767 10 2.4 311.2022 4 65.78 2 29798 AEV_1_3_RA2_01_1232.d 3.07E4 1 1 103 112 Methylation(KR)
K.QIVVDILHPNR(+14.02).A Y 36.37 1316.7565 11 14.4 439.9324 3 71.50 2 33968 AEV_1_3_RA2_01_1232.d 6.89E4 1 1 114 124 Methylation(KR)
K.TTGFALIYDSTEALK(+14.02)KFEPR.Y Y 35.65 2300.2051 20 9.2 576.0638 4 85.48 3 52023 AEV_3_3_RA3_01_1233.d 2.82E5 1 1 161 180 Methylation(KR)
K.TTGFALIYDSTE(+14.02)ALK.K Y 35.49 1642.8453 15 19.5 822.4460 2 84.64 2 44104 AEV_1_3_RA2_01_1232.d 5.82E3 1 1 161 175 Methylation(others)
R.GKLSELYK(+14.02).S Y 34.36 950.5436 8 -19.0 476.2701 2 51.17 3 26555 AEV_3_3_RA3_01_1233.d 0 1 1 134 141 Methylation(KR)
K.SNKEQVSVFGLR(+14.02).T Y 33.82 1376.7412 12 -90.1 459.8797 3 78.68 1 40788 AEV 2_3_RA2_01_1224.d 2.65E5 1 1 142 153 Methylation(KR)
K.LSELYKSNKEQVSVFGLR(+14.02).T Y 33.73 2110.1421 18 10.0 528.5481 4 73.58 3 43034 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 136 153 Methylation(KR)
R.TTATTDKPSSQPSSS(+162.05)RFIK.A Y 33.15 2200.0859 19 -11.0 551.0227 4 56.37 3 29773 AEV_3_3_RA3_01_1233.d 3.98E4 1 1 57 75 Hexose (NSY)
K.Q(+42.01)IVVDILHPNR.A Y 32.61 1344.7513 11 -55.1 449.2330 3 70.50 3 40625 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 114 124 Acetylation (N-term)
R.IGAAE(+43.99)KVEK.A Y 32.60 987.5236 9 -23.0 494.7578 2 73.88 3 43256 AEV_3_3_RA3_01_1233.d 4.23E5 2 2 186 194 Carboxylation (E)
K.T(-18.01)TGPK.K Y 32.46 484.2645 5 -85.6 485.2303 1 75.36 1 38164 AEV 2_3_RA2_01_1224.d 7.56E4 2 2 216 220 Dehydration
R.IGAAEK(+14.02)VEK.A Y 31.75 957.5494 9 2.8 479.7833 2 26.02 2 8949 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 186 194 Methylation(KR)
K.TTGFALIYDSTEALKKFEPR(+.98).Y Y 31.36 2287.1736 20 7.7 572.8051 4 84.82 3 51573 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 161 180 Deamidation (R)
K.LSELYKSN(+.98)KEQVSVF(+31.99)GLR.T Y 30.90 2129.1003 18 -22.1 710.6917 3 47.83 3 24386 AEV_3_3_RA3_01_1233.d 9.78E4 1 1 136 153 Deamidation (NQ); Dihydroxy
R.GKLSE(+14.02)LYK.S Y 29.91 950.5436 8 -17.9 476.2706 2 46.73 3 23638 AEV_3_3_RA3_01_1233.d 0 2 2 134 141 Methylation(others)
K.T(+42.01)TGPK(+42.01).K Y 28.57 586.2963 5 -86.6 587.2527 1 69.21 1 33348 AEV 2_3_RA2_01_1224.d 0 1 1 216 220 Acetylation (N-term); Acetylation (K)
K.F(+43.01)IR(+14.02)NPLLAR.K Y 28.37 1155.6876 9 1.0 386.2369 3 73.17 2 35250 AEV_1_3_RA2_01_1232.d 1.29E5 2 2 104 112 Carbamylation; Methylation(KR)
R.IGAAEK(+42.01).V Y 28.31 629.3384 6 -25.7 630.3295 1 75.64 3 44631 AEV_3_3_RA3_01_1233.d 0 1 1 186 191 Acetylation (K)
K.LSE(+14.02)LYK.S Y 27.98 765.4272 6 -1.6 383.7203 2 51.36 3 26612 AEV_3_3_RA3_01_1233.d 7.68E5 4 4 136 141 Methylation(others)
K.F(+42.01)RGTEKTTGPK.K Y 27.40 1262.6619 11 5.0 421.8967 3 41.67 3 20451 AEV_3_3_RA3_01_1233.d 0 1 1 210 220 Acetylation (N-term)
K.LSELYK(+14.02).S Y 26.23 765.4272 6 -0.5 383.7207 2 49.13 3 25169 AEV_3_3_RA3_01_1233.d 4.21E5 3 3 136 141 Methylation(KR)
K.FRGTEK(+31.99)TTGPK(+42.01).K Y 26.19 1294.6517 11 -5.3 324.6685 4 26.48 2 9151 AEV_1_3_RA2_01_1232.d 0 1 1 210 220 Dihydroxy; Acetylation (K)
R.K(+54.01)QIVVDILHPNR.A Y 26.05 1484.8463 12 1.4 372.2194 4 62.98 3 34722 AEV_3_3_RA3_01_1233.d 0 1 1 113 124 MDA adduct +54
K.KFEPR.Y N 25.92 675.3704 5 4.4 338.6939 2 12.51 2 3425 AEV_1_3_RA2_01_1232.d 8.83E5 3 3 176 180
R.I(+41.03)GAAEKVEK.A Y 25.36 984.5604 9 -10.0 329.1908 3 16.35 3 5866 AEV_3_3_RA3_01_1233.d 0 1 1 186 194 Amidination of lysines or N-terminal amines with methyl acetimidate
K.E(+21.98)QVSVFGLR.T Y 25.13 1055.5376 9 34.1 528.7941 2 72.80 3 42429 AEV_3_3_RA3_01_1233.d 6.46E4 1 1 145 153 Sodium adduct
R.NPLLAR(+14.02).K Y 24.99 696.4282 6 -1.4 349.2209 2 46.14 3 23274 AEV_3_3_RA3_01_1233.d 1.27E5 2 2 107 112 Methylation(KR)
R.YRLVR.I Y 24.90 705.4286 5 -3.8 353.7202 2 24.99 3 10607 AEV_3_3_RA3_01_1233.d 2E6 4 4 181 185
R.KFIRNPLLARK.Q Y 24.28 1354.8561 11 -8.1 452.6223 3 55.04 3 28994 AEV_3_3_RA3_01_1233.d 2.29E5 1 1 103 113
K.T(+43.01)TGPK.K Y 24.19 545.2809 5 -6.9 546.2844 1 22.32 3 9065 AEV_3_3_RA3_01_1233.d 4.24E4 1 1 216 220 Carbamylation
R.G(+42.01)K(+42.01)LSELYK.S Y 23.72 1020.5491 8 -11.2 341.1865 3 41.80 3 20535 AEV_3_3_RA3_01_1233.d 9E4 1 1 134 141 Acetylation (N-term); Acetylation (K)
K.TTGPK(+31.99).K Y 23.61 534.2650 5 -3.8 535.2702 1 54.77 3 28848 AEV_3_3_RA3_01_1233.d 0 1 1 216 220 Dihydroxy
R.KQIVVD(+14.02)ILHPNR.A Y 23.50 1444.8514 12 -16.8 362.2141 4 64.65 2 29012 AEV_1_3_RA2_01_1232.d 0 1 1 113 124 Methylation(others)
K.F(+362.14)IRNPLLAR.K Y 23.01 1460.8027 9 32.4 366.2198 4 66.02 3 37078 AEV_3_3_RA3_01_1233.d 0 1 1 104 112 Nucleophilic addtion to cytopiloyne
R.K(+78.05)QIVVDILHPNR.A Y 23.00 1508.8827 12 -9.8 378.2242 4 64.65 2 29011 AEV_1_3_RA2_01_1232.d 0 1 1 113 124 2,5-dimethypyrrole
K.S(-18.01)NK(+14.02)EQVSVFGLR.T Y 22.50 1358.7306 12 -31.1 680.3514 2 63.78 3 35338 AEV_3_3_RA3_01_1233.d 0 1 1 142 153 Dehydration; Methylation(KR)
R.N(+.98)AVVGPSR.E Y 22.45 799.4188 8 -7.8 800.4198 1 91.12 3 55318 AEV_3_3_RA3_01_1233.d 5.05E3 1 1 32 39 Deamidation (NQ)
K.EQVS(-18.01)VFGLR.T Y 22.39 1015.5450 9 43.4 339.5370 3 52.77 2 21861 AEV_1_3_RA2_01_1232.d 3.93E4 1 1 145 153 Dehydration
R.T(+42.01)RK(+43.01)FIRNPLLAR.K Y 22.03 1568.9263 12 -56.0 393.2169 4 65.92 3 37001 AEV_3_3_RA3_01_1233.d 0 1 1 101 112 Acetylation (N-term); Carbamylation
K.E(+43.01)QVSVFGLR.T Y 21.55 1076.5614 9 5.9 539.2911 2 44.34 2 17611 AEV_1_3_RA2_01_1232.d 1.15E5 1 1 145 153 Carbamylation
R.IGAAEKVEK(+42.01).A Y 21.46 985.5444 9 -26.3 493.7665 2 50.34 3 25940 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 186 194 Acetylation (K)
R.N(+.98)AVVGPS(+79.97)R.E Y 21.44 879.3851 8 98.8 880.4793 1 82.57 3 50006 AEV_3_3_RA3_01_1233.d 3.06E4 1 1 32 39 Deamidation (NQ); Phosphorylation (STY)
K.K(+44.03)FEPRYRLVR.I Y 21.25 1406.8146 10 -6.5 352.7086 4 28.76 2 10151 AEV_1_3_RA2_01_1232.d 0 1 1 176 185 Ethanolation (KR)
K.S(+42.01)N(+.98)K(+14.02)EQVSVFGLR.T Y 21.17 1419.7357 12 -81.5 474.2140 3 74.43 1 37413 AEV 2_3_RA2_01_1224.d 2.62E5 1 1 142 153 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
R.GKLSELYKSNK(+14.02)EQVSVFGLR.T Y 20.96 2295.2585 20 6.3 460.0619 5 73.82 3 43205 AEV_3_3_RA3_01_1233.d 9.74E4 1 1 134 153 Methylation(KR)
K.TTGPK.K Y 20.65 502.2751 5 42.4 503.3037 1 72.32 3 42044 AEV_3_3_RA3_01_1233.d 1.04E6 4 4 216 220
K.KFRGTEK.T Y 20.11 864.4817 7 1.7 433.2488 2 9.64 3 2399 AEV_3_3_RA3_01_1233.d 1.56E4 1 1 209 215
R.N(+42.01)PLLAR.K Y 19.34 724.4232 6 -33.6 363.2067 2 38.41 2 14708 AEV_1_3_RA2_01_1232.d 1.24E5 1 1 107 112 Acetylation (N-term)
K.T(+42.01)T(+79.97)GPK.K Y 19.30 624.2520 5 -26.0 625.2430 1 34.74 1 11550 AEV 2_3_RA2_01_1224.d 0 1 1 216 220 Acetylation (N-term); Phosphorylation (STY)
R.IGAAEKVEK(+31.99)ASRQQR.K Y 18.86 1701.9121 15 -36.4 568.2906 3 69.60 2 32547 AEV_1_3_RA2_01_1232.d 0 1 1 186 200 Dihydroxy
K.TTGP(+31.99)K.K Y 18.72 534.2650 5 -11.8 535.2659 1 23.19 2 7725 AEV_1_3_RA2_01_1232.d 0 1 1 216 220 Dihydroxy
K.VEKASR(+21.98).Q Y 18.45 710.3687 6 -56.0 356.1718 2 62.26 1 28230 AEV 2_3_RA2_01_1224.d 0 1 1 192 197 Sodium adduct
R.THYGGGK.T Y 17.80 718.3398 7 1.3 360.1777 2 74.36 1 37358 AEV 2_3_RA2_01_1224.d 2.48E4 1 1 154 160
R.HWIS(-18.01)R.T Y 17.69 679.3554 5 -5.8 680.3588 1 84.35 2 43865 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 52 56 Dehydration
R.KFIRN(+.98)PLLAR.K Y 17.52 1227.7451 10 21.0 307.9500 4 64.24 2 28724 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 103 112 Deamidation (NQ)
R.IGAAEK(+14.02)VEK(+14.02).A Y 17.51 971.5651 9 -5.1 486.7874 2 34.68 2 12953 AEV_1_3_RA2_01_1232.d 3.51E4 1 1 186 194 Methylation(KR)
R.K(+42.01)(+14.02)Q(+.98)IVVDILHPNR.A Y 17.45 1487.8459 12 -28.4 372.9582 4 63.00 3 34743 AEV_3_3_RA3_01_1233.d 0 1 1 113 124 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
K.TTGPK(+27.99).K Y 17.38 530.2700 5 12.4 531.2839 1 72.70 3 42348 AEV_3_3_RA3_01_1233.d 8.42E4 1 1 216 220 Formylation
R.A(+42.01)NISK(+42.01).D Y 17.14 615.3228 5 -5.2 616.3268 1 33.73 2 12471 AEV_1_3_RA2_01_1232.d 0 1 1 125 129 Acetylation (N-term); Acetylation (K)
K.DELRGKLSELYK(+43.01).S Y 16.87 1492.7885 12 -26.4 374.1945 4 55.11 2 23063 AEV_1_3_RA2_01_1232.d 0 1 1 130 141 Carbamylation
R.N(+.98)AVVGPSR(+14.02)EPTSK.H Y 16.75 1355.7045 13 10.5 452.9135 3 56.61 2 23880 AEV_1_3_RA2_01_1232.d 1.17E5 1 1 32 44 Deamidation (NQ); Methylation(KR)
R.NAVVGPSR.E Y 16.73 798.4348 8 -142.4 799.3284 1 93.96 1 52450 AEV 2_3_RA2_01_1224.d 0 1 1 32 39
R.I(+42.01)GAAEKVEK(+14.02).A Y 16.53 999.5600 9 -6.9 334.1917 3 26.12 2 8996 AEV_1_3_RA2_01_1232.d 0 1 1 186 194 Acetylation (N-term); Methylation(KR)
R.TTATTDK(+43.01)PSSQPS(+79.97)SSR.F Y 16.26 1772.7578 16 -17.4 444.1890 4 72.74 1 36087 AEV 2_3_RA2_01_1224.d 0 1 1 57 72 Carbamylation; Phosphorylation (STY)
K.FRGTEK.T Y 16.02 736.3868 6 6.2 369.2029 2 9.42 2 2292 AEV_1_3_RA2_01_1232.d 3.12E4 1 1 210 215
R.SKKFR.G N 15.87 664.4020 5 3.9 333.2096 2 8.62 2 2040 AEV_1_3_RA2_01_1232.d 8.32E3 1 1 207 211
K.TT(+14.02)GPK.K Y 15.79 516.2908 5 -19.4 517.2880 1 59.90 3 32352 AEV_3_3_RA3_01_1233.d 0 1 1 216 220 Methylation(others)
K.TTGFALIYDSTEALKK(+14.96)FEPR.Y Y 15.77 2301.1528 20 36.5 576.3165 4 86.65 3 52801 AEV_3_3_RA3_01_1233.d 6.7E4 1 1 161 180 Alpha-amino adipic acid
K.TT(-18.01)GPK(+14.02).K Y 15.70 498.2802 5 -33.4 499.2708 1 59.20 2 25363 AEV_1_3_RA2_01_1232.d 0 1 1 216 220 Dehydration; Methylation(KR)
K.S(+42.01)NK(+14.02)EQ(+.98)VSVFGLR.T Y 15.66 1419.7357 12 -83.1 474.2132 3 73.95 1 37100 AEV 2_3_RA2_01_1224.d 2.62E5 1 1 142 153 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
R.N(+162.05)AVVGPSR.E Y 15.65 960.4875 8 19.9 481.2606 2 70.90 2 33523 AEV_1_3_RA2_01_1232.d 1.51E5 1 1 32 39 Hexose (NSY)
R.EPT(-18.01)SK(+14.02).H Y 15.59 556.2856 5 -6.8 557.2891 1 34.02 3 15750 AEV_3_3_RA3_01_1233.d 0 1 1 40 44 Dehydration; Methylation(KR)
R.IGAAEK(+21.98).V Y 15.53 609.3098 6 24.1 610.3318 1 83.91 2 43551 AEV_1_3_RA2_01_1232.d 8.73E4 1 1 186 191 Sodium adduct
K.TTGPK(+43.99).K Y 15.40 546.2650 5 18.9 547.2825 1 31.26 2 11296 AEV_1_3_RA2_01_1232.d 0 1 1 216 220 Carboxylation (DKW)
R.THYGGGK(+111.03)TTGFALIYDSTEALK.K Y 15.37 2440.1909 22 54.5 814.4486 3 83.73 3 50827 AEV_3_3_RA3_01_1233.d 0 1 1 154 175 Nmethylmaleimide
K.EQ(+.98)VSVFGLR.T Y 15.33 1034.5397 9 -74.3 345.8282 3 54.68 1 22968 AEV 2_3_RA2_01_1224.d 4.2E5 1 1 145 153 Deamidation (NQ)
K.TTGFALIYDSTE(+129.04)ALK.K Y 15.24 1757.8723 15 30.8 586.9828 3 79.07 3 47340 AEV_3_3_RA3_01_1233.d 2.21E5 1 1 161 175 Monoglutamyl
R.IGAAEKVEK(+14.02)ASR.Q Y 15.19 1271.7197 12 -55.9 318.9194 4 28.45 3 12502 AEV_3_3_RA3_01_1233.d 5.09E5 1 1 186 197 Methylation(KR)
MVKNGS(-18.01)K.K Y 15.09 744.3953 7 15.8 373.2108 2 10.00 3 2552 AEV_3_3_RA3_01_1233.d 2.68E4 1 1 1 7 Dehydration
total 134 peptides
C1GAG4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.HLTPLPLKLQTPVPSDIAISR.A Y 136.73 2295.3313 21 4.6 574.8427 4 79.81 2 40406 AEV_1_3_RA2_01_1232.d 3.53E5 2 2 398 418
R.AQRPKPITTVAAEIGIAPQELEPYGHTK.A Y 115.19 3014.6189 28 4.0 603.9335 5 77.54 2 38603 AEV_1_3_RA2_01_1232.d 4.77E5 3 3 419 446
R.MFHESTQSDAALYKR.L Y 108.91 1782.8359 15 4.4 595.2885 3 51.46 3 26680 AEV_3_3_RA3_01_1233.d 3.51E5 4 4 558 572
R.IAFANVRQPSQGPTFGIK.G Y 106.26 1930.0425 18 -1.7 644.3537 3 73.09 3 42653 AEV_3_3_RA3_01_1233.d 1.99E5 2 2 498 515
R.SDIVGSPVSYLLK.S Y 100.67 1376.7551 13 1.3 689.3857 2 81.89 2 42044 AEV_1_3_RA2_01_1232.d 7.24E5 3 3 270 282
R.SSGLVPDTVVIVATVR.A Y 98.56 1611.9196 16 2.1 538.3149 3 82.59 2 42618 AEV_1_3_RA2_01_1232.d 4.57E5 5 5 790 805
R.YILVC(+57.02)GITPTPLGEGK.S Y 96.99 1716.9120 16 -0.9 859.4625 2 80.28 3 48303 AEV_3_3_RA3_01_1233.d 5.95E5 5 5 465 480 Carbamidomethylation
K.TKDLENIIKQADILVAAIGKPEFVK.G Y 96.85 2752.5737 25 2.2 551.5233 5 88.80 3 54075 AEV_3_3_RA3_01_1233.d 7.96E4 1 1 295 319
K.STTTMGLTQALGAHLNR.I Y 96.42 1770.9047 17 3.7 591.3110 3 72.22 3 41962 AEV_3_3_RA3_01_1233.d 2.85E5 3 3 481 497
K.DVDGFGAVNIGELAK.R Y 95.80 1503.7568 15 -2.7 752.8837 2 82.00 3 49631 AEV_3_3_RA3_01_1233.d 4.63E5 3 3 219 233
K.AAQEANIQC(+57.02)QLTK.F Y 95.39 1473.7246 13 2.9 737.8717 2 55.51 2 23266 AEV_1_3_RA2_01_1232.d 3.15E5 4 4 157 169 Carbamidomethylation
K.TNPDDLTPEEINR.F Y 95.19 1512.7056 13 -1.1 757.3592 2 62.78 3 34591 AEV_3_3_RA3_01_1233.d 1.12E6 6 6 599 611
K.Q(-17.03)ADILVAAIGKPEFVK.G Y 86.53 1680.9449 16 0.6 841.4802 2 85.96 3 52338 AEV_3_3_RA3_01_1233.d 1.64E5 3 3 304 319 Pyro-glu from Q
K.LAGTEPDEDHEAK.T Y 86.25 1410.6262 13 19.4 706.3340 2 21.27 3 8525 AEV_3_3_RA3_01_1233.d 8.02E5 10 10 752 764
R.NGRYILVC(+57.02)GITPTPLGEGK.S Y 82.89 2044.0775 19 -4.3 682.3635 3 76.43 3 45242 AEV_3_3_RA3_01_1233.d 4.97E4 1 1 462 480 Carbamidomethylation
K.STTTM(+15.99)GLTQALGAHLNR.I Y 82.45 1786.8995 17 3.8 596.6427 3 68.82 2 31973 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 481 497 Oxidation (M)
R.GITIGQAATER.G Y 78.01 1115.5935 11 2.8 558.8056 2 54.91 2 22955 AEV_1_3_RA2_01_1232.d 1.71E6 7 7 637 647
K.LQTPVPSDIAISR.A Y 77.57 1395.7721 13 12.5 698.9020 2 72.89 2 35030 AEV_1_3_RA2_01_1232.d 5.25E5 3 3 406 418
K.LLYDLEGTVQER.I Y 71.39 1434.7355 12 -0.4 718.3748 2 75.15 2 36732 AEV_1_3_RA2_01_1232.d 7.62E4 1 1 917 928
K.SADATVTVC(+57.02)HSK.T Y 67.49 1274.5925 12 -18.6 638.2917 2 20.73 3 8206 AEV_3_3_RA3_01_1233.d 4.16E5 6 6 283 294 Carbamidomethylation
R.LNAEIQKSQQTNPR.F Y 64.24 1625.8485 14 4.0 542.9589 3 31.54 3 14295 AEV_3_3_RA3_01_1233.d 6.63E4 1 1 118 131
R.QPSQGPTFGIK.G Y 64.17 1158.6033 11 3.7 580.3110 2 59.32 2 25505 AEV_1_3_RA2_01_1232.d 1.39E5 3 3 505 515
R.EFQPIFFR.R Y 63.66 1082.5548 8 4.9 542.2874 2 80.41 2 40891 AEV_1_3_RA2_01_1232.d 2.16E5 2 2 582 589
K.Q(-17.03)GFGNLPIC(+57.02)IAK.T Y 63.32 1299.6646 12 2.8 650.8414 2 85.34 2 44545 AEV_1_3_RA2_01_1232.d 3.37E5 2 2 958 969 Pyro-glu from Q; Carbamidomethylation
R.LDIDPETITWRR.V Y 61.21 1513.7888 12 0.2 505.6036 3 75.69 3 44694 AEV_3_3_RA3_01_1233.d 3.73E5 3 3 615 626
R.Q(-17.03)PSQGPTFGIK.G Y 59.06 1141.5768 11 2.3 571.7970 2 71.61 2 34046 AEV_1_3_RA2_01_1232.d 3.19E5 2 2 505 515 Pyro-glu from Q
K.RGDPVTC(+57.02)DDIGC(+57.02)GGALTALMK.D Y 53.96 2206.0181 21 4.5 736.3499 3 77.50 3 46102 AEV_3_3_RA3_01_1233.d 1.26E6 1 1 690 710 Carbamidomethylation
R.GITIGQAATER(+14.02).G Y 52.45 1129.6091 11 -5.9 565.8085 2 61.35 2 26766 AEV_1_3_RA2_01_1232.d 3.77E4 1 1 637 647 Methylation(KR)
R.IAFANVR.Q Y 49.37 789.4497 7 -4.3 395.7304 2 55.79 3 29403 AEV_3_3_RA3_01_1233.d 6.52E5 3 3 498 504
K.TNPDDLTPEEINRFAR.L Y 48.69 1886.9122 16 7.9 629.9830 3 71.91 2 34276 AEV_1_3_RA2_01_1232.d 3.21E5 2 2 599 614
K.VTLDLLDR.L Y 47.88 943.5338 8 -1.6 472.7734 2 74.45 3 43705 AEV_3_3_RA3_01_1233.d 9.18E4 2 2 449 456
K.TQYSLSHDPNLK.G Y 46.76 1401.6888 12 9.6 468.2414 3 48.53 3 24782 AEV_3_3_RA3_01_1233.d 3.2E4 2 2 970 981
K.SADATVTVC(+57.02)HSK(+14.02).T Y 45.42 1288.6082 12 -0.7 645.3109 2 26.16 3 11233 AEV_3_3_RA3_01_1233.d 2.54E4 1 1 283 294 Carbamidomethylation; Methylation(KR)
R.HLTPLPLK(+14.02)LQT(-18.01)PVPSDIAISR.A Y 44.40 2291.3364 21 -60.2 573.8069 4 79.89 2 40472 AEV_1_3_RA2_01_1232.d 0 1 1 398 418 Methylation(KR); Dehydration
R.YILVC(+57.02)GITPTPLGEGK(+14.02).S Y 41.58 1730.9276 16 4.9 866.4753 2 80.91 2 41282 AEV_1_3_RA2_01_1232.d 2.95E4 1 1 465 480 Carbamidomethylation; Methylation(KR)
K.VSGIELAGK.N Y 40.12 872.4967 9 -2.3 437.2546 2 49.46 3 25394 AEV_3_3_RA3_01_1233.d 1.9E5 3 3 254 262
R.TENTELLR.K Y 38.09 974.5032 8 -88.8 488.2156 2 55.66 1 23608 AEV 2_3_RA2_01_1224.d 1.94E5 1 1 828 835
K.GAPTGYTVPIRDVR.L Y 37.78 1500.8048 14 4.4 501.2777 3 63.95 2 28523 AEV_1_3_RA2_01_1232.d 7.96E4 1 1 982 995
R.LNAEIQK.S Y 37.72 814.4548 7 2.5 408.2357 2 28.10 2 9852 AEV_1_3_RA2_01_1232.d 1.85E5 2 2 118 124
R.IAFANVRQPSQ(+.98)GPTFGIK.G Y 35.56 1931.0265 18 -12.7 644.6746 3 73.23 3 42765 AEV_3_3_RA3_01_1233.d 0 1 1 498 515 Deamidation (NQ)
R.EFQPIFFRR.L Y 33.30 1238.6560 9 -3.0 413.8914 3 73.41 3 42909 AEV_3_3_RA3_01_1233.d 4.97E5 2 2 582 590
R.GGKPLFVPC(+57.02)TPK.G Y 31.90 1299.7009 12 -31.9 650.8370 2 59.39 3 31958 AEV_3_3_RA3_01_1233.d 5.05E5 3 3 235 246 Carbamidomethylation
K.AKVTLDLLDR.L Y 31.86 1142.6659 10 2.4 381.8968 3 68.60 3 39134 AEV_3_3_RA3_01_1233.d 5.9E4 1 1 447 456
R.QPS(-18.01)QGPTFGIK.G Y 31.59 1140.5928 11 -13.8 571.2958 2 43.65 3 21728 AEV_3_3_RA3_01_1233.d 0 1 1 505 515 Dehydration
R.QPSQGPTF(+31.99)GIK.G Y 30.29 1190.5931 11 -11.2 596.2972 2 53.83 3 28245 AEV_3_3_RA3_01_1233.d 0 1 1 505 515 Dihydroxy
R.FARLDIDPETITWRR.V Y 30.09 1887.9955 15 1.7 473.0069 4 76.93 3 45642 AEV_3_3_RA3_01_1233.d 7.89E4 1 1 612 626
K.GSWLK(-1.03)PGVVVIDVGTNYIDDPTKK.S Y 29.04 2599.3533 24 38.6 650.8707 4 81.24 3 49020 AEV_3_3_RA3_01_1233.d 1.35E5 1 1 320 343 Lysine oxidation to aminoadipic semialdehyde
K.STTTMGL(+53.97)TQALGAHLNR.I Y 28.74 1824.8765 17 43.1 457.2461 4 60.37 3 32690 AEV_3_3_RA3_01_1233.d 9.89E4 2 2 481 497 Trifluoroleucine
K.STTTMGLTQ(+15.00)ALGAHLNR.I Y 27.94 1785.9043 17 -6.8 596.3047 3 68.26 3 38861 AEV_3_3_RA3_01_1233.d 0 1 1 481 497 Deamidation followed by a methylation
R.VLD(-18.01)VNDR.H Y 26.86 811.4188 7 -80.5 812.3608 1 99.31 1 55438 AEV 2_3_RA2_01_1224.d 1.01E4 1 1 627 633 Dehydration
R.G(+42.01)GKPLFVPCTPK.G Y 26.19 1284.6899 12 -78.8 322.1544 4 62.12 1 28129 AEV 2_3_RA2_01_1224.d 0 3 3 235 246 Acetylation (N-term)
R.QPSQGPT(-18.01)FGIK.G Y 25.70 1140.5928 11 -33.1 571.2848 2 45.36 2 18111 AEV_1_3_RA2_01_1232.d 0 1 1 505 515 Dehydration
K.VTLDLLDRLSHR.R Y 25.50 1436.8099 12 -11.7 360.2056 4 75.57 3 44581 AEV_3_3_RA3_01_1233.d 6.14E4 1 1 449 460
K.GVIIASSK(+27.99)PK.D Y 25.07 1026.6073 10 10.6 343.2133 3 29.44 3 13067 AEV_3_3_RA3_01_1233.d 2.84E5 1 1 904 913 Formylation
K.IDGTAIAK(+21.98).N Y 25.01 809.4259 8 -12.9 810.4227 1 97.12 2 50039 AEV_1_3_RA2_01_1232.d 0 1 1 105 112 Sodium adduct
R.GITIGQ(+.98)AATER(+14.02).G Y 24.94 1130.5931 11 12.8 377.8765 3 51.99 2 21457 AEV_1_3_RA2_01_1232.d 6.83E4 1 1 637 647 Deamidation (NQ); Methylation(KR)
K.VEFSELAQKKVDTYTK(+72.02)QGFGNLPIC(+57.02)IAK.T Y 24.33 3255.6848 28 -5.8 652.1404 5 85.30 3 51905 AEV_3_3_RA3_01_1233.d 0 1 1 942 969 Carboxyethyl; Carbamidomethylation
K.L(+27.99)AGTEPDEDHEAK.T Y 24.31 1438.6212 13 -30.3 720.2961 2 88.29 1 48329 AEV 2_3_RA2_01_1224.d 4.08E4 1 1 752 764 Formylation
K.TNPDDLTPEEINR(+14.02).F Y 23.76 1526.7212 13 -3.1 764.3655 2 66.36 3 37359 AEV_3_3_RA3_01_1233.d 1.48E5 2 2 599 611 Methylation(KR)
K.IDGLF Y 23.59 563.2955 5 -111.8 564.2397 1 77.40 1 39772 AEV 2_3_RA2_01_1224.d 2.43E5 3 3 1034 1038
K.GGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIETR.M Y 23.34 4249.1226 42 27.1 850.8549 5 92.30 3 55949 AEV_3_3_RA3_01_1233.d 0 1 1 516 557
K.DVDGFGAVNIGELAK(-.98).R Y 22.97 1502.7728 15 -12.0 752.3846 2 82.06 3 49635 AEV_3_3_RA3_01_1233.d 1.23E5 1 1 219 233 Amidation
K.LQ(+.98)TPVPSDIAISR.A Y 22.74 1396.7561 13 -3.4 699.3829 2 72.87 2 35023 AEV_1_3_RA2_01_1232.d 0 1 1 406 418 Deamidation (NQ)
R.GITIGQ(+.98)AATER.G Y 22.64 1116.5775 11 -14.9 559.2877 2 58.02 2 24645 AEV_1_3_RA2_01_1232.d 0 1 1 637 647 Deamidation (NQ)
MPVPAATGFAC(+57.02)R.A Y 22.54 1276.6056 12 -0.6 426.5422 3 10.82 3 2912 AEV_3_3_RA3_01_1233.d 1.1E5 2 2 1 12 Carbamidomethylation
K.SAD(-18.01)ATVTVC(+57.02)HSK.T Y 22.33 1256.5819 12 -63.0 629.2587 2 63.57 1 29228 AEV 2_3_RA2_01_1224.d 1.55E5 1 1 283 294 Dehydration; Carbamidomethylation
M(+15.99)PVPAATGFAC(+57.02)R.A Y 21.85 1292.6006 12 -57.2 647.2706 2 81.04 1 42645 AEV 2_3_RA2_01_1224.d 5.89E4 1 1 1 12 Oxidation (M); Carbamidomethylation
R.GITIGQ(+.98)AAT(-18.01)ER.G Y 21.60 1098.5669 11 -48.0 367.1786 3 54.13 1 22641 AEV 2_3_RA2_01_1224.d 8.87E5 1 1 637 647 Deamidation (NQ); Dehydration
R.M(+42.01)VIATSK(+14.02).R Y 21.25 804.4415 7 -8.1 403.2248 2 33.85 2 12523 AEV_1_3_RA2_01_1232.d 6.36E4 1 1 683 689 Acetylation (N-term); Methylation(KR)
K.IDGT(+79.97)AIAKNIR.E Y 21.19 1250.6384 11 -2.9 417.8855 3 39.96 3 19392 AEV_3_3_RA3_01_1233.d 4.34E5 1 1 105 115 Phosphorylation (STY)
MPVPAATGF(+31.99)AC(+57.02)R.A Y 21.13 1308.5955 12 -35.2 655.2820 2 22.80 1 5664 AEV 2_3_RA2_01_1224.d 1.4E4 1 1 1 12 Dihydroxy; Carbamidomethylation
K.LLYDLEGTVQ(+.98)ERIER(+14.02).I Y 21.08 1847.9629 15 36.8 463.0150 4 77.31 3 45948 AEV_3_3_RA3_01_1233.d 5.05E5 1 1 917 931 Deamidation (NQ); Methylation(KR)
R.GHTRETGFDISVASEC(+57.02)MAILALSNDLADMR(+21.98)(+14.02).E Y 20.98 3315.5298 30 2.9 664.1152 5 93.08 1 51813 AEV 2_3_RA2_01_1224.d 6.6E5 1 1 648 677 Carbamidomethylation; Sodium adduct; Methylation(KR)
K.DFK(+42.01)LLYDLEGTVQER.I Y 20.90 1866.9363 15 -37.3 467.7239 4 57.77 3 30782 AEV_3_3_RA3_01_1233.d 3.97E4 1 1 914 928 Acetylation (K)
K.RGGKPLFVPC(+57.02)TPK.G Y 20.37 1455.8020 13 -0.2 364.9577 4 51.81 3 26916 AEV_3_3_RA3_01_1233.d 6.85E5 2 2 234 246 Carbamidomethylation
K.LGITKTNPDDLTPEEINR.F Y 20.22 2025.0378 18 6.0 676.0239 3 69.16 2 32220 AEV_1_3_RA2_01_1232.d 6.86E4 1 1 594 611
K.L(+42.01)AGTEPDEDHEAK.T Y 20.09 1452.6368 13 -30.7 727.3034 2 81.68 1 43148 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 752 764 Acetylation (N-term)
K.IDGT(+79.97)AIAK(+42.01).N Y 20.05 909.4208 8 96.4 304.1768 3 44.77 3 22409 AEV_3_3_RA3_01_1233.d 7.17E5 1 1 105 112 Phosphorylation (STY); Acetylation (K)
R.SDIVGSPVSYLLK(-2.02).S Y 20.04 1374.7394 13 -6.9 688.3723 2 82.07 2 42184 AEV_1_3_RA2_01_1232.d 0 1 1 270 282 2-amino-3-oxo-butanoic_acid
R.M(+15.99)FHESTQSDAALYKR.L Y 19.92 1798.8308 15 -82.6 600.5680 3 61.54 1 27636 AEV 2_3_RA2_01_1224.d 1.45E5 1 1 558 572 Oxidation (M)
R.HLTPLPLK.L Y 19.90 917.5698 8 -92.2 306.8357 3 72.62 1 35994 AEV 2_3_RA2_01_1224.d 3.38E4 1 1 398 405
K.VDTYTK.Q Y 19.75 725.3596 6 -145.3 726.2615 1 53.31 1 22131 AEV 2_3_RA2_01_1224.d 8.48E4 2 2 952 957
K.LAGTEPDE(+21.98)DHEAK.T Y 19.69 1432.6082 13 67.1 359.1833 4 66.98 1 31623 AEV 2_3_RA2_01_1224.d 0 1 1 752 764 Sodium adduct
R.L(+42.01)NAEIQK(+43.01)SQQTNPR.F Y 19.64 1710.8649 14 26.7 428.7349 4 42.63 3 21051 AEV_3_3_RA3_01_1233.d 0 1 1 118 131 Acetylation (N-term); Carbamylation
K.SADATVT(+79.97)VC(+57.02)HSK(+42.01).T Y 19.48 1396.5693 12 -25.1 699.2744 2 66.97 1 31617 AEV 2_3_RA2_01_1224.d 0 1 1 283 294 Phosphorylation (STY); Carbamidomethylation; Acetylation (K)
R.VLDVNDR(-.98).H Y 19.19 828.4454 7 29.5 415.2422 2 52.85 2 21907 AEV_1_3_RA2_01_1232.d 1.11E5 2 2 627 633 Amidation
K.R(+14.02)GGK(+226.08)PLFVPC(+57.02)TPK.G Y 18.98 1695.8953 13 5.2 424.9833 4 68.34 2 31613 AEV_1_3_RA2_01_1232.d 6.3E4 1 1 234 246 Methylation(KR); Biotinylation; Carbamidomethylation
R.ERLN(+.98)AEIQKSQQTNPR(+14.02).F Y 18.76 1925.9918 16 -5.6 386.2035 5 36.39 2 13723 AEV_1_3_RA2_01_1232.d 3.42E4 1 1 116 131 Deamidation (NQ); Methylation(KR)
K.I(+71.04)DGLF Y 18.64 634.3326 5 12.9 635.3480 1 34.89 3 16270 AEV_3_3_RA3_01_1233.d 5.05E4 1 1 1034 1038 Propionamide (K, X@N-term)
R.G(+42.01)ITIGQAATERGHTR.E Y 18.62 1608.8333 15 5.0 403.2176 4 56.07 2 23583 AEV_1_3_RA2_01_1232.d 0 1 1 637 651 Acetylation (N-term)
R.GHTRETGFDISVASEC(+57.02)MAILALSNDLAD(+21.98)MR(+14.02).E Y 18.59 3315.5298 30 -0.3 664.1130 5 93.95 1 52447 AEV 2_3_RA2_01_1224.d 1.32E6 1 1 648 677 Carbamidomethylation; Sodium adduct; Methylation(KR)
R.FKPS(+79.97)LVIFQIGDR(+14.02).S Y 18.59 1612.8378 13 14.3 404.2225 4 58.42 3 31241 AEV_3_3_RA3_01_1233.d 2.24E5 1 1 132 144 Phosphorylation (STY); Methylation(KR)
K.S(+42.01)ADATVTVC(+57.02)HSK(+42.01).T Y 18.37 1358.6136 12 18.8 680.3269 2 79.36 2 40050 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 283 294 Acetylation (N-term); Carbamidomethylation; Acetylation (K)
R.QPSQ(+.98)GPTFGIK.G Y 18.24 1159.5873 11 23.7 387.5455 3 11.28 2 2945 AEV_1_3_RA2_01_1232.d 4.42E4 1 1 505 515 Deamidation (NQ)
R.FFNIK.C Y 18.23 667.3693 5 -99.1 334.6589 2 72.43 1 35871 AEV 2_3_RA2_01_1224.d 1.74E5 1 1 783 787
R.AIKVHGGGPPIAPGSPLAEEYR.T Y 18.07 2215.1748 22 -25.7 554.7867 4 52.92 2 21938 AEV_1_3_RA2_01_1232.d 0 1 1 806 827
K.TN(+.98)PDDLTPEEINRFAR.L Y 17.91 1887.8962 16 12.0 630.3136 3 71.77 3 41621 AEV_3_3_RA3_01_1233.d 0 1 1 599 614 Deamidation (NQ)
R.GITIGQ(+.98)AAT(+79.97)ER.G Y 17.85 1196.5438 11 -104.3 399.8136 3 51.08 1 20816 AEV 2_3_RA2_01_1224.d 6.73E4 2 2 637 647 Deamidation (NQ); Phosphorylation (STY)
R.MVIATS(+79.97)K.R Y 17.60 828.3817 7 -63.2 829.3366 1 100.00 1 55694 AEV 2_3_RA2_01_1224.d 4.01E4 1 1 683 689 Phosphorylation (STY)
K.VSGIELAGK(+28.03).N Y 17.48 900.5280 9 -2.0 301.1827 3 31.19 3 14078 AEV_3_3_RA3_01_1233.d 0 1 1 254 262 Dimethylation(KR)
R.H(+156.12)LRGITIGQAATER.G Y 17.46 1677.9526 14 -43.6 560.3004 3 55.29 2 23160 AEV_1_3_RA2_01_1232.d 3.88E4 1 1 634 647 4-hydroxynonenal (HNE)
R.LGR(+14.02)M(+15.99)VIATSK(+42.01)R.G Y 17.42 1302.7441 11 15.8 326.6985 4 22.73 2 7536 AEV_1_3_RA2_01_1232.d 0 1 1 680 690 Methylation(KR); Oxidation (M); Acetylation (K)
K.S(+79.97)AD(+43.99)ATVTVC(+57.02)HSK.T Y 17.34 1398.5487 12 55.1 467.2159 3 77.48 1 39841 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 283 294 Phosphorylation (STY); Carboxylation (DKW); Carbamidomethylation
K.I(+42.01)DGTAIAK.N Y 17.04 829.4545 8 7.1 830.4677 1 83.73 3 50828 AEV_3_3_RA3_01_1233.d 0 1 1 105 112 Acetylation (N-term)
K.GVIIASS(+79.97)KPK(+14.02).D Y 16.70 1092.5944 10 29.2 365.2160 3 28.71 2 10130 AEV_1_3_RA2_01_1232.d 1.86E4 1 1 904 913 Phosphorylation (STY); Methylation(KR)
K.K(+42.01)VDTYTKQGFGNLPICIAK.T Y 16.52 2137.1240 19 1.6 535.2891 4 83.96 2 43588 AEV_1_3_RA2_01_1232.d 1.02E5 1 1 951 969 Acetylation (N-term)
K.SQQTNPR.F Y 16.50 829.4042 7 42.0 830.4464 1 106.04 1 57614 AEV 2_3_RA2_01_1224.d 0 1 1 125 131
R.GGK(+14.02)PLFVPCTPK.G Y 16.47 1256.6951 12 -27.7 419.8940 3 40.80 3 19881 AEV_3_3_RA3_01_1233.d 0 1 1 235 246 Methylation(KR)
R.IAFAN(+.98)VR(+14.02).Q Y 16.18 804.4493 7 -68.5 403.2044 2 66.24 1 31054 AEV 2_3_RA2_01_1224.d 6.41E3 1 1 498 504 Deamidation (NQ); Methylation(KR)
K.DFKLLYDLEGTVQER(+28.03).I Y 16.16 1852.9570 15 1.0 927.4867 2 112.11 3 62563 AEV_3_3_RA3_01_1233.d 2.5E4 1 1 914 928 Dimethylation(KR)
R.LNAEIQK(+345.05).S Y 16.04 1159.5023 7 -46.0 580.7318 2 43.45 1 16397 AEV 2_3_RA2_01_1224.d 8.57E4 1 1 118 124 Phospho-guanosine
R.FARLDIDPETITWR.R Y 16.03 1731.8944 14 -1.0 578.3048 3 80.45 3 48422 AEV_3_3_RA3_01_1233.d 1.98E5 1 1 612 625
K.T(+42.01)QYSLSHDPNLK.G Y 15.81 1443.6993 12 -3.1 722.8547 2 75.37 2 36894 AEV_1_3_RA2_01_1232.d 4.45E4 1 1 970 981 Acetylation (N-term)
K.TKDLENIIK.Q Y 15.70 1072.6128 9 -0.4 358.5447 3 54.50 3 28685 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 295 303
R.AHPLHFPPIP(+31.99)R.H Y 15.70 1312.7040 11 -4.6 329.1818 4 39.77 3 19269 AEV_3_3_RA3_01_1233.d 0 1 1 13 23 Dihydroxy
K.VTLDLLD(-18.01)RLSHR.R Y 15.67 1418.7993 12 -10.5 355.7034 4 50.55 3 26070 AEV_3_3_RA3_01_1233.d 2.47E6 1 1 449 460 Dehydration
MPVPAATGFAC(+57.02)R(+28.03).A Y 15.63 1304.6370 12 -50.6 653.2927 2 84.08 1 45053 AEV 2_3_RA2_01_1224.d 0 1 1 1 12 Carbamidomethylation; Dimethylation(KR)
R.MVIATSK(+43.99).R Y 15.62 792.4052 7 -6.7 793.4071 1 75.95 3 44877 AEV_3_3_RA3_01_1233.d 5.9E4 1 1 683 689 Carboxylation (DKW)
K.Q(+42.01)YGIPVIVAIN(+.98)K.F Y 15.47 1356.7653 12 -6.7 453.2593 3 63.00 2 27878 AEV_1_3_RA2_01_1232.d 0 1 1 850 861 Acetylation (N-term); Deamidation (NQ)
K.VS(+79.96)GIELAGK.N Y 15.19 952.4535 9 3.8 477.2358 2 60.88 3 33089 AEV_3_3_RA3_01_1233.d 0 1 1 254 262 Sulfation
K.SADATVTVC(+57.02)HSK(+21.98).T Y 15.19 1296.5745 12 -3.3 325.1498 4 37.16 1 12801 AEV 2_3_RA2_01_1224.d 0 1 1 283 294 Carbamidomethylation; Sodium adduct
K.GVMELLKVSGIELAGKNAVVLGR.S Y 15.11 2352.3562 23 2.3 471.4796 5 78.40 2 39287 AEV_1_3_RA2_01_1232.d 0 1 1 247 269
R.LNAEIQ(+.98)KSQQT(+79.97)NPR.F Y 15.09 1706.7988 14 8.8 569.9453 3 64.45 2 28866 AEV_1_3_RA2_01_1232.d 1.63E4 1 1 118 131 Deamidation (NQ); Phosphorylation (STY)
R.MVIATSK.R Y 15.01 748.4153 7 -166.1 749.2982 1 109.48 1 58613 AEV 2_3_RA2_01_1224.d 3.88E5 1 1 683 689
total 124 peptides
C1G2V1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.NIAAHVSPAFRVEEGDQVTVGQC(+57.02)RPLSK.T Y 141.18 3064.5513 28 2.1 767.1467 4 69.86 2 32763 AEV_1_3_RA2_01_1232.d 2.66E6 7 7 111 138 Carbamidomethylation
R.AFQKQPHIFLNSK.Q Y 128.00 1556.8463 13 2.8 519.9575 3 60.17 2 26022 AEV_1_3_RA2_01_1232.d 7.91E6 13 13 12 24
K.TAIEGSYIDKKC(+57.02)PFTGQVSIR.G Y 118.62 2369.2048 21 -2.1 593.3073 4 69.54 3 39881 AEV_3_3_RA3_01_1233.d 1.33E6 4 4 52 72 Carbamidomethylation
R.VEEGDQVTVGQC(+57.02)RPLSK.T Y 118.41 1900.9313 17 4.1 634.6536 3 56.12 2 23653 AEV_1_3_RA2_01_1232.d 4.26E6 13 13 122 138 Carbamidomethylation
K.NIAAHVSPAFR(+14.02)VEEGDQVTVGQC(+57.02)RPLSK.T Y 109.12 3078.5669 28 -0.9 770.6483 4 71.01 3 41019 AEV_3_3_RA3_01_1233.d 9.28E5 2 2 111 138 Methylation(KR); Carbamidomethylation
K.C(+57.02)PFTGQVSIR.G Y 101.44 1163.5757 10 4.9 582.7980 2 64.67 2 29025 AEV_1_3_RA2_01_1232.d 3.09E6 6 6 63 72 Carbamidomethylation
K.TAIEGSYIDKK.C Y 99.70 1223.6398 11 2.7 612.8288 2 41.16 2 16089 AEV_1_3_RA2_01_1232.d 1.64E7 19 19 52 62
R.WYKDVGLGFRTPK.T Y 98.97 1565.8354 13 6.7 522.9559 3 68.37 2 31632 AEV_1_3_RA2_01_1232.d 1.75E6 7 7 39 51
R.WYKDVGLGFR.T Y 98.77 1239.6400 10 2.0 414.2214 3 71.27 2 33833 AEV_1_3_RA2_01_1232.d 5.8E6 9 9 39 48
K.NIAAHVSPAFR.V Y 97.96 1181.6305 11 -3.3 591.8206 2 59.09 2 25287 AEV_1_3_RA2_01_1232.d 3.43E6 8 8 111 121
R.HKNIAAHVSPAFR.V Y 97.47 1446.7844 13 2.4 483.2699 3 39.98 3 19385 AEV_3_3_RA3_01_1233.d 1.24E6 10 10 109 121
R.GRILTGTVVSTK.M Y 91.30 1230.7296 12 -28.5 411.2388 3 51.18 3 26547 AEV_3_3_RA3_01_1233.d 5.21E5 3 3 73 84
R.EYLHYIPK.Y Y 90.43 1061.5546 8 1.1 531.7852 2 60.54 2 26252 AEV_1_3_RA2_01_1232.d 4.89E6 12 12 94 101
K.Q(-17.03)PHIFLNSK.Q Y 81.80 1065.5607 9 -2.9 533.7861 2 67.67 3 38392 AEV_3_3_RA3_01_1233.d 2.72E6 7 7 16 24 Pyro-glu from Q
R.VEEGDQVTVGQ(+.98)C(+57.02)RPLSK.T Y 80.05 1901.9153 17 4.2 634.9817 3 56.78 3 30056 AEV_3_3_RA3_01_1233.d 6.48E5 4 4 122 138 Deamidation (NQ); Carbamidomethylation
K.TAIEGSYIDK.K Y 78.40 1095.5448 10 -0.4 548.7795 2 52.60 3 27453 AEV_3_3_RA3_01_1233.d 1.38E6 9 9 52 61
R.AFQKQPHIFLNSK(+14.02).Q Y 75.54 1570.8619 13 -1.0 524.6274 3 59.77 3 32242 AEV_3_3_RA3_01_1233.d 9.25E5 3 3 12 24 Methylation(KR)
R.ILTGTVVSTK.M Y 75.52 1017.6070 10 -1.7 509.8099 2 54.02 3 28394 AEV_3_3_RA3_01_1233.d 6.2E6 9 9 75 84
R.VEEGDQVTVGQC(+57.02)R(+.98)PLSK.T Y 75.34 1901.9153 17 9.2 634.9849 3 58.68 3 31427 AEV_3_3_RA3_01_1233.d 2.86E5 2 2 122 138 Carbamidomethylation; Deamidation (R)
K.KC(+57.02)PFTGQVSIR.G Y 73.93 1291.6707 11 0.0 431.5641 3 58.95 2 25224 AEV_1_3_RA2_01_1232.d 7.41E5 4 4 62 72 Carbamidomethylation
R.AFQKQPHIFLNS(+79.96)K.Q Y 72.42 1636.8031 13 45.2 410.2266 4 57.99 3 30943 AEV_3_3_RA3_01_1233.d 0 1 1 12 24 Sulfation
K.TAIE(+14.02)GSYIDKK.C Y 70.36 1237.6554 11 -0.8 619.8345 2 48.19 3 24614 AEV_3_3_RA3_01_1233.d 1.67E6 5 5 52 62 Methylation(others)
R.VE(+14.02)EGDQVTVGQC(+57.02)RPLSK.T Y 70.30 1914.9469 17 -0.7 639.3224 3 57.96 3 30919 AEV_3_3_RA3_01_1233.d 5.95E5 2 2 122 138 Methylation(others); Carbamidomethylation
K.NIAAHVSPAFRVEEGDQVTVGQ(+.98)C(+57.02)RPLSK.T Y 69.94 3065.5352 28 -3.9 767.3881 4 69.70 3 40004 AEV_3_3_RA3_01_1233.d 0 1 1 111 138 Deamidation (NQ); Carbamidomethylation
R.VEE(+14.02)GDQVTVGQC(+57.02)RPLSK.T Y 68.94 1914.9469 17 -0.8 639.3224 3 59.96 3 32390 AEV_3_3_RA3_01_1233.d 4.92E5 2 2 122 138 Methylation(others); Carbamidomethylation
R.VEEGDQVTVGQC(+57.02)RPLSK(+14.02).T Y 68.02 1914.9469 17 -0.7 639.3224 3 57.31 3 30437 AEV_3_3_RA3_01_1233.d 1.63E5 1 1 122 138 Carbamidomethylation; Methylation(KR)
K.C(+57.02)PFTGQVSIRGR.I Y 67.06 1376.6982 12 -0.6 459.9064 3 57.58 3 30641 AEV_3_3_RA3_01_1233.d 3.69E5 1 1 63 74 Carbamidomethylation
K.Q(-17.03)PHIFLN(+.98)SK.Q Y 61.51 1066.5447 9 5.8 534.2827 2 70.73 2 33459 AEV_1_3_RA2_01_1232.d 4.38E5 3 3 16 24 Pyro-glu from Q; Deamidation (NQ)
R.AFQKQPHIFLN(+.98)SK.Q Y 60.14 1557.8303 13 2.0 390.4656 4 61.73 2 27012 AEV_1_3_RA2_01_1232.d 1.27E6 4 4 12 24 Deamidation (NQ)
K.C(+57.02)PFTGQVSIR(+14.02).G Y 59.76 1177.5913 10 2.8 589.8046 2 68.55 3 39105 AEV_3_3_RA3_01_1233.d 5.76E5 3 3 63 72 Carbamidomethylation; Methylation(KR)
R.VEEGDQVTVGQC(+57.02)R(+14.02)PLSK.T Y 59.54 1914.9469 17 2.9 639.3248 3 58.55 2 24996 AEV_1_3_RA2_01_1232.d 0 1 1 122 138 Carbamidomethylation; Methylation(KR)
R.WYKDVGLGFR(+14.02).T Y 59.24 1253.6556 10 2.3 418.8934 3 73.17 3 42718 AEV_3_3_RA3_01_1233.d 4.79E5 3 3 39 48 Methylation(KR)
K.GVKQFGKF Y 59.04 909.5072 8 2.3 455.7619 2 48.23 2 19596 AEV_1_3_RA2_01_1232.d 5.1E5 3 3 154 161
K.C(+58.01)PFTGQVSIR.G Y 58.74 1164.5597 10 5.3 583.2902 2 69.20 2 32301 AEV_1_3_RA2_01_1232.d 3.11E6 5 5 63 72 Carboxymethyl
K.Q(-17.03)PHIFLNSK(+14.02).Q Y 58.71 1079.5763 9 0.0 540.7954 2 68.96 3 39423 AEV_3_3_RA3_01_1233.d 9.64E4 1 1 16 24 Pyro-glu from Q; Methylation(KR)
K.TAIEGSYIDKK(+14.02).C Y 57.63 1237.6554 11 2.3 619.8364 2 49.23 2 20060 AEV_1_3_RA2_01_1232.d 4.91E5 3 3 52 62 Methylation(KR)
R.AFQ(+.98)KQPHIFLNSK.Q Y 57.23 1557.8303 13 -3.2 520.2824 3 60.25 3 32598 AEV_3_3_RA3_01_1233.d 9.66E5 2 2 12 24 Deamidation (NQ)
K.QPHIFLNSK.Q Y 56.45 1082.5873 9 -0.7 542.3005 2 49.22 3 25226 AEV_3_3_RA3_01_1233.d 1.38E6 8 8 16 24
M.A(+42.01)TELTVQSERAFQKQPHIFLNSK.Q Y 54.45 2713.4187 23 2.5 679.3636 4 77.86 2 38857 AEV_1_3_RA2_01_1232.d 4.41E5 2 2 2 24 Acetylation (Protein N-term)
R.TGKGVKQFGKF Y 52.31 1195.6713 11 -7.2 598.8386 2 36.68 3 17378 AEV_3_3_RA3_01_1233.d 6.91E5 4 4 151 161
M.A(+42.01)TELTVQSER.A Y 51.98 1174.5830 10 -2.3 588.2974 2 64.62 3 35976 AEV_3_3_RA3_01_1233.d 4.39E6 10 10 2 11 Acetylation (Protein N-term)
K.TVRFNVLR.V Y 51.94 1003.5927 8 3.6 335.5394 3 61.44 2 26840 AEV_1_3_RA2_01_1232.d 2.09E6 7 7 139 146
K.DVGLGFR.T Y 51.87 762.4024 7 -1.6 382.2079 2 63.92 3 35474 AEV_3_3_RA3_01_1233.d 2.34E6 5 5 42 48
K.NIAAHVSPAFR(+14.02).V Y 51.42 1195.6461 11 13.9 399.5615 3 61.64 3 33689 AEV_3_3_RA3_01_1233.d 0 2 2 111 121 Methylation(KR)
K.TAIEGSYIDK(+14.02).K Y 50.99 1109.5604 10 1.3 555.7882 2 60.91 2 26470 AEV_1_3_RA2_01_1232.d 8.36E4 1 1 52 61 Methylation(KR)
R.VEEGD(+14.02)QVTVGQC(+57.02)RPLSK.T Y 48.84 1914.9469 17 8.7 639.3285 3 60.09 2 25990 AEV_1_3_RA2_01_1232.d 2.27E5 1 1 122 138 Methylation(others); Carbamidomethylation
M.A(+42.01)TELTVQSER(+14.02).A Y 47.42 1188.5986 10 -2.3 595.3052 2 69.58 3 39986 AEV_3_3_RA3_01_1233.d 2.36E6 8 8 2 11 Acetylation (Protein N-term); Methylation(KR)
K.TAIEGSYIDK(+14.02)K.C Y 47.35 1237.6554 11 2.9 413.5603 3 48.28 2 19578 AEV_1_3_RA2_01_1232.d 3.61E5 3 3 52 62 Methylation(KR)
R.WY(-2.02)KDVGLGFRTPK.T Y 46.84 1563.8197 13 -14.2 522.2731 3 67.31 3 38099 AEV_3_3_RA3_01_1233.d 9.97E4 1 1 39 51 2-amino-3-oxo-butanoic_acid
R.TPK(+143.06)TAIEGSYIDKK.C Y 46.15 1692.8933 14 8.6 424.2342 4 41.47 2 16189 AEV_1_3_RA2_01_1232.d 5.03E3 1 1 49 62 Nethylmaleimidehydrolysis
R.RWYKDVGLGFR.T Y 44.22 1395.7411 11 -2.4 349.9417 4 67.00 3 37872 AEV_3_3_RA3_01_1233.d 3.49E5 3 3 38 48
K.Q(+.98)FGKF Y 42.00 626.3064 5 -0.2 627.3135 1 49.26 3 25252 AEV_3_3_RA3_01_1233.d 1.81E5 2 2 157 161 Deamidation (NQ)
K.TAIE(+14.02)GSYIDKKC(+57.02)PFTGQVSIR.G Y 41.82 2383.2205 21 2.3 596.8138 4 71.50 3 41408 AEV_3_3_RA3_01_1233.d 3.48E5 2 2 52 72 Methylation(others); Carbamidomethylation
R.REYLHYIPK.Y Y 41.61 1217.6556 9 5.5 305.4229 4 55.83 2 23442 AEV_1_3_RA2_01_1232.d 4.06E5 3 3 93 101
K.N(+.98)IAAHVSPAFR.V Y 40.65 1182.6145 11 -3.1 592.3127 2 59.45 2 25529 AEV_1_3_RA2_01_1232.d 0 2 2 111 121 Deamidation (NQ)
R.E(+14.02)YLHYIPK.Y Y 40.65 1075.5702 8 3.2 538.7941 2 61.45 2 26829 AEV_1_3_RA2_01_1232.d 2.26E5 2 2 94 101 Methylation(others)
R.FNVLR.V N 40.27 647.3755 5 4.3 324.6964 2 52.04 2 21528 AEV_1_3_RA2_01_1232.d 1.22E7 12 12 142 146
K.TVRFNVLR(+14.02).V Y 40.18 1017.6083 8 -3.0 340.2090 3 63.39 3 35038 AEV_3_3_RA3_01_1233.d 1.87E5 2 2 139 146 Methylation(KR)
R.ILTGTVVSTK(+14.02).M Y 39.19 1031.6227 10 2.0 516.8196 2 61.62 2 26925 AEV_1_3_RA2_01_1232.d 3.01E5 2 2 75 84 Methylation(KR)
R.GRILTGTVVSTK(+42.01)MHR.T Y 38.65 1696.9407 15 -19.3 425.2343 4 55.45 2 23238 AEV_1_3_RA2_01_1232.d 0 1 1 73 87 Acetylation (K)
R.AFQ(+.98)KQPHIFLN(+.98)SK.Q Y 37.60 1558.8143 13 11.3 390.7153 4 60.34 3 32671 AEV_3_3_RA3_01_1233.d 4.06E5 1 1 12 24 Deamidation (NQ)
K.C(+58.01)PFTGQVSIRGR.I Y 36.41 1377.6823 12 27.9 460.2475 3 62.24 3 34149 AEV_3_3_RA3_01_1233.d 0 1 1 63 74 Carboxymethyl
K.TAIEGSYID(+14.02)KK.C Y 36.15 1237.6554 11 -0.4 413.5589 3 45.80 3 23062 AEV_3_3_RA3_01_1233.d 3.06E5 1 1 52 62 Methylation(others)
K.DVGLGFR(+14.02).T Y 35.69 776.4180 7 -3.9 389.2148 2 69.92 3 40165 AEV_3_3_RA3_01_1233.d 1.05E5 1 1 42 48 Methylation(KR)
R.FNVLRVLPR.T Y 34.84 1112.6818 9 4.1 371.9027 3 73.77 3 43172 AEV_3_3_RA3_01_1233.d 4.21E4 1 1 142 150
K.Q(-17.03)FGKF Y 34.52 608.2958 5 -91.3 609.2476 1 79.36 1 41331 AEV 2_3_RA2_01_1224.d 1.56E6 1 1 157 161 Pyro-glu from Q
R.EY(-18.01)LHYIPK.Y Y 34.30 1043.5439 8 3.4 522.7810 2 70.65 2 33332 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 94 101 Dehydration
K.N(+42.01)IAAHVSPAFR.V Y 32.85 1223.6411 11 -104.1 408.8452 3 69.04 1 33213 AEV 2_3_RA2_01_1224.d 1.38E5 2 2 111 121 Acetylation (N-term)
M.A(+42.01)TELTVQ(+.98)SER.A Y 32.49 1175.5670 10 -1.9 588.7897 2 66.57 3 37520 AEV_3_3_RA3_01_1233.d 4.81E5 2 2 2 11 Acetylation (Protein N-term); Deamidation (NQ)
R.AFQ(+.98)KQ(+.98)PHIFLNSK.Q Y 31.89 1558.8143 13 26.1 390.7210 4 60.22 2 26027 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 12 24 Deamidation (NQ)
R.GRILTGTVVSTK(+42.01)MHR(-.98).T Y 31.36 1695.9567 15 5.4 424.9987 4 55.45 2 23239 AEV_1_3_RA2_01_1232.d 1.22E5 1 1 73 87 Acetylation (K); Amidation
M.A(+42.01)TELTVQSERAFQK.Q Y 30.97 1648.8420 14 -1.0 825.4275 2 72.37 3 42082 AEV_3_3_RA3_01_1233.d 3.76E4 1 1 2 15 Acetylation (Protein N-term)
K.C(+57.02)PFTGQ(+.98)VSIR.G Y 30.38 1164.5597 10 27.8 583.3033 2 66.30 2 30166 AEV_1_3_RA2_01_1232.d 4.3E5 3 3 63 72 Carbamidomethylation; Deamidation (NQ)
R.RWYKDVGLGFRTPK.T Y 30.31 1721.9365 14 12.4 345.3989 5 65.09 3 36344 AEV_3_3_RA3_01_1233.d 9.61E4 1 1 38 51
K.N(+.98)IAAHVSPAFRVEEGDQ(+.98)VTVGQC(+57.02)RPLSK.T Y 29.55 3066.5193 28 15.4 614.3206 5 69.97 2 32826 AEV_1_3_RA2_01_1232.d 6.39E4 1 1 111 138 Deamidation (NQ); Carbamidomethylation
K.NIAAHVSPAFRVEEGDQVTVGQC(+57.02)R(+14.02)PLSK.T Y 29.50 3078.5669 28 -8.3 770.6426 4 70.54 2 33253 AEV_1_3_RA2_01_1232.d 4.91E4 1 1 111 138 Carbamidomethylation; Methylation(KR)
K.DVGLGFRTPK.T Y 29.36 1088.5978 10 1.7 363.8738 3 61.69 3 33728 AEV_3_3_RA3_01_1233.d 4.94E5 3 3 42 51
K.QFGKF Y 28.35 625.3224 5 -0.4 626.3294 1 46.37 2 18615 AEV_1_3_RA2_01_1232.d 2.07E6 7 7 157 161
R.Y(+17.99)EKRHKNIAAHVSPAFR.V Y 27.95 2041.0769 17 -23.6 409.2130 5 59.18 2 25351 AEV_1_3_RA2_01_1232.d 0 1 1 105 121 Fluorination
K.TAIE(+14.02)GSYIDK.K Y 27.81 1109.5604 10 0.6 555.7878 2 60.52 3 32807 AEV_3_3_RA3_01_1233.d 2.92E5 2 2 52 61 Methylation(others)
R.VEEGDQ(+.98)VTVGQC(+57.02)RPLSK.T Y 27.73 1901.9153 17 9.1 634.9848 3 58.19 2 24752 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 122 138 Deamidation (NQ); Carbamidomethylation
K.RH(+15.99)K(+14.02)NIAAHVSPAFR.V Y 27.34 1632.8960 14 -29.9 409.2191 4 59.59 2 25614 AEV_1_3_RA2_01_1232.d 8.95E4 1 1 108 121 Oxidation (HW); Methylation(KR)
R.ILTGTVVSTKMHR.T Y 26.73 1441.8075 13 0.9 361.4595 4 56.90 2 24058 AEV_1_3_RA2_01_1232.d 7.24E4 1 1 75 87
R.FN(+.98)VLR.V N 26.45 648.3595 5 10.9 325.1906 2 55.47 3 29217 AEV_3_3_RA3_01_1233.d 9.71E4 1 1 142 146 Deamidation (NQ)
R.TIIIR.R N 26.10 614.4115 5 -88.7 308.1858 2 59.38 1 26042 AEV 2_3_RA2_01_1224.d 5.95E5 3 3 88 92
R.EYLHYIPKYSR(+37.96).Y Y 25.34 1505.7069 11 5.7 753.8650 2 86.53 2 45364 AEV_1_3_RA2_01_1232.d 5.14E5 2 2 94 104 Replacement of proton by potassium
R.FNVLR(+14.02).V N 24.96 661.3911 5 5.3 331.7046 2 61.45 2 26824 AEV_1_3_RA2_01_1232.d 2.05E5 1 1 142 146 Methylation(KR)
K.TAIE(+43.99)GSYIDKK.C Y 24.51 1267.6295 11 -49.8 423.5294 3 56.59 1 24176 AEV 2_3_RA2_01_1224.d 7.39E5 1 1 52 62 Carboxylation (E)
K.QPHIFLNS(+162.05)K.Q Y 24.31 1244.6400 9 -22.0 623.3136 2 25.76 3 11003 AEV_3_3_RA3_01_1233.d 1.72E4 1 1 16 24 Hexose (NSY)
R.WYKD(+14.02)VGLGFR.T Y 23.94 1253.6556 10 13.1 418.8979 3 73.61 2 35578 AEV_1_3_RA2_01_1232.d 2.22E5 2 2 39 48 Methylation(others)
K.D(-18.01)VGLGFRTPK(+42.01)TAIEGSYIDK.K Y 23.53 2190.1321 20 -13.4 548.5330 4 55.18 2 23109 AEV_1_3_RA2_01_1232.d 6.38E5 1 1 42 61 Dehydration; Acetylation (K)
K.QPHIFLN(+.98)S(+79.97)K.Q Y 23.07 1163.5376 9 76.3 388.8828 3 58.14 3 31046 AEV_3_3_RA3_01_1233.d 0 1 1 16 24 Deamidation (NQ); Phosphorylation (STY)
R.GRILTGTVVST(-2.02)K.M Y 22.91 1228.7139 12 -3.3 410.5772 3 55.56 2 23293 AEV_1_3_RA2_01_1232.d 4.56E5 1 1 73 84 2-amino-3-oxo-butanoic_acid
K.KC(+57.02)PFTGQVS(+79.97)IR.G Y 22.57 1371.6370 11 60.7 343.9373 4 73.26 3 42793 AEV_3_3_RA3_01_1233.d 3.99E4 1 1 62 72 Carbamidomethylation; Phosphorylation (STY)
K.TAIEGSYIDK(+43.01)K(+14.02).C Y 22.55 1280.6611 11 -6.6 641.3336 2 39.41 3 19038 AEV_3_3_RA3_01_1233.d 3.38E4 1 1 52 62 Carbamylation; Methylation(KR)
R.TIIIRR.E Y 22.37 770.5126 6 -94.2 386.2273 2 54.86 1 23081 AEV 2_3_RA2_01_1224.d 3.07E6 4 4 88 93
K.NIAAHVSPAFRVEEGDQVTVGQC(+57.02)RPLSK(-.98)(+14.02).T Y 21.98 3077.5828 28 0.1 770.4031 4 69.42 3 39788 AEV_3_3_RA3_01_1233.d 0 1 1 111 138 Carbamidomethylation; Amidation; Methylation(KR)
R.AFQKQPHIFLNSKQK.S Y 21.62 1812.9999 15 -1.6 363.6067 5 48.53 3 24785 AEV_3_3_RA3_01_1233.d 2.28E5 2 2 12 26
K.QPHIFLNS(+79.97)K(+42.01)QK(+14.02).S Y 21.57 1474.7333 11 -4.2 738.3708 2 72.14 2 34459 AEV_1_3_RA2_01_1232.d 0 1 1 16 26 Phosphorylation (STY); Acetylation (K); Methylation(KR)
K.DVGLGFR(+44.03).T Y 21.14 806.4286 7 -114.6 807.3434 1 90.30 1 49849 AEV 2_3_RA2_01_1224.d 1.99E4 1 1 42 48 Ethanolation (KR)
K.Q(+.98)PHIFLNS(+79.96)K.Q Y 20.68 1163.5281 9 84.7 388.8828 3 60.82 2 26409 AEV_1_3_RA2_01_1232.d 0 1 1 16 24 Deamidation (NQ); Sulfation
K.RHK(+31.99)NIAAHVSPAFR.V Y 20.63 1634.8752 14 -119.8 409.6771 4 69.12 1 33275 AEV 2_3_RA2_01_1224.d 0 1 1 108 121 Dihydroxy
R.AF(+31.99)QKQPHIFLNSK.Q Y 20.46 1588.8362 13 1.0 398.2167 4 58.21 3 31097 AEV_3_3_RA3_01_1233.d 0 1 1 12 24 Dihydroxy
R.G(+27.99)RILTGTVVST(+79.97)K.M Y 19.99 1338.6908 12 28.5 335.6895 4 26.64 2 9219 AEV_1_3_RA2_01_1232.d 0 1 1 73 84 Formylation; Phosphorylation (STY)
R.AFQK(+14.02)Q(+.98)PHIFLN(+.98)SK.Q Y 19.84 1572.8300 13 7.3 394.2177 4 56.10 3 29599 AEV_3_3_RA3_01_1233.d 0 1 1 12 24 Methylation(KR); Deamidation (NQ)
K.GVKQFGK.F Y 19.78 762.4388 7 -183.9 763.3058 1 108.73 1 58401 AEV 2_3_RA2_01_1224.d 0 1 1 154 160
R.REYLHYIPKYSRYEK.R Y 19.61 2044.0530 15 -9.3 682.3519 3 79.63 3 47787 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 93 107
K.TAIE(+37.03)GSYIDKK.C Y 19.33 1260.6714 11 35.4 421.2459 3 41.77 2 16343 AEV_1_3_RA2_01_1232.d 8.41E4 1 1 52 62 Propargylamine
K.D(+42.01)VGLGFRT(+79.97)PK.T Y 19.31 1210.5747 10 -67.5 606.2538 2 73.29 1 36515 AEV 2_3_RA2_01_1224.d 1.07E5 1 1 42 51 Acetylation (N-term); Phosphorylation (STY)
K.Q(+43.01)PHIFLNSKQK.S Y 19.18 1381.7466 11 15.9 346.4494 4 41.60 3 20399 AEV_3_3_RA3_01_1233.d 2.65E5 1 1 16 26 Carbamylation
R.T(+79.97)PKTAIEGSYIDKK.C Y 19.06 1629.8015 14 9.6 408.4616 4 56.72 3 30014 AEV_3_3_RA3_01_1233.d 1.45E5 1 1 49 62 Phosphorylation (STY)
K.T(+42.01)AIEGSY(+79.97)IDK.K Y 19.00 1217.5217 10 -19.1 1218.5057 1 96.79 1 54257 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 52 61 Acetylation (N-term); Phosphorylation (STY)
R.EYLHYIPK(-.98).Y Y 18.76 1060.5706 8 -5.2 531.2898 2 59.64 3 32151 AEV_3_3_RA3_01_1233.d 3.81E4 1 1 94 101 Amidation
R.VEEGDQVT(-2.02)VGQC(+57.02)RPLSK.T Y 18.62 1898.9156 17 42.9 634.0063 3 57.86 2 24558 AEV_1_3_RA2_01_1232.d 2.02E5 1 1 122 138 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
K.T(+79.97)VR(+14.02)FNVLR.V Y 18.38 1097.5747 8 5.0 366.8673 3 49.90 3 25671 AEV_3_3_RA3_01_1233.d 9.4E4 1 1 139 146 Phosphorylation (STY); Methylation(KR)
R.VLPRTGK(+21.98).G Y 17.72 791.4630 7 -201.8 792.3105 1 110.02 1 58765 AEV 2_3_RA2_01_1224.d 7.11E4 1 1 147 153 Sodium adduct
K.T(+43.01)AIEGSYIDKK.C Y 17.43 1266.6455 11 -97.7 423.1812 3 56.99 1 24412 AEV 2_3_RA2_01_1224.d 1.41E5 1 1 52 62 Carbamylation
R.ILTGTVVS(+79.97)TK.M Y 17.33 1097.5734 10 13.8 549.8015 2 77.40 3 46017 AEV_3_3_RA3_01_1233.d 0 1 1 75 84 Phosphorylation (STY)
K.YSRYEKR.H Y 17.31 1000.5090 7 -12.6 501.2555 2 9.74 2 2392 AEV_1_3_RA2_01_1232.d 0 1 1 102 108
R.I(+42.01)LTGTVVS(+79.97)TKMHR.T Y 16.87 1563.7844 13 -1.1 522.2682 3 35.16 2 13144 AEV_1_3_RA2_01_1232.d 0 1 1 75 87 Acetylation (N-term); Phosphorylation (STY)
K.C(+105.06)PFTGQVSIR.G Y 16.65 1211.6121 10 -4.1 303.9091 4 25.16 3 10670 AEV_3_3_RA3_01_1233.d 2.8E5 1 1 63 72 S-pyridylethylation
K.DVGLGF(+31.99)R.T Y 16.64 794.3922 7 6.8 795.4049 1 67.66 3 38384 AEV_3_3_RA3_01_1233.d 2.02E4 1 1 42 48 Dihydroxy
R.EYLHY(+31.99)IPK.Y Y 16.42 1093.5443 8 2.0 547.7805 2 21.83 2 7148 AEV_1_3_RA2_01_1232.d 4.83E4 1 1 94 101 Dihydroxy
K.D(+356.19)VGLGFRTPK.T Y 16.16 1444.7860 10 51.3 362.2223 4 61.61 3 33670 AEV_3_3_RA3_01_1233.d 2.78E5 1 1 42 51 Biotin polyethyleneoxide amine
R.F(+42.01)NVLR.V N 15.86 689.3860 5 -19.7 345.6935 2 53.81 1 22431 AEV 2_3_RA2_01_1224.d 1.75E6 1 1 142 146 Acetylation (N-term)
K.C(+57.02)PFTGQVS(-18.01)IR(+14.02).G Y 15.15 1159.5808 10 -21.6 580.7852 2 63.87 3 35402 AEV_3_3_RA3_01_1233.d 0 1 1 63 72 Carbamidomethylation; Dehydration; Methylation(KR)
R.W(+44.99)YKDVGLGFR.T Y 15.02 1284.6251 10 76.3 429.2483 3 70.42 3 40561 AEV_3_3_RA3_01_1233.d 9.07E4 1 1 39 48 Oxidation to nitro
total 127 peptides
C1GG76
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.DITDGKDTQVLANQMESK.L Y 154.27 1991.9470 18 2.4 664.9912 3 67.87 2 31271 AEV_1_3_RA2_01_1232.d 2.97E6 11 11 137 154
R.IVTIIQNPTQYKIPTWFLNR.Q Y 138.64 2444.3579 20 6.3 612.1006 4 86.24 2 45131 AEV_1_3_RA2_01_1232.d 2.39E6 6 6 115 134
R.AGEITTEELERIVTIIQNPTQYK.I Y 115.57 2645.3911 23 -12.3 662.3469 4 89.06 2 46750 AEV_1_3_RA2_01_1232.d 5.6E5 3 3 104 126
R.QRDITDGKDTQVLANQMESK.L Y 114.66 2276.1067 20 -4.1 570.0316 4 61.29 3 33442 AEV_3_3_RA3_01_1233.d 4.1E5 3 3 135 154
R.DITDGKDTQVLANQM(+15.99)ESK.L Y 113.63 2007.9419 18 3.8 670.3238 3 60.42 2 26148 AEV_1_3_RA2_01_1232.d 6.93E5 4 4 137 154 Oxidation (M)
R.AGEITTEELERIVTIIQNPTQYKIPTWFLNR.Q Y 111.68 3672.9514 31 5.2 735.6014 5 93.61 3 56618 AEV_3_3_RA3_01_1233.d 1.06E6 7 7 104 134
R.IVTIIQNPTQYK.I Y 102.15 1416.7976 12 -23.7 709.3893 2 71.49 2 33960 AEV_1_3_RA2_01_1232.d 1.67E6 7 7 115 126
R.DITDGKDTQVLANQMESKLREDLER.L Y 101.26 2903.4294 25 0.0 726.8646 4 80.01 3 48073 AEV_3_3_RA3_01_1233.d 6.44E5 3 3 137 161
R.Q(-17.03)RDITDGKDTQVLANQMESK.L Y 95.46 2259.0801 20 -2.3 1130.5447 2 67.42 3 38190 AEV_3_3_RA3_01_1233.d 1.05E6 5 5 135 154 Pyro-glu from Q
R.IVTIIQNPTQYKIPTWFLNR(+14.02).Q Y 92.44 2458.3735 20 2.5 615.6022 4 86.16 3 52485 AEV_3_3_RA3_01_1233.d 2.28E5 3 3 115 134 Methylation(KR)
R.AGEITTEELER.I Y 88.72 1246.6041 11 3.3 624.3114 2 58.71 2 25076 AEV_1_3_RA2_01_1232.d 4.49E6 10 10 104 114
R.YSNLVC(+57.02)K.K Y 85.73 882.4269 7 12.6 442.2263 2 33.19 2 12266 AEV_1_3_RA2_01_1232.d 3.05E6 7 7 88 94 Carbamidomethylation
R.IVTIIQN(+.98)PTQYKIPTWFLNR.Q Y 85.18 2445.3420 20 3.1 612.3447 4 86.42 3 52651 AEV_3_3_RA3_01_1233.d 2.33E5 2 2 115 134 Deamidation (NQ)
R.YSNLVC(+57.02)KK.A Y 84.20 1010.5219 8 3.4 506.2700 2 21.91 2 7205 AEV_1_3_RA2_01_1232.d 4.36E5 3 3 88 95 Carbamidomethylation
K.DTQVLANQM(+15.99)ESK.L Y 83.44 1378.6399 12 0.3 690.3275 2 32.62 3 14942 AEV_3_3_RA3_01_1233.d 9.38E4 2 2 143 154 Oxidation (M)
R.Q(-17.03)RDITDGKDTQVLANQM(+15.99)ESK.L Y 79.75 2275.0750 20 0.3 759.3658 3 60.31 3 32660 AEV_3_3_RA3_01_1233.d 3.37E5 2 2 135 154 Pyro-glu from Q; Oxidation (M)
R.LLNTNVDGKQK.I Y 79.27 1228.6775 11 -9.7 615.3401 2 29.00 3 12834 AEV_3_3_RA3_01_1233.d 4.07E6 14 14 63 73
K.TNFQFILR.L Y 77.12 1037.5658 8 0.9 519.7906 2 77.62 2 38684 AEV_1_3_RA2_01_1232.d 1.77E6 6 6 55 62
K.DTQVLANQMESK.L Y 75.63 1362.6449 12 5.7 682.3336 2 55.70 3 29352 AEV_3_3_RA3_01_1233.d 2.48E5 5 5 143 154
K.Q(-17.03)KIMYALTK.I Y 71.34 1077.5892 9 -4.2 539.7996 2 69.65 3 39966 AEV_3_3_RA3_01_1233.d 2.66E5 2 2 72 80 Pyro-glu from Q
R.Q(-17.03)RDITDGKDTQVLANQMESK(+14.02).L Y 70.59 2273.0957 20 -5.4 758.7018 3 69.97 3 40206 AEV_3_3_RA3_01_1233.d 2.42E5 2 2 135 154 Pyro-glu from Q; Methylation(KR)
K.IPTWFLNR.Q Y 70.02 1045.5709 8 4.7 349.5326 3 79.34 2 40035 AEV_1_3_RA2_01_1232.d 2.11E6 6 6 127 134
R.DITDGKDTQ(+.98)VLANQMESK.L Y 67.88 1992.9310 18 32.5 665.3392 3 69.09 2 32164 AEV_1_3_RA2_01_1232.d 0 2 2 137 154 Deamidation (NQ)
R.AGEITTEELER(+14.02).I Y 66.52 1260.6198 11 -3.2 631.3151 2 63.40 3 35073 AEV_3_3_RA3_01_1233.d 2.25E6 4 4 104 114 Methylation(KR)
R.LLNTNVDGK.Q Y 65.40 972.5240 9 1.0 487.2698 2 40.86 3 19911 AEV_3_3_RA3_01_1233.d 4.51E6 11 11 63 71
R.AGEITTEELER(+14.02)IVTIIQNPTQYK.I Y 63.02 2659.4067 23 1.2 665.8597 4 89.77 3 54588 AEV_3_3_RA3_01_1233.d 5.46E5 4 4 104 126 Methylation(KR)
K.TNFQFILR(+14.02).L Y 61.85 1051.5814 8 1.6 526.7988 2 80.13 2 40664 AEV_1_3_RA2_01_1232.d 2.9E5 3 3 55 62 Methylation(KR)
R.Q(-17.03)RDITDGKDTQ(+.98)VLANQMESK.L Y 57.99 2260.0642 20 -0.3 754.3618 3 68.53 3 39072 AEV_3_3_RA3_01_1233.d 3.74E4 2 2 135 154 Pyro-glu from Q; Deamidation (NQ)
R.AGEITTE(+14.02)ELER.I Y 52.68 1260.6198 11 0.6 631.3175 2 62.84 2 27786 AEV_1_3_RA2_01_1232.d 5.11E5 1 1 104 114 Methylation(others)
R.Q(-17.03)RDITDGKDTQVLANQ(+.98)MESK.L Y 52.13 2260.0642 20 3.1 754.3643 3 69.98 3 40212 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 135 154 Pyro-glu from Q; Deamidation (NQ)
R.LLN(+.98)TNVDGKQK.I Y 50.68 1229.6615 11 14.1 410.9002 3 29.14 3 12894 AEV_3_3_RA3_01_1233.d 2.21E5 1 1 63 73 Deamidation (NQ)
R.AGEITT(+14.02)EELER.I Y 50.63 1260.6198 11 -1.7 631.3161 2 62.12 3 34106 AEV_3_3_RA3_01_1233.d 9.47E5 1 1 104 114 Methylation(others)
R.AGEIT(-2.02)TEELERIVTIIQNPTQYK.I Y 50.49 2643.3755 23 0.3 882.1327 3 88.80 3 54051 AEV_3_3_RA3_01_1233.d 3.79E4 1 1 104 126 2-amino-3-oxo-butanoic_acid
R.IVTIIQNPTQYK(+14.02).I Y 50.13 1430.8134 12 -28.9 716.3933 2 74.12 3 43437 AEV_3_3_RA3_01_1233.d 0 2 2 115 126 Methylation(KR)
R.DITDGKDTQVLANQM(+15.99)ESK(+14.02).L Y 49.29 2021.9575 18 1.3 674.9940 3 62.41 3 34278 AEV_3_3_RA3_01_1233.d 8.14E4 2 2 137 154 Oxidation (M); Methylation(KR)
R.RYSNLVC(+57.02)K.K Y 48.74 1038.5281 8 -2.5 520.2700 2 28.63 3 12604 AEV_3_3_RA3_01_1233.d 7.67E5 6 6 87 94 Carbamidomethylation
K.KADVDLNKR.A Y 48.02 1057.5880 9 6.9 353.5391 3 14.87 2 4287 AEV_1_3_RA2_01_1232.d 1.41E6 5 5 95 103
R.AGEITTEELER(+28.03).I Y 48.00 1274.6354 11 -0.6 638.3246 2 67.41 3 38247 AEV_3_3_RA3_01_1233.d 8.99E5 5 5 104 114 Dimethylation(KR)
R.AGEITTEELER(+.98).I Y 47.53 1247.5881 11 12.7 624.8093 2 58.03 3 30975 AEV_3_3_RA3_01_1233.d 2.56E5 1 1 104 114 Deamidation (R)
R.DIT(-2.02)DGKDTQVLANQMESK.L Y 47.50 1989.9313 18 -3.7 664.3152 3 67.43 3 38195 AEV_3_3_RA3_01_1233.d 6.9E4 2 2 137 154 2-amino-3-oxo-butanoic_acid
R.DITDGKDTQVLANQMESK(+14.02).L Y 46.70 2005.9626 18 -24.5 669.6451 3 70.59 3 40687 AEV_3_3_RA3_01_1233.d 0 1 1 137 154 Methylation(KR)
R.AGE(+14.02)ITTEELERIVTIIQNPTQYK.I Y 46.20 2659.4067 23 -2.0 665.8576 4 89.63 2 47048 AEV_1_3_RA2_01_1232.d 1.09E5 2 2 104 126 Methylation(others)
R.LLNTNVDGKQK(+14.02).I Y 45.71 1242.6932 11 -17.7 622.3429 2 36.08 3 16996 AEV_3_3_RA3_01_1233.d 1.77E5 2 2 63 73 Methylation(KR)
R.HYWGLR.V Y 45.50 830.4188 6 -0.2 416.2166 2 50.34 3 25939 AEV_3_3_RA3_01_1233.d 1.2E6 7 7 173 178
K.R(+14.02)AGEITTEELER.I Y 44.71 1416.7208 12 6.4 473.2506 3 54.43 3 28633 AEV_3_3_RA3_01_1233.d 0 1 1 103 114 Methylation(KR)
R.IVTIIQNPTQ(+.98)YK.I Y 44.21 1417.7816 12 -50.8 709.8621 2 72.29 2 34572 AEV_1_3_RA2_01_1232.d 0 1 1 115 126 Deamidation (NQ)
R.IVTIIQ(+.98)NPTQYK.I Y 44.11 1417.7816 12 -37.0 709.8718 2 72.75 2 34986 AEV_1_3_RA2_01_1232.d 0 2 2 115 126 Deamidation (NQ)
K.ADVDLNKR.A Y 43.13 929.4930 8 2.1 465.7548 2 18.92 3 7249 AEV_3_3_RA3_01_1233.d 9.58E5 5 5 96 103
R.RYSNLVC(+57.02)KK.A Y 42.78 1166.6230 9 0.9 389.8820 3 20.07 3 7857 AEV_3_3_RA3_01_1233.d 1.7E5 1 1 87 95 Carbamidomethylation
K.IM(+15.99)YALTK.I Y 42.67 854.4572 7 1.0 428.2363 2 56.54 2 23844 AEV_1_3_RA2_01_1232.d 1.42E6 6 6 74 80 Oxidation (M)
R.DITDGKDTQVLAN(+.98)QMESK(+14.02).L Y 42.61 2006.9467 18 -9.7 669.9830 3 73.02 3 42598 AEV_3_3_RA3_01_1233.d 1.48E5 1 1 137 154 Deamidation (NQ); Methylation(KR)
K.IPTWFLNR(+14.02).Q Y 41.90 1059.5865 8 -1.1 530.8000 2 79.65 3 47799 AEV_3_3_RA3_01_1233.d 2.78E5 3 3 127 134 Methylation(KR)
K.IMYALTK.I Y 41.88 838.4623 7 -2.9 420.2372 2 58.56 3 31335 AEV_3_3_RA3_01_1233.d 1.37E6 3 3 74 80
K.LREDLER.L Y 41.86 929.4930 7 8.0 310.8408 3 26.93 2 9369 AEV_1_3_RA2_01_1232.d 6.49E6 11 11 155 161
R.QRDITDGKDTQVLANQM(+15.99)ESK.L Y 41.67 2292.1016 20 -1.1 765.0403 3 49.45 3 25388 AEV_3_3_RA3_01_1233.d 1.59E5 2 2 135 154 Oxidation (M)
R.LLNTNVDGK(+14.02).Q Y 39.68 986.5397 9 -7.3 494.2735 2 50.68 2 20795 AEV_1_3_RA2_01_1232.d 6.73E5 4 4 63 71 Methylation(KR)
R.DITDGKDTQVLAN(+.98)QMESK.L Y 39.66 1992.9310 18 4.6 665.3207 3 69.51 2 32483 AEV_1_3_RA2_01_1232.d 3.05E4 1 1 137 154 Deamidation (NQ)
R.Q(-17.03)RDITDGK(+14.02)DTQVLANQMESK.L Y 37.88 2273.0957 20 28.3 569.2973 4 61.20 3 33345 AEV_3_3_RA3_01_1233.d 1.69E4 1 1 135 154 Pyro-glu from Q; Methylation(KR)
R.LLNTNVDGKQKIMYALTK.I Y 36.22 2049.1292 18 -5.3 513.2869 4 71.02 2 33611 AEV_1_3_RA2_01_1232.d 9.71E4 1 1 63 80
R.LLNTNVDGKQ(+.98)K.I Y 35.50 1229.6615 11 6.3 410.8970 3 33.71 2 12458 AEV_1_3_RA2_01_1232.d 2.02E5 2 2 63 73 Deamidation (NQ)
R.DITDGKDTQ(+.98)VLANQMESKLREDLER(+14.02).L Y 35.24 2918.4290 25 -9.7 584.6874 5 80.96 2 41324 AEV_1_3_RA2_01_1232.d 0 1 1 137 161 Deamidation (NQ); Methylation(KR)
R.LLNTN(+.98)VDGK.Q Y 35.00 973.5080 9 1.8 487.7621 2 43.84 3 21807 AEV_3_3_RA3_01_1233.d 1.27E5 1 1 63 71 Deamidation (NQ)
R.DITDGKDTQ(+.98)VLANQMESK(+14.02).L Y 34.68 2006.9467 18 5.6 669.9932 3 71.90 3 41724 AEV_3_3_RA3_01_1233.d 9.15E4 1 1 137 154 Deamidation (NQ); Methylation(KR)
R.Q(-17.03)RDITDGKDTQVLAN(+.98)QMESK.L Y 32.57 2260.0642 20 3.5 754.3646 3 70.40 2 33150 AEV_1_3_RA2_01_1232.d 0 1 1 135 154 Pyro-glu from Q; Deamidation (NQ)
K.LREDLER(+14.02).L Y 31.78 943.5087 7 -0.4 472.7614 2 32.97 3 15147 AEV_3_3_RA3_01_1233.d 4.33E5 2 2 155 161 Methylation(KR)
K.LREDLERLK.K Y 31.45 1170.6720 9 1.5 391.2318 3 46.53 2 18692 AEV_1_3_RA2_01_1232.d 4.59E5 2 2 155 163
R.DITDGKDTQVLANQMESK(+28.03).L Y 31.05 2019.9783 18 9.3 674.3396 3 73.07 3 42639 AEV_3_3_RA3_01_1233.d 5.98E4 1 1 137 154 Dimethylation(KR)
R.YSNLVC(+57.02)KKADVDLNKR.A Y 28.89 1922.0044 16 6.5 385.4106 5 48.28 3 24668 AEV_3_3_RA3_01_1233.d 8.03E4 1 1 88 103 Carbamidomethylation
R.L(+42.01)LNTNVDGKQKIMYALTK.I Y 28.31 2091.1399 18 -45.9 419.2161 5 58.32 3 31174 AEV_3_3_RA3_01_1233.d 0 1 1 63 80 Acetylation (N-term)
K.IM(-48.00)YALTK.I Y 27.58 790.4589 7 -1.7 396.2361 2 32.77 3 15018 AEV_3_3_RA3_01_1233.d 2.11E6 4 4 74 80 Dethiomethyl
K.TNFQ(+.98)FILR.L Y 27.39 1038.5498 8 2.2 520.2833 2 78.94 2 39717 AEV_1_3_RA2_01_1232.d 1.43E5 3 3 55 62 Deamidation (NQ)
R.GQHTK.T N 24.46 569.2922 5 19.0 570.3102 1 16.66 2 5016 AEV_1_3_RA2_01_1232.d 4.32E4 2 2 181 185
R.YSNLVC(+57.02)K(+14.02).K Y 24.11 896.4426 7 3.4 449.2301 2 42.44 2 16680 AEV_1_3_RA2_01_1232.d 4.43E5 4 4 88 94 Carbamidomethylation; Methylation(KR)
K.TN(+.98)FQFILR.L Y 23.72 1038.5498 8 17.3 520.2911 2 78.18 2 39121 AEV_1_3_RA2_01_1232.d 4.92E4 1 1 55 62 Deamidation (NQ)
K.QKIM(+15.99)YALTK.I Y 23.50 1110.6107 9 1.5 371.2114 3 24.29 3 10172 AEV_3_3_RA3_01_1233.d 0 1 1 72 80 Oxidation (M)
K.IKGVGRR.Y Y 22.63 784.5031 7 -9.0 393.2553 2 10.94 3 2972 AEV_3_3_RA3_01_1233.d 6.18E4 1 1 81 87
K.RAGEITTEELER(-.98).I Y 22.03 1401.7212 12 -10.8 468.2426 3 50.99 2 20942 AEV_1_3_RA2_01_1232.d 4.1E5 1 1 103 114 Amidation
R.T(+27.99)VGVSK.K Y 21.14 617.3384 6 -26.1 618.3296 1 82.04 2 42159 AEV_1_3_RA2_01_1232.d 8.64E4 1 1 193 198 Formylation
R.AGEITTEELERIVTIIQNPTQYK(+298.19).I Y 20.83 2943.5845 23 -3.7 736.9006 4 94.00 3 56791 AEV_3_3_RA3_01_1233.d 2.66E5 1 1 104 126 Levuglandinyl-lysine anhyropyrrole adduct
R.Q(+.98)RDITDGKDTQVLANQMESK.L Y 20.82 2277.0906 20 4.2 570.2823 4 62.87 2 27794 AEV_1_3_RA2_01_1232.d 9.19E4 1 1 135 154 Deamidation (NQ)
K.TNFQFILRLLNTNVDGKQK.I Y 20.76 2248.2327 19 -24.0 750.4001 3 88.78 2 46608 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 55 73
R.A(+42.01)GEITTEELER(+14.02).I Y 19.30 1302.6302 11 -2.8 652.3206 2 64.40 3 35804 AEV_3_3_RA3_01_1233.d 0 1 1 104 114 Acetylation (N-term); Methylation(KR)
K.IPTW(+31.99)FLNR.Q Y 19.01 1077.5607 8 1.2 539.7883 2 72.09 2 34413 AEV_1_3_RA2_01_1232.d 1.93E4 1 1 127 134 Dihydroxy
K.RAGEITTEELER.I Y 18.92 1402.7052 12 3.5 468.5773 3 48.21 3 24581 AEV_3_3_RA3_01_1233.d 5.39E5 1 1 103 114
K.LREDLER(-.98).L Y 18.69 928.5090 7 -9.9 465.2572 2 27.44 2 9573 AEV_1_3_RA2_01_1232.d 0 1 1 155 161 Amidation
K.K(+42.01)ADVDLNK.R Y 18.65 943.4974 8 -2.8 472.7547 2 41.69 3 20464 AEV_3_3_RA3_01_1233.d 0 1 1 95 102 Acetylation (N-term)
K.DTQVLANQ(+.98)MESK.L Y 18.42 1363.6289 12 -36.2 682.7971 2 24.24 1 6241 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 143 154 Deamidation (NQ)
R.DITDGK(-.98).D Y 18.12 646.3286 6 5.6 647.3395 1 85.36 2 44557 AEV_1_3_RA2_01_1232.d 0 1 1 137 142 Amidation
K.GVGRRYSN(+.98)LVCK.K Y 18.02 1351.7030 12 6.6 451.5779 3 36.93 3 17542 AEV_3_3_RA3_01_1233.d 2.81E5 1 1 83 94 Deamidation (NQ)
K.DTQVLANQM(-4.99)ESK.L Y 18.00 1357.6586 12 -27.4 679.8180 2 80.77 1 42432 AEV 2_3_RA2_01_1224.d 3.3E4 1 1 143 154 Methionine replacement by azido homoalanine
K.IMYALT(+79.97)K.I Y 17.91 918.4286 7 -14.2 460.2150 2 73.33 1 36545 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 74 80 Phosphorylation (STY)
K.GVGRRYSNLVCK.K Y 17.90 1350.7190 12 8.4 451.2507 3 34.94 2 13044 AEV_1_3_RA2_01_1232.d 8.72E5 1 1 83 94
R.GRTVGVSK.K Y 17.65 802.4661 8 -56.8 803.4278 1 112.17 2 54348 AEV_1_3_RA2_01_1232.d 5.06E4 1 1 191 198
K.IPTWFLN(+.98)R.Q Y 17.54 1046.5549 8 -87.4 524.2390 2 85.97 1 46542 AEV 2_3_RA2_01_1224.d 1.95E5 2 2 127 134 Deamidation (NQ)
K.KADVDLNK(+14.02)R.A Y 17.32 1071.6036 9 -37.1 358.1952 3 20.71 3 8194 AEV_3_3_RA3_01_1233.d 0 1 1 95 103 Methylation(KR)
K.IMYALTK(+43.01).I Y 17.28 881.4681 7 -5.5 441.7389 2 51.09 3 26438 AEV_3_3_RA3_01_1233.d 8.85E4 1 1 74 80 Carbamylation
R.IVTIIQNPTQYK(-1.03)IPTWFLNR.Q Y 16.61 2443.3264 20 -34.0 815.4218 3 86.50 3 52710 AEV_3_3_RA3_01_1233.d 1.78E5 1 1 115 134 Lysine oxidation to aminoadipic semialdehyde
K.ADVDLNK(+27.99).R Y 16.46 801.3868 7 11.9 401.7055 2 54.73 3 28832 AEV_3_3_RA3_01_1233.d 9.06E4 2 2 96 102 Formylation
K.DTQVLAN(+.98)QMES(+79.97)KLR.E Y 16.28 1712.7804 14 -15.2 429.1959 4 73.52 1 36702 AEV 2_3_RA2_01_1224.d 1.32E5 1 1 143 156 Deamidation (NQ); Phosphorylation (STY)
R.AGEITT(+14.02)EELERIVTIIQNPTQYK.I Y 16.21 2659.4067 23 -2.7 665.8572 4 91.65 2 48017 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 104 126 Methylation(others)
K.LREDLE(+14.02)R.L Y 16.05 943.5087 7 -0.7 472.7613 2 34.12 3 15824 AEV_3_3_RA3_01_1233.d 2.45E4 1 1 155 161 Methylation(others)
K.A(+226.08)DVDLNKR.A Y 15.90 1155.5706 8 -16.4 578.7831 2 14.97 2 4337 AEV_1_3_RA2_01_1232.d 1.02E4 1 1 96 103 Biotinylation
R.DITD(-18.01)GK.D Y 15.59 629.3021 6 -4.7 630.3064 1 73.62 3 43062 AEV_3_3_RA3_01_1233.d 0 1 1 137 142 Dehydration
R.GQ(+.98)HTK.T N 15.38 570.2762 5 38.8 571.3056 1 60.33 2 26098 AEV_1_3_RA2_01_1232.d 0 1 1 181 185 Deamidation (NQ)
K.ADVDLN(+.98)K(+14.02).R Y 15.33 788.3916 7 -96.1 789.3231 1 111.35 1 59142 AEV 2_3_RA2_01_1224.d 3.64E5 1 1 96 102 Deamidation (NQ); Methylation(KR)
R.DITD(-18.01)GK(+14.02).D Y 15.30 643.3177 6 -42.5 644.2976 1 87.66 1 47845 AEV 2_3_RA2_01_1224.d 6.45E4 1 1 137 142 Dehydration; Methylation(KR)
MQT(+79.97)FFK(+43.99).R Y 15.12 924.3452 6 -12.6 463.1741 2 18.92 1 4494 AEV 2_3_RA2_01_1224.d 1.36E4 1 1 1 6 Phosphorylation (STY); Carboxylation (DKW)
R.LLN(+.98)TNVDGKQ(+.98)K.I Y 15.05 1230.6455 11 -5.9 616.3264 2 33.64 2 12430 AEV_1_3_RA2_01_1232.d 0 1 1 63 73 Deamidation (NQ)
total 108 peptides
C1G0X4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TANVDQKTKDQLAEYGY Y 136.10 1942.9272 17 5.4 648.6532 3 65.43 2 29570 AEV_1_3_RA2_01_1232.d 3.14E6 7 7 186 202
R.C(+57.02)EALNISGEFFR.A Y 127.29 1441.6660 12 3.1 721.8425 2 80.20 2 40742 AEV_1_3_RA2_01_1232.d 9.54E5 4 4 39 50 Carbamidomethylation
R.LSHEVGWKYQDVVAR.L Y 125.46 1785.9161 15 6.3 596.3164 3 64.68 2 29030 AEV_1_3_RA2_01_1232.d 2.12E6 7 7 143 157
R.Q(-17.03)LAQAQKTANVDQK.T Y 98.04 1524.7896 14 -8.8 763.3953 2 52.35 3 27311 AEV_3_3_RA3_01_1233.d 2.49E5 4 4 179 192 Pyro-glu from Q
R.LSHEVGWKYQDVVARLEER.R Y 97.50 2313.1865 19 0.6 463.6448 5 75.14 3 44229 AEV_3_3_RA3_01_1233.d 9.78E5 3 3 143 161
K.DQLAEYGY Y 95.78 957.4080 8 -91.4 958.3277 1 74.26 1 37277 AEV 2_3_RA2_01_1224.d 1.34E5 2 2 195 202
R.LKVFEGVPPPYDK.K Y 94.61 1487.8024 13 -0.3 744.9082 2 70.57 2 33294 AEV_1_3_RA2_01_1232.d 2.33E6 12 12 104 116
K.TKDQLAEYGY Y 93.03 1186.5505 10 12.0 594.2897 2 63.19 2 28079 AEV_1_3_RA2_01_1232.d 4.93E6 9 9 193 202
K.RVVVPQALR.I Y 88.59 1036.6505 9 3.0 346.5585 3 54.66 2 22830 AEV_1_3_RA2_01_1232.d 2.54E6 9 9 119 127
K.VFEGVPPPYDK.K Y 86.88 1246.6233 11 -3.1 624.3170 2 66.53 3 37488 AEV_3_3_RA3_01_1233.d 1.66E6 7 7 106 116
M.S(+42.01)TFEPVVVIDGKGHLLGR.L Y 86.14 1965.0684 18 -0.4 983.5410 2 81.01 3 48870 AEV_3_3_RA3_01_1233.d 4.47E6 9 9 2 19 Acetylation (Protein N-term)
R.RQLAQAQKTANVDQK.T Y 82.96 1697.9172 15 2.9 425.4878 4 21.95 3 8869 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 178 192
R.VVVPQALR.I Y 81.44 880.5494 8 1.8 441.2828 2 61.22 2 26672 AEV_1_3_RA2_01_1232.d 9.32E6 7 7 120 127
R.LSHEVGWKYQ(+.98)DVVAR.L Y 80.42 1786.9001 15 8.3 447.7360 4 63.74 3 35307 AEV_3_3_RA3_01_1233.d 1.81E5 2 2 143 157 Deamidation (NQ)
R.Q(-17.03)LAQAQKTANVDQKTKDQLAEYGY Y 78.47 2693.3296 24 -2.4 898.7817 3 73.45 3 42938 AEV_3_3_RA3_01_1233.d 2.04E5 2 2 179 202 Pyro-glu from Q
K.VKGSAYYER.K Y 77.30 1071.5349 9 2.7 536.7762 2 20.36 3 8003 AEV_3_3_RA3_01_1233.d 2.07E6 7 7 164 172
R.LKVFEGVPPPYDKK.K Y 76.69 1615.8973 14 -7.3 808.9501 2 64.27 3 35711 AEV_3_3_RA3_01_1233.d 5.26E6 8 8 104 117
M.S(+42.01)TFEPVVVIDGKGHLLGR(+14.02).L Y 72.84 1979.0840 18 0.8 990.5500 2 80.45 3 48420 AEV_3_3_RA3_01_1233.d 6.38E5 3 3 2 19 Acetylation (Protein N-term); Methylation(KR)
K.VFEGVPPPYDKK.K Y 70.68 1374.7183 12 -0.9 459.2463 3 59.61 3 32133 AEV_3_3_RA3_01_1233.d 1.96E6 9 9 106 117
R.LSHEVGWK.Y Y 70.42 954.4923 8 0.1 478.2535 2 34.87 3 16281 AEV_3_3_RA3_01_1233.d 2.47E6 7 7 143 150
R.GGPFHFR.A Y 65.87 816.4031 7 3.6 409.2103 2 53.18 2 22073 AEV_1_3_RA2_01_1232.d 4.02E6 11 11 70 76
K.TANVDQKTKDQLAE(+14.02)YGY Y 64.20 1956.9429 17 1.2 653.3223 3 66.11 3 37152 AEV_3_3_RA3_01_1233.d 2.81E5 1 1 186 202 Methylation(others)
K.YQDVVAR.L Y 63.20 849.4344 7 -88.0 425.6871 2 40.97 1 14975 AEV 2_3_RA2_01_1224.d 3.86E6 8 8 151 157
K.TK(+14.02)DQLAEYGY Y 62.22 1200.5663 10 4.7 601.2932 2 65.27 3 36490 AEV_3_3_RA3_01_1233.d 3.23E5 3 3 193 202 Methylation(KR)
R.LSHE(+14.02)VGWKYQDVVAR.L Y 62.13 1799.9319 15 -19.2 450.9816 4 65.34 3 36543 AEV_3_3_RA3_01_1233.d 0 1 1 143 157 Methylation(others)
R.C(+58.01)EALNISGEFFR.A Y 61.44 1442.6500 12 -0.7 722.3318 2 82.91 3 50246 AEV_3_3_RA3_01_1233.d 2.45E5 4 4 39 50 Carboxymethyl
M.S(+42.01)TFEPVVVIDGK.G Y 61.19 1331.6973 12 0.9 666.8565 2 83.30 2 43116 AEV_1_3_RA2_01_1232.d 1.16E6 4 4 2 13 Acetylation (Protein N-term)
K.TANVDQ(+.98)KTKDQLAEYGY Y 58.88 1943.9113 17 2.8 648.9795 3 67.99 3 38644 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 186 202 Deamidation (NQ)
R.VVVPQALR(+14.02).I Y 56.19 894.5651 8 -7.8 448.2863 2 65.02 3 36291 AEV_3_3_RA3_01_1233.d 5.2E5 2 2 120 127 Methylation(KR)
R.C(+57.02)EALN(-17.03)ISGEFFR.A Y 54.33 1424.6394 12 -3.6 713.3244 2 88.62 3 53972 AEV_3_3_RA3_01_1233.d 4.99E5 3 3 39 50 Carbamidomethylation; Ammonia-loss (N)
R.LSHEVGWKYQDVVARLEER(+14.02).R Y 54.21 2327.2021 19 1.3 466.4483 5 77.84 3 46379 AEV_3_3_RA3_01_1233.d 1.37E5 2 2 143 161 Methylation(KR)
K.TKDQLAE(+14.02)YGY Y 53.74 1200.5663 10 -2.6 601.2889 2 65.63 3 36778 AEV_3_3_RA3_01_1233.d 5.86E5 2 2 193 202 Methylation(others)
K.YHAYLR.K Y 52.91 821.4184 6 -88.2 411.6802 2 51.98 1 21340 AEV 2_3_RA2_01_1224.d 5.07E5 5 5 55 60
R.FNPTRGGPFHFR.A Y 52.53 1431.7159 12 3.3 358.9374 4 65.50 2 29597 AEV_1_3_RA2_01_1232.d 7.78E4 1 1 65 76
K.KRVVVPQALR.I Y 51.95 1164.7455 10 -20.8 389.2477 3 39.68 3 19206 AEV_3_3_RA3_01_1233.d 0 3 3 118 127
R.C(+71.04)EALNISGEFFR.A Y 49.76 1455.6816 12 -4.7 728.8447 2 81.74 2 41925 AEV_1_3_RA2_01_1232.d 1.74E5 2 2 39 50 Propionamide
K.LKYHAYLR.K Y 49.05 1062.5974 8 -14.8 532.2981 2 43.72 2 17335 AEV_1_3_RA2_01_1232.d 6.98E5 5 5 53 60
K.GSAYYER.K Y 48.84 844.3715 7 -87.9 423.1559 2 31.85 1 10003 AEV 2_3_RA2_01_1224.d 1.13E6 5 5 166 172
K.VKGSAYYER(+14.02).K Y 48.71 1085.5505 9 -0.6 543.7822 2 26.86 3 11618 AEV_3_3_RA3_01_1233.d 1.51E5 2 2 164 172 Methylation(KR)
K.YQDVVARLEER.R Y 48.07 1376.7048 11 3.3 459.9104 3 64.74 2 29069 AEV_1_3_RA2_01_1232.d 6.31E5 2 2 151 161
R.GGPFHFRAPSR.I Y 48.04 1227.6261 11 0.3 410.2161 3 51.96 3 27029 AEV_3_3_RA3_01_1233.d 1.64E6 4 4 70 80
R.LSHEVGWK(-1.03)YQDVVAR.L Y 46.19 1784.8845 15 12.8 447.2341 4 63.53 3 35149 AEV_3_3_RA3_01_1233.d 3.04E5 2 2 143 157 Lysine oxidation to aminoadipic semialdehyde
K.TANVDQKTK(+14.02)DQLAEYGY Y 45.78 1956.9429 17 5.3 653.3250 3 66.75 2 30475 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 186 202 Methylation(KR)
R.LASIVAK.Q Y 45.42 700.4483 7 2.9 351.2325 2 37.66 2 14345 AEV_1_3_RA2_01_1232.d 6.17E6 12 12 20 26
R.VVVPQ(+.98)ALR.I Y 45.40 881.5334 8 6.2 441.7767 2 63.27 2 28058 AEV_1_3_RA2_01_1232.d 9.02E5 3 3 120 127 Deamidation (NQ)
K.YQDVVAR(+14.02).L Y 45.04 863.4501 7 1.2 432.7328 2 37.52 3 17900 AEV_3_3_RA3_01_1233.d 8.61E5 7 7 151 157 Methylation(KR)
M.S(+56.06)TFEPVVVIDGKGHLLGR.L Y 44.92 1979.1204 18 -19.8 990.5479 2 82.52 3 49964 AEV_3_3_RA3_01_1233.d 5.62E5 2 2 2 19 Diethylation
R.RQLAQAQK.T Y 44.87 941.5406 8 5.4 471.7802 2 10.35 2 2607 AEV_1_3_RA2_01_1232.d 1.67E5 3 3 178 185
R.LKVFE(+14.02)GVPPPYDK.K Y 43.52 1501.8180 13 -2.9 751.9141 2 71.64 3 41516 AEV_3_3_RA3_01_1233.d 5.86E4 2 2 104 116 Methylation(others)
R.KYC(+57.02)TVGR.L Y 43.35 882.4382 7 12.6 442.2319 2 13.79 3 4527 AEV_3_3_RA3_01_1233.d 1.47E5 2 2 136 142 Carbamidomethylation
K.TKDQ(+.98)LAEYGY Y 43.31 1187.5345 10 11.9 594.7816 2 65.85 2 29914 AEV_1_3_RA2_01_1232.d 4.24E5 3 3 193 202 Deamidation (NQ)
K.YC(+57.02)TVGR.L Y 42.84 754.3432 6 -85.0 378.1468 2 27.05 1 7499 AEV 2_3_RA2_01_1224.d 9.84E5 4 4 137 142 Carbamidomethylation
K.QLLNGQK.I Y 38.25 799.4552 7 -105.4 800.3782 1 35.38 1 11881 AEV 2_3_RA2_01_1224.d 2.89E5 4 4 27 33
K.TKDQLAEYGY(+14.02) Y 38.08 1200.5663 10 11.9 601.2975 2 67.61 2 31083 AEV_1_3_RA2_01_1232.d 6.14E5 3 3 193 202 Methylation(C-term)
K.TANVDQKTKDQLAEYGY(+14.02) Y 36.32 1956.9429 17 8.7 653.3272 3 68.48 2 31713 AEV_1_3_RA2_01_1232.d 9.67E4 1 1 186 202 Methylation(C-term)
R.APSRIFYK.A Y 36.24 980.5443 8 0.3 491.2796 2 39.17 3 18930 AEV_3_3_RA3_01_1233.d 3.03E5 2 2 77 84
R.L(+42.01)ASIVAK.Q Y 35.85 742.4589 7 -112.2 372.1951 2 52.28 1 21527 AEV 2_3_RA2_01_1224.d 1.29E4 2 2 20 26 Acetylation (Protein N-term)
R.LK(+14.02)VFEGVPPPYDKK.K Y 35.35 1629.9130 14 7.1 408.4884 4 65.90 3 36987 AEV_3_3_RA3_01_1233.d 4.54E5 3 3 104 117 Methylation(KR)
K.GSAYYER(+14.02).K Y 35.24 858.3871 7 0.0 430.2009 2 29.11 3 12875 AEV_3_3_RA3_01_1233.d 9.6E5 3 3 166 172 Methylation(KR)
M.STFE(+37.03)PVVVIDGKGHLLGR.L Y 34.51 1960.0894 18 -18.9 654.3580 3 81.50 2 41736 AEV_1_3_RA2_01_1232.d 4.46E4 1 1 2 19 Propargylamine
R.GMIPHK.S Y 34.04 681.3632 6 5.3 341.6907 2 19.47 3 7562 AEV_3_3_RA3_01_1233.d 6.86E5 3 3 88 93
R.LSHEVGWKYQDVVAR(+28.03)LEER.R Y 33.77 2341.2178 19 0.6 469.2511 5 78.49 3 46890 AEV_3_3_RA3_01_1233.d 4.95E4 1 1 143 161 Dimethylation(KR)
K.GSAYYERK.K Y 33.40 972.4664 8 4.6 487.2427 2 14.25 2 4061 AEV_1_3_RA2_01_1232.d 1.68E5 2 2 166 173
K.GSAYYER(+14.02)K.K Y 33.03 986.4821 8 20.3 494.2583 2 18.51 3 7035 AEV_3_3_RA3_01_1233.d 0 1 1 166 173 Methylation(KR)
R.LSHEVGWKYQDVVAR(+14.02).L Y 32.51 1799.9319 15 -32.9 450.9755 4 65.77 3 36884 AEV_3_3_RA3_01_1233.d 0 1 1 143 157 Methylation(KR)
R.LASIVAK(+14.02).Q Y 31.82 714.4639 7 -0.5 358.2390 2 46.47 3 23481 AEV_3_3_RA3_01_1233.d 5.4E5 5 5 20 26 Methylation(KR)
R.GM(+15.99)IPHK.S Y 30.99 697.3581 6 -87.6 349.6558 2 23.19 1 5800 AEV 2_3_RA2_01_1224.d 7.15E5 7 7 88 93 Oxidation (M)
R.FNPTR.G Y 30.95 633.3234 5 5.5 317.6707 2 17.75 2 5462 AEV_1_3_RA2_01_1232.d 2.27E6 7 7 65 69
R.GM(-48.00)IPHK.S Y 30.54 633.3599 6 6.4 317.6892 2 8.69 2 2060 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 88 93 Dethiomethyl
M.S(+42.01)TFEPVVVIDGK(+14.02)GHLLGR.L Y 30.05 1979.0840 18 3.2 660.7040 3 83.22 2 43034 AEV_1_3_RA2_01_1232.d 1.01E6 2 2 2 19 Acetylation (Protein N-term); Methylation(KR)
R.GAAAMER.L Y 29.88 704.3275 7 66.6 353.1945 2 12.28 3 3642 AEV_3_3_RA3_01_1233.d 0 1 1 97 103
R.GM(+15.99)IPHKSSR.G Y 29.64 1027.5233 9 5.0 343.5168 3 9.93 2 2459 AEV_1_3_RA2_01_1232.d 2.51E4 1 1 88 96 Oxidation (M)
K.ITRFNPTR.G Y 29.47 1003.5563 8 -1.6 335.5255 3 31.01 3 13975 AEV_3_3_RA3_01_1233.d 4.43E5 2 2 62 69
R.LSHEVGWK(+42.01)YQDVVAR.L Y 29.44 1827.9268 15 -31.0 457.9748 4 74.30 1 37308 AEV 2_3_RA2_01_1224.d 0 1 1 143 157 Acetylation (K)
K.QLLN(+.98)GQK.I Y 29.39 800.4392 7 9.6 401.2307 2 27.17 2 9448 AEV_1_3_RA2_01_1232.d 0 1 1 27 33 Deamidation (NQ)
R.FNPTR(+14.02).G Y 29.19 647.3391 5 0.9 324.6771 2 23.88 3 9978 AEV_3_3_RA3_01_1233.d 5.54E5 2 2 65 69 Methylation(KR)
R.Q(-17.03)LAQAQK(+14.02).T Y 29.10 782.4286 7 -120.0 783.3420 1 49.64 1 20050 AEV 2_3_RA2_01_1224.d 0 1 1 179 185 Pyro-glu from Q; Methylation(KR)
R.Q(-17.03)LAQAQK.T Y 29.08 768.4130 7 -86.9 385.1804 2 35.91 1 12141 AEV 2_3_RA2_01_1224.d 3.36E5 1 1 179 185 Pyro-glu from Q
R.LS(-2.02)HEVGWKYQDVVARLEER.R Y 28.13 2311.1709 19 18.5 463.2500 5 76.09 2 37463 AEV_1_3_RA2_01_1232.d 0 1 1 143 161 2-amino-3-oxo-butanoic_acid
R.LKPGRK.Y Y 27.90 697.4598 6 6.0 349.7393 2 8.18 2 1935 AEV_1_3_RA2_01_1232.d 4.27E4 2 2 131 136
M.S(+42.01)TFEPVVVID(-18.01)GKGHLLGR.L Y 27.85 1947.0577 18 7.7 650.0315 3 81.30 2 41588 AEV_1_3_RA2_01_1232.d 6.2E4 1 1 2 19 Acetylation (Protein N-term); Dehydration
R.RQLAQ(+.98)AQK.T Y 27.12 942.5247 8 3.1 472.2711 2 11.11 2 2886 AEV_1_3_RA2_01_1232.d 1.82E4 1 1 178 185 Deamidation (NQ)
K.GHLLGR.L Y 27.05 651.3816 6 0.8 326.6983 2 19.55 3 7605 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 14 19
R.GAAAMER(+14.02).L Y 26.72 718.3432 7 15.7 360.1845 2 18.10 3 6809 AEV_3_3_RA3_01_1233.d 1.36E5 2 2 97 103 Methylation(KR)
K.YQDVVARLEER(+14.02).R Y 26.57 1390.7205 11 6.4 464.5837 3 69.71 3 40071 AEV_3_3_RA3_01_1233.d 1.46E5 1 1 151 161 Methylation(KR)
R.GMIPHKSSR.G Y 26.09 1011.5284 9 -6.1 506.7684 2 17.72 2 5452 AEV_1_3_RA2_01_1232.d 3.71E4 1 1 88 96
R.L(+42.01)K(+42.01)VFEGVPPPYDKK.K Y 25.72 1699.9185 14 -5.0 425.9848 4 65.44 2 29556 AEV_1_3_RA2_01_1232.d 1.11E6 2 2 104 117 Acetylation (N-term); Acetylation (K)
R.G(+42.01)AAAM(+15.99)ERLKVFEGVPPPYDK.K Y 25.64 2232.1248 20 26.5 745.0686 3 70.13 3 40328 AEV_3_3_RA3_01_1233.d 0 1 1 97 116 Acetylation (N-term); Oxidation (M)
R.G(+127.06)GPFHFR.A Y 25.48 943.4664 7 -20.3 315.4897 3 68.48 1 32798 AEV 2_3_RA2_01_1224.d 0 1 1 70 76 N-Succinimidyl-2-morpholine acetate
K.YC(+57.02)TVGR(+14.02).L Y 25.17 768.3588 6 17.6 385.1935 2 24.03 2 8073 AEV_1_3_RA2_01_1232.d 6.89E5 4 4 137 142 Carbamidomethylation; Methylation(KR)
K.VFEGVPPPYD(+43.99)K.K Y 25.16 1290.6132 11 -104.2 431.1668 3 41.77 1 15429 AEV 2_3_RA2_01_1224.d 0 1 1 106 116 Carboxylation (DKW)
K.YQ(+.98)DVVAR.L Y 24.91 850.4185 7 2.5 426.2176 2 32.23 3 14705 AEV_3_3_RA3_01_1233.d 4E5 1 1 151 157 Deamidation (NQ)
K.Q(-17.03)LLNGQ(+.98)K.I Y 24.21 783.4127 7 -29.6 784.3967 1 57.69 2 24465 AEV_1_3_RA2_01_1232.d 2.88E4 2 2 27 33 Pyro-glu from Q; Deamidation (NQ)
R.ILRLKPGR.K Y 24.07 951.6342 8 16.9 952.6575 1 102.86 3 59976 AEV_3_3_RA3_01_1233.d 0 1 1 128 135
R.LK(+14.02)VFEGVPPPYDK.K Y 23.92 1501.8180 13 29.0 501.6278 3 71.41 3 41332 AEV_3_3_RA3_01_1233.d 3.75E5 2 2 104 116 Methylation(KR)
K.YQD(+14.02)VVAR.L Y 23.91 863.4501 7 -1.7 432.7316 2 41.16 3 20100 AEV_3_3_RA3_01_1233.d 1.42E5 1 1 151 157 Methylation(others)
K.RVVVPQ(+.98)ALR.I Y 23.17 1037.6345 9 25.0 346.8941 3 54.13 3 28444 AEV_3_3_RA3_01_1233.d 0 1 1 119 127 Deamidation (NQ)
R.RQLAQAQK(+14.02).T Y 22.60 955.5563 8 2.3 478.7865 2 14.61 2 4192 AEV_1_3_RA2_01_1232.d 1.99E4 1 1 178 185 Methylation(KR)
R.LKVFEGVPPPY(-18.01)DK(+14.02)K.K Y 22.59 1611.9023 14 -3.7 403.9814 4 64.22 3 35675 AEV_3_3_RA3_01_1233.d 0 1 1 104 117 Dehydration; Methylation(KR)
R.GGPFHFRAPSR(+14.02).I Y 22.55 1241.6417 11 -2.7 311.4169 4 57.12 3 30309 AEV_3_3_RA3_01_1233.d 6.43E4 1 1 70 80 Methylation(KR)
K.I(+43.01)VVVR.C N 22.44 627.4068 5 -105.8 314.6775 2 46.88 1 18420 AEV 2_3_RA2_01_1224.d 1.9E5 1 1 34 38 Carbamylation
K.G(+42.01)SAYYER.K Y 21.80 886.3821 7 61.3 444.2255 2 21.90 2 7175 AEV_1_3_RA2_01_1232.d 0 1 1 166 172 Acetylation (N-term)
K.T(+42.01)ANVDQK(+43.99).T Y 21.75 860.3876 7 -76.1 431.1683 2 24.98 1 6579 AEV 2_3_RA2_01_1224.d 6.86E4 1 1 186 192 Acetylation (N-term); Carboxylation (DKW)
R.LSHEVGWKYQD(+21.98)VVARLEER.R Y 20.90 2335.1685 19 5.5 468.0435 5 63.66 3 35244 AEV_3_3_RA3_01_1233.d 1.55E5 1 1 143 161 Sodium adduct
K.G(+210.20)S(+79.97)AYYERK.K Y 20.84 1262.6311 8 9.8 316.6682 4 14.39 3 4777 AEV_3_3_RA3_01_1233.d 0 1 1 166 173 Myristoylation; Phosphorylation (STY)
R.GAAAM(+15.99)ER(+14.02).L Y 20.79 734.3381 7 -89.5 368.1434 2 21.93 1 5361 AEV 2_3_RA2_01_1224.d 0 2 2 97 103 Oxidation (M); Methylation(KR)
K.VK(+43.99)GSAYYER.K Y 20.53 1115.5247 9 97.1 372.8849 3 20.36 3 8005 AEV_3_3_RA3_01_1233.d 2.24E5 1 1 164 172 Carboxylation (DKW)
K.Y(+42.01)QDVVAR.L Y 19.93 891.4450 7 3.0 446.7311 2 74.84 1 37742 AEV 2_3_RA2_01_1224.d 0 1 1 151 157 Acetylation (N-term)
R.KITRFNPTR.G Y 19.53 1131.6512 9 5.9 378.2266 3 33.18 2 12211 AEV_1_3_RA2_01_1232.d 4.53E4 1 1 61 69
R.FNPTR(+31.99).G Y 19.47 665.3133 5 16.1 666.3313 1 57.13 2 24165 AEV_1_3_RA2_01_1232.d 0 1 1 65 69 Dihydroxy
K.VK(+31.99)GSAYYER.K Y 19.28 1103.5247 9 17.0 368.8551 3 22.00 2 7221 AEV_1_3_RA2_01_1232.d 0 1 1 164 172 Dihydroxy
R.GGPFHFRAPSR(+.98).I Y 19.15 1228.6101 11 16.3 410.5507 3 56.49 2 23812 AEV_1_3_RA2_01_1232.d 7.26E4 1 1 70 80 Deamidation (R)
R.GM(-48.00)IPHKSSR.G Y 18.99 963.5250 9 1.9 482.7707 2 9.13 3 2230 AEV_3_3_RA3_01_1233.d 3E4 2 2 88 96 Dethiomethyl
R.Q(+.98)LAQAQK(+42.01).T Y 18.62 828.4341 7 -27.7 829.4184 1 94.24 2 49062 AEV_1_3_RA2_01_1232.d 3.66E4 1 1 179 185 Deamidation (NQ); Acetylation (K)
R.QLAQAQ(+.98)K(+14.02).T Y 18.59 800.4392 7 8.6 401.2303 2 37.42 3 17839 AEV_3_3_RA3_01_1233.d 0 1 1 179 185 Deamidation (NQ); Methylation(KR)
K.VFE(+14.02)GVPPPYDKK.K Y 18.58 1388.7339 12 8.8 463.9226 3 62.95 3 34703 AEV_3_3_RA3_01_1233.d 2.27E5 1 1 106 117 Methylation(others)
R.KYC(+57.02)TVGR(+14.02).L Y 18.32 896.4538 7 -1.3 449.2336 2 16.76 3 6075 AEV_3_3_RA3_01_1233.d 5.22E4 1 1 136 142 Carbamidomethylation; Methylation(KR)
R.RQLAQAQK(-.98).T Y 18.31 940.5566 8 18.4 471.2943 2 10.65 3 2844 AEV_3_3_RA3_01_1233.d 1.18E4 1 1 178 185 Amidation
R.R(+42.01)QLAQAQK.T Y 18.15 983.5512 8 -8.9 984.5497 1 101.69 1 56272 AEV 2_3_RA2_01_1224.d 2.09E4 1 1 178 185 Acetylation (N-term)
K.V(+42.01)KGSAYYER.K Y 17.61 1113.5454 9 31.3 372.2007 3 20.78 3 8237 AEV_3_3_RA3_01_1233.d 0 1 1 164 172 Acetylation (N-term)
K.AVRGMIPHK(+43.01).S Y 17.32 1050.5757 9 -15.7 351.1937 3 12.88 3 3982 AEV_3_3_RA3_01_1233.d 0 1 1 85 93 Carbamylation
K.GSAYYERK(+14.02).K Y 17.11 986.4821 8 21.3 494.2589 2 22.70 3 9274 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 166 173 Methylation(KR)
R.V(+119.04)VVPQALR.I Y 16.99 999.5865 8 -8.2 334.2001 3 35.48 3 16616 AEV_3_3_RA3_01_1233.d 3.74E5 1 1 120 127 Pyridylacetyl
K.TANVDQK(+226.08).T Y 16.74 1000.4648 7 -64.4 501.2075 2 24.78 1 6453 AEV 2_3_RA2_01_1224.d 0 1 1 186 192 Biotinylation
R.CEALN(+.98)ISGEFFR.A Y 16.70 1385.6285 12 -18.6 462.8749 3 66.66 1 31369 AEV 2_3_RA2_01_1224.d 5.16E4 1 1 39 50 Deamidation (NQ)
K.TANVDQK.T Y 16.65 774.3871 7 -2.0 388.2001 2 17.43 3 6442 AEV_3_3_RA3_01_1233.d 0 1 1 186 192
R.AKLKYHAYLR.K Y 16.19 1261.7295 10 9.1 316.4425 4 36.22 3 17081 AEV_3_3_RA3_01_1233.d 5.52E5 1 1 51 60
K.Q(-17.03)LLNGQK.I Y 15.92 782.4286 7 -91.2 392.1859 2 60.23 1 26654 AEV 2_3_RA2_01_1224.d 3.22E5 1 1 27 33 Pyro-glu from Q
K.V(+226.08)FEGVPPPYDK.K Y 15.89 1472.7009 11 -7.5 369.1797 4 62.69 1 28547 AEV 2_3_RA2_01_1224.d 2.06E5 1 1 106 116 Biotinylation
R.GAAAMER(-.98).L Y 15.56 703.3435 7 -102.1 352.6431 2 39.10 1 13891 AEV 2_3_RA2_01_1224.d 1.27E5 1 1 97 103 Amidation
K.TANVDQK(+14.02).T Y 15.36 788.4028 7 -112.3 789.3215 1 109.77 1 58694 AEV 2_3_RA2_01_1224.d 3.64E5 1 1 186 192 Methylation(KR)
K.Q(+.98)LLNGQK.I Y 15.27 800.4392 7 30.3 401.2390 2 50.82 3 26247 AEV_3_3_RA3_01_1233.d 3.86E4 1 1 27 33 Deamidation (NQ)
R.GMIPHKSSRGAAAMER.L Y 15.27 1697.8453 16 -1.8 566.9547 3 81.12 2 41443 AEV_1_3_RA2_01_1232.d 1.9E4 1 1 88 103
K.TK(+43.99)DQLAEYGY Y 15.24 1230.5404 10 -31.5 411.1745 3 26.35 1 7149 AEV 2_3_RA2_01_1224.d 0 1 1 193 202 Carboxylation (DKW)
R.LSHEVGW(+15.99)K.Y Y 15.23 970.4872 8 16.7 486.2590 2 32.71 2 11985 AEV_1_3_RA2_01_1232.d 0 1 1 143 150 Oxidation (HW)
total 135 peptides
C1GDJ1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.FIDDNVTPADADILR.T Y 120.47 1673.8260 15 0.9 837.9211 2 78.89 2 39673 AEV_1_3_RA2_01_1232.d 5.28E5 4 4 883 897
R.AIQVEGQPIILTGAPAINK.L Y 114.88 1932.1044 19 -6.7 645.0377 3 79.65 2 40284 AEV_1_3_RA2_01_1232.d 1.26E5 2 2 1782 1800
K.HAQPFLGQLPDLGPPQVVGNKPPQR.F Y 107.80 2689.4451 25 1.3 673.3694 4 77.89 2 38880 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 772 796
R.ALADGGLLVLLDGR.S Y 106.75 1381.7928 14 1.4 691.9047 2 87.72 2 46034 AEV_1_3_RA2_01_1232.d 2.13E5 2 2 652 665
R.NSAVPNITATSPSSPLKPATPSRR.D Y 102.52 2448.3083 24 1.0 613.0850 4 63.97 3 35477 AEV_3_3_RA3_01_1233.d 3.58E5 3 3 2186 2209
K.Q(-17.03)PGSTLEAGDILGILALDNPSR.V Y 100.45 2219.1433 22 -0.7 1110.5781 2 96.62 3 57899 AEV_3_3_RA3_01_1233.d 1.8E5 2 2 748 769 Pyro-glu from Q
R.LGGIPIGVIAVETR.S Y 99.00 1393.8292 14 0.5 697.9222 2 82.03 2 42153 AEV_1_3_RA2_01_1232.d 2.96E5 3 3 1920 1933
R.MPQKLDSLLAQVVDR.A Y 94.52 1711.9291 15 -12.4 571.6432 3 82.04 2 42219 AEV_1_3_RA2_01_1232.d 2.13E5 2 2 849 863
K.LREENKDDIFGVIQTVLSHSK.V Y 89.46 2427.2756 21 3.3 486.4640 5 83.96 2 43583 AEV_1_3_RA2_01_1232.d 1.25E5 2 2 950 970
R.GGVLEPEGIVNIK.Y Y 82.20 1323.7397 13 -1.2 662.8763 2 75.72 3 44695 AEV_3_3_RA3_01_1233.d 1.52E5 2 2 2058 2070
R.SVDTVTPADPANPDSMELISTEAGGVWYPNSAFK.T Y 81.16 3565.6558 34 0.7 1189.5601 3 87.76 3 53439 AEV_3_3_RA3_01_1233.d 9.28E4 1 1 1934 1967
R.MPQKLDSLLAQVVDRAK.T Y 80.47 1911.0612 17 3.6 478.7743 4 80.34 3 48334 AEV_3_3_RA3_01_1233.d 9.24E4 2 2 849 865
R.VKHAQPFLGQLPDLGPPQVVGNKPPQR.F Y 77.44 2916.6086 27 -19.9 584.3174 5 74.60 3 43819 AEV_3_3_RA3_01_1233.d 6.36E4 1 1 770 796
K.YLYLTPEVK.K Y 76.14 1124.6117 9 0.3 563.3133 2 72.15 2 34463 AEV_1_3_RA2_01_1232.d 4.5E5 5 5 1692 1700
R.LLYGVDPNTSSEIDFHFENEESTK.T Y 73.48 2770.2610 24 2.7 924.4301 3 80.46 3 48423 AEV_3_3_RA3_01_1233.d 1.51E5 2 2 415 438
R.HSEPALAFQLELGR.L Y 72.77 1566.8154 14 -9.4 523.2742 3 77.10 2 38261 AEV_1_3_RA2_01_1232.d 1.23E5 4 4 1314 1327
R.MAAAAPSTTSR.N Y 72.51 1062.5128 11 4.3 532.2660 2 25.63 3 10930 AEV_3_3_RA3_01_1233.d 1.57E5 2 2 2175 2185
K.ALNDKFLPADQLSK.I Y 69.30 1558.8354 14 -4.4 520.6168 3 68.78 3 39275 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 2093 2106
R.GSGLIAGATSK.A Y 66.80 960.5240 11 0.7 481.2696 2 36.93 3 17544 AEV_3_3_RA3_01_1233.d 2.15E5 5 5 1743 1753
R.LSVDGKTC(+57.02)LLEEENDPTQLR.T Y 58.04 2316.1267 20 19.4 773.0645 3 72.83 3 42453 AEV_3_3_RA3_01_1233.d 7.15E4 1 1 680 699 Carbamidomethylation
M.GVTDTPATATN(+.98)GFGSSFAAK.H Y 56.76 1899.8850 20 1.4 950.9511 2 71.66 3 41535 AEV_3_3_RA3_01_1233.d 9.71E4 2 2 2 21 Deamidation (NQ)
K.IVQWMSFIPDKK.N Y 56.65 1490.7955 12 -6.9 497.9357 3 79.89 2 40474 AEV_1_3_RA2_01_1232.d 6.75E4 1 1 1839 1850
R.ILC(+57.02)TEPTTGMAYPLR.V Y 55.33 1721.8480 15 1.1 861.9323 2 75.71 2 37169 AEV_1_3_RA2_01_1232.d 4.22E4 1 1 1454 1468 Carbamidomethylation
R.M(+15.99)AAAAPSTTSR.N Y 51.64 1078.5077 11 19.7 540.2717 2 16.74 2 5052 AEV_1_3_RA2_01_1232.d 2.33E5 6 6 2175 2185 Oxidation (M)
K.GVIIPVNYLDDAEEMLSR.A Y 50.77 2033.0139 18 1.0 1017.5153 2 91.10 3 55305 AEV_3_3_RA3_01_1233.d 6.9E4 1 1 1187 1204
R.GPTYNEDESIR.H Y 49.55 1279.5680 11 2.5 640.7928 2 43.87 3 21833 AEV_3_3_RA3_01_1233.d 5.72E5 2 2 1303 1313
M.GVTDTPATATNGFGSSFAAK.H Y 49.03 1898.9010 20 2.4 950.4601 2 71.90 2 34270 AEV_1_3_RA2_01_1232.d 1.14E5 2 2 2 21
K.LVSEVKEELLAR.R Y 48.19 1384.7925 12 -4.1 462.6029 3 67.53 3 38275 AEV_3_3_RA3_01_1233.d 1.12E4 2 2 1268 1279
R.IYLSANSGAR.I Y 47.46 1050.5458 10 1.8 526.2811 2 43.92 3 21868 AEV_3_3_RA3_01_1233.d 9.81E5 8 8 1656 1665
K.YTVENGEHVK.A Y 47.35 1174.5618 10 1.0 588.2888 2 25.22 2 8604 AEV_1_3_RA2_01_1232.d 3.77E5 3 3 709 718
K.YLGSP Y 46.84 535.2642 5 16.6 536.2803 1 39.12 3 18872 AEV_3_3_RA3_01_1233.d 2.47E5 5 5 2294 2298
R.IIGFPVMVK.A Y 46.64 1002.5936 9 -3.1 502.3025 2 79.25 3 47486 AEV_3_3_RA3_01_1233.d 4.46E4 1 1 239 247
K.QPGSTLEAGDILGILALDNPSR.V Y 46.63 2236.1699 22 -2.7 746.3953 3 90.21 3 54866 AEV_3_3_RA3_01_1233.d 8.84E4 1 1 748 769
K.AKETIRQALQWK.N Y 44.31 1470.8307 12 -17.2 736.4100 2 80.90 2 41270 AEV_1_3_RA2_01_1232.d 4.55E5 2 2 2141 2152
R.AHLSSEAC(+57.02)IAEYR.K Y 43.85 1505.6932 13 -104.4 502.8526 3 67.15 1 31759 AEV 2_3_RA2_01_1224.d 0 1 1 584 596 Carbamidomethylation
R.VE(+21.98)SIDELTGVC(+57.02)NVAIR.D Y 43.62 1795.8750 16 -10.6 449.9713 4 89.38 1 49167 AEV 2_3_RA2_01_1224.d 1.39E5 1 1 1236 1251 Sodium adduct; Carbamidomethylation
R.TPEYPR.G Y 42.69 761.3708 6 36.4 381.7065 2 23.49 3 9705 AEV_3_3_RA3_01_1233.d 5.74E5 5 5 1610 1615
K.TVFPVDFIYEGFRYK.F Y 42.18 1879.9508 15 -0.4 627.6573 3 86.32 3 52590 AEV_3_3_RA3_01_1233.d 2.55E5 1 1 612 626
K.KIIFIGPPGSAMR.S Y 40.26 1385.7853 13 13.4 462.9419 3 72.84 2 35033 AEV_1_3_RA2_01_1232.d 7.21E4 1 1 165 177
K.KISSISDM(+15.99)SYLVNKGVNEPMRK.G Y 39.61 2511.2825 22 -2.5 628.8264 4 90.59 3 55036 AEV_3_3_RA3_01_1233.d 0 2 2 1165 1186 Oxidation (M)
R.ALAGFLER.F Y 39.49 875.4865 8 -3.8 438.7488 2 69.33 3 39716 AEV_3_3_RA3_01_1233.d 3E5 3 3 1430 1437
K.QPGS(-20.03)TLEAGDILGILALDNPSR.V Y 39.02 2216.1436 22 -19.5 1109.0575 2 96.56 3 57867 AEV_3_3_RA3_01_1233.d 9.18E4 1 1 748 769 Formation of five membered aromatic heterocycle
K.IGSMHLRPVST(-18.01)PYPTK(+14.02).E Y 34.96 1778.9501 16 -2.8 445.7436 4 69.45 3 39810 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 1505 1520 Dehydration; Methylation(KR)
R.ITSEDPGEGFKPSSGTMHELNFR.S Y 33.98 2535.1699 23 10.6 634.8065 4 70.93 2 33543 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 454 476
K.WAYNTFGDER.A Y 33.76 1257.5414 10 38.4 629.8021 2 68.29 3 38885 AEV_3_3_RA3_01_1233.d 0 1 1 77 86
K.NSPVPIRPYSDTWDRDIAYYPPAR.Q Y 32.25 2848.3931 24 -26.1 713.0870 4 77.31 2 38414 AEV_1_3_RA2_01_1232.d 0 1 1 1851 1874
R.SSNDNYHLFINGSK.C Y 31.86 1594.7375 14 -14.4 532.5788 3 62.55 3 34387 AEV_3_3_RA3_01_1233.d 1.09E5 2 2 632 645
R.L(+42.01)DPEYGELRK.A Y 31.14 1260.6350 10 14.1 421.2249 3 49.52 3 25437 AEV_3_3_RA3_01_1233.d 2.69E5 1 1 2083 2092 Acetylation (N-term)
K.T(+42.01)K(+42.01)NVIT(+79.97)ELVTENSEER.H Y 30.26 2024.9303 16 7.3 507.2435 4 86.92 1 47283 AEV 2_3_RA2_01_1224.d 0 1 1 1708 1723 Acetylation (N-term); Acetylation (K); Phosphorylation (STY)
R.AIQFTVM(+15.99)ATPEDLR.A Y 29.48 1606.8025 14 -3.4 402.7065 4 18.79 3 7186 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 87 100 Oxidation (M)
R.TTVEYLIK.L Y 29.23 965.5433 8 -1.2 483.7784 2 64.81 3 36126 AEV_3_3_RA3_01_1233.d 1.13E5 3 3 533 540
R.DANLNTLQSWTGMLDR.E Y 28.59 1833.8679 16 27.0 612.3131 3 79.30 2 40005 AEV_1_3_RA2_01_1232.d 2.79E5 1 1 2210 2225
K.GHT(+79.97)TAC(+57.02)R.I Y 28.40 881.3215 7 -88.6 882.2507 1 113.11 1 59654 AEV 2_3_RA2_01_1224.d 4.26E3 1 1 447 453 Phosphorylation (STY); Carbamidomethylation
K.GEWIFQSIGGTT(+79.97)K(-.98).I Y 28.26 1501.6967 13 -4.1 751.8525 2 44.47 3 22218 AEV_3_3_RA3_01_1233.d 5.33E4 1 1 1492 1504 Phosphorylation (STY); Amidation
R.ALEVFPR.A Y 27.77 830.4650 7 -90.6 416.2021 2 74.09 1 37157 AEV 2_3_RA2_01_1224.d 1.62E5 1 1 1205 1211
R.IKPVFTENR.N Y 27.71 1102.6134 9 -4.1 368.5436 3 42.43 3 20919 AEV_3_3_RA3_01_1233.d 3.21E5 2 2 1333 1341
K.WAYN(+.98)TFGDER(+14.02).A Y 27.70 1272.5411 10 -7.6 637.2730 2 59.02 1 25778 AEV 2_3_RA2_01_1224.d 8.71E4 1 1 77 86 Deamidation (NQ); Methylation(KR)
R.DIED(-18.01)LDDTEMVS(+79.97)R.I Y 27.54 1598.6171 13 -1.9 800.3143 2 81.87 1 43301 AEV 2_3_RA2_01_1224.d 0 1 1 1252 1264 Dehydration; Phosphorylation (STY)
K.LREENKDDIFGVIQ(+.98)TVLSHSK.V Y 27.17 2428.2598 21 21.8 608.0854 4 83.54 3 50699 AEV_3_3_RA3_01_1233.d 1.82E5 1 1 950 970 Deamidation (NQ)
K.G(-15.01)EWIFQSIGGTTK.I Y 26.84 1407.7034 13 -56.6 470.2152 3 52.65 1 21739 AEV 2_3_RA2_01_1224.d 1.6E6 5 5 1492 1504 ISD (z+2)-series
K.FTATR(+28.03).S Y 24.81 622.3439 5 -39.7 623.3264 1 80.69 3 48597 AEV_3_3_RA3_01_1233.d 5.34E4 1 1 627 631 Dimethylation(KR)
R.DIAYYPPAR.Q Y 24.81 1064.5291 9 -2.4 533.2705 2 61.80 3 33822 AEV_3_3_RA3_01_1233.d 2.28E5 2 2 1866 1874
K.GPESDKAVD(-18.01)K.R Y 24.65 1026.4982 10 -11.2 514.2506 2 28.77 2 10154 AEV_1_3_RA2_01_1232.d 4.6E5 1 1 1352 1361 Dehydration
K.LAELESR(+31.99).A Y 24.65 848.4240 7 6.4 425.2220 2 22.54 3 9188 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 1006 1012 Dihydroxy
K.DDIFGVIQTVLS(+162.05)HS(+79.97)K.V Y 24.52 1899.8866 15 40.9 381.0001 5 43.43 3 21553 AEV_3_3_RA3_01_1233.d 8.3E5 1 1 956 970 Hexose (NSY); Phosphorylation (STY)
K.L(+42.01)AGNAR.H Y 24.50 642.3449 6 -122.0 643.2738 1 84.41 1 45308 AEV 2_3_RA2_01_1224.d 8.12E4 1 1 287 292 Acetylation (N-term)
R.MAAAAPST(-18.01)TSR.N Y 24.11 1044.5022 11 31.5 523.2748 2 54.25 2 22625 AEV_1_3_RA2_01_1232.d 0 1 1 2175 2185 Dehydration
K.GEWIFQS(+79.97)IGGTTK(+21.98).I Y 23.96 1524.6626 13 -11.5 763.3298 2 94.81 1 53060 AEV 2_3_RA2_01_1224.d 0 1 1 1492 1504 Phosphorylation (STY); Sodium adduct
R.RDANLN(+162.05)TLQ(+.98)SWTGMLDR.E Y 23.95 2153.0059 17 -23.0 539.2463 4 80.43 1 42203 AEV 2_3_RA2_01_1224.d 1.22E5 1 1 2209 2225 Hexose (NSY); Deamidation (NQ)
K.QDEEGFLPGFFDK.D Y 23.71 1527.6881 13 -18.2 510.2274 3 40.37 1 14620 AEV 2_3_RA2_01_1224.d 3.33E5 2 2 1887 1899
K.EEAAAT(-18.01)R.L Y 23.69 728.3453 7 12.1 729.3614 1 78.24 3 46695 AEV_3_3_RA3_01_1233.d 1.27E5 3 3 673 679 Dehydration
K.TRKAE(+43.99)FPANQLMK.T Y 23.61 1576.8031 13 13.4 395.2133 4 19.61 3 7637 AEV_3_3_RA3_01_1233.d 8.52E4 1 1 866 878 Carboxylation (E)
R.LT(-18.01)FIC(+57.02)GHK.D Y 23.57 956.4902 8 -3.3 479.2508 2 60.02 3 32437 AEV_3_3_RA3_01_1233.d 9.58E4 1 1 1284 1291 Dehydration; Carbamidomethylation
K.R(+14.02)M(+15.99)AAAAPSTTSR(+14.02).N Y 23.56 1262.6401 12 10.5 632.3340 2 75.83 2 37257 AEV_1_3_RA2_01_1232.d 4.57E5 2 2 2174 2185 Methylation(KR); Oxidation (M)
K.GPESDK(+14.02)AVDK.R Y 23.43 1058.5244 10 -96.1 1059.4299 1 84.49 1 45370 AEV 2_3_RA2_01_1224.d 6.28E4 2 2 1352 1361 Methylation(KR)
R.YSEGL(+53.97)K.V Y 23.09 749.3207 6 -31.1 750.3046 1 112.20 1 59390 AEV 2_3_RA2_01_1224.d 1.65E5 1 1 910 915 Trifluoroleucine
R.Q(+43.01)ALQWK.N Y 23.02 815.4290 6 5.4 816.4407 1 86.29 3 52569 AEV_3_3_RA3_01_1233.d 0 1 1 2147 2152 Carbamylation
K.GVIIPVNYLDDAEEMLSR(+14.02).A Y 23.01 2047.0295 18 0.4 1024.5225 2 93.87 2 48923 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 1187 1204 Methylation(KR)
R.L(+42.01)RVT(+79.96)GAEIR.I Y 22.93 1135.5656 9 -13.6 379.5240 3 42.74 3 21124 AEV_3_3_RA3_01_1233.d 8.5E4 1 1 1445 1453 Acetylation (N-term); Sulfation
K.E(+43.01)TIRQALQWK.N Y 22.81 1314.7043 10 -31.6 439.2282 3 17.00 3 6206 AEV_3_3_RA3_01_1233.d 0 1 1 2143 2152 Carbamylation
K.LAELES(+79.97)RATSK(+43.01)VALKAR.E Y 22.81 1965.0408 17 4.9 492.2699 4 42.58 3 21018 AEV_3_3_RA3_01_1233.d 0 1 1 1006 1022 Phosphorylation (STY); Carbamylation
R.SLGDK.I N 22.56 518.2700 5 -98.7 519.2261 1 70.07 1 34012 AEV 2_3_RA2_01_1224.d 1.86E5 2 2 178 182
K.GPESDKAVD(-18.01)K(+42.01).R Y 22.45 1068.5087 10 -15.1 535.2535 2 53.01 3 27712 AEV_3_3_RA3_01_1233.d 5.51E4 1 1 1352 1361 Dehydration; Acetylation (K)
K.HMVVALKELSIR(+14.02)GD(+43.99)FR.T Y 22.30 1928.0302 16 1.5 483.0155 4 63.58 2 28281 AEV_1_3_RA2_01_1232.d 6.4E4 1 1 517 532 Methylation(KR); Carboxylation (DKW)
R.AESQ(+.98)KSSGSS(-18.01)ITLSLAALR.K Y 22.11 1887.9901 19 -8.5 630.3320 3 75.76 2 37202 AEV_1_3_RA2_01_1232.d 2.23E5 1 1 1212 1230 Deamidation (NQ); Dehydration
R.Y(-18.01)SEGLK(+42.01).V Y 22.09 719.3490 6 -58.5 720.3142 1 48.74 1 19488 AEV 2_3_RA2_01_1224.d 0 1 1 910 915 Dehydration; Acetylation (K)
K.VALWYEENK.K Y 22.07 1150.5658 9 -63.9 576.2534 2 60.98 1 27205 AEV 2_3_RA2_01_1224.d 0 1 1 2234 2242
R.NIH(+15.99)VYEAIGK.G Y 22.04 1158.6033 10 -13.1 387.2033 3 14.67 2 4215 AEV_1_3_RA2_01_1232.d 6.11E4 1 1 1342 1351 Oxidation (HW)
K.L(+53.97)GIPR.I N 22.02 608.3257 5 13.9 305.1744 2 27.35 2 9527 AEV_1_3_RA2_01_1232.d 0 1 1 1651 1655 Trifluoroleucine
R.M(+15.99)AAAAPSTT(-18.01)SR.N Y 22.01 1060.4971 11 3.9 354.5077 3 16.72 2 5084 AEV_1_3_RA2_01_1232.d 1.23E6 1 1 2175 2185 Oxidation (M); Dehydration
K.VDGVAVEVAQLLMGN(-17.03)K.D Y 21.98 1624.8494 16 -3.8 407.2181 4 61.84 2 27086 AEV_1_3_RA2_01_1232.d 4.86E4 1 1 2254 2269 Ammonia-loss (N)
K.ASEGGGGK(-.98).G Y 21.89 660.3191 8 -19.5 661.3135 1 67.54 3 38283 AEV_3_3_RA3_01_1233.d 0 1 1 248 255 Amidation
K.RMAAAAPSTTSR.N Y 21.63 1218.6139 12 1.6 610.3152 2 92.73 2 48475 AEV_1_3_RA2_01_1232.d 6.2E4 1 1 2174 2185
K.D(+42.01)GGLR(+14.02).G Y 21.56 572.2918 5 -92.9 573.2459 1 81.79 1 43235 AEV 2_3_RA2_01_1224.d 0 1 1 2270 2274 Acetylation (N-term); Methylation(KR)
R.ALEVFPRAESQKSSGSSITLSLAALR.K Y 21.55 2717.4712 26 -13.5 680.3659 4 79.61 3 47768 AEV_3_3_RA3_01_1233.d 0 1 1 1205 1230
K.GQVPSKDVLK.T Y 21.49 1069.6132 10 -30.7 535.7974 2 32.68 3 14970 AEV_3_3_RA3_01_1233.d 0 1 1 602 611
K.GC(+57.02)THSPQEGLEK.A Y 21.39 1341.5983 12 -7.0 448.2036 3 69.42 1 33502 AEV 2_3_RA2_01_1224.d 9.49E4 1 1 225 236 Carbamidomethylation
K.TVFPVDFIYE(+21.98)GFR.Y Y 21.36 1610.7744 13 4.0 806.3977 2 83.14 2 42983 AEV_1_3_RA2_01_1232.d 9.28E4 1 1 612 624 Sodium adduct
R.EPGTNTHGMVGWMITAR.T Y 21.15 1856.8662 17 -14.4 465.2172 4 106.63 3 61052 AEV_3_3_RA3_01_1233.d 0 1 1 1593 1609
R.S(+27.99)LGDK.I N 21.12 546.2649 5 -62.6 547.2380 1 25.96 1 6967 AEV 2_3_RA2_01_1224.d 0 1 1 178 182 Formylation
R.AHLSSEAC(+57.02)IAEYRK.G Y 21.11 1633.7882 14 -94.4 545.5519 3 63.49 1 29164 AEV 2_3_RA2_01_1224.d 5.45E4 1 1 584 597 Carbamidomethylation
K.VDGVAVEVAQLLMGNKDGGLR(+28.03).G Y 20.76 2168.1624 21 29.0 543.0636 4 83.32 2 43112 AEV_1_3_RA2_01_1232.d 0 1 1 2254 2274 Dimethylation(KR)
K.EEAAATR.L Y 20.66 746.3558 7 -17.3 747.3502 1 35.56 3 16666 AEV_3_3_RA3_01_1233.d 0 1 1 673 679
K.D(+42.01)GGLRGVQQVLS(+79.97)MLPVEER.E Y 20.59 2204.0659 19 -4.6 735.6925 3 83.26 2 43071 AEV_1_3_RA2_01_1232.d 9.32E4 1 1 2270 2288 Acetylation (N-term); Phosphorylation (STY)
R.GFS(+79.97)GGQR(+21.98).D Y 20.59 809.2833 7 -34.8 810.2625 1 3.18 2 739 AEV_1_3_RA2_01_1232.d 0 1 1 1991 1997 Phosphorylation (STY); Sodium adduct
R.TPSPGK(+58.01).L Y 20.47 643.3177 6 -8.0 644.3198 1 28.71 3 12641 AEV_3_3_RA3_01_1233.d 0 1 1 700 705 Carboxymethyl (KW, X@N-term)
K.FYFLELNPR.L Y 20.39 1197.6182 9 -23.3 400.2040 3 77.15 1 39572 AEV 2_3_RA2_01_1224.d 9.21E5 2 2 370 378
K.R(+42.01)MAAAAPSTTS(-18.01)R.N Y 20.39 1242.6139 12 1.9 622.3154 2 33.69 3 15554 AEV_3_3_RA3_01_1233.d 5.2E4 1 1 2174 2185 Acetylation (N-term); Dehydration
R.TPSPGKLVK(+42.01)YTVENGEHVK(+42.01).A Y 20.36 2166.1321 19 5.9 434.2362 5 62.58 3 34415 AEV_3_3_RA3_01_1233.d 0 1 1 700 718 Acetylation (K)
R.TPSPGK.L Y 20.27 585.3122 6 85.6 586.3696 1 28.47 2 10017 AEV_1_3_RA2_01_1232.d 5.57E4 3 3 700 705
R.N(+42.01)SAVPNITATSPSSPLKPATPS(+79.97)RR.D Y 20.20 2570.2854 24 -1.3 643.5778 4 69.71 3 40010 AEV_3_3_RA3_01_1233.d 3.09E5 1 1 2186 2209 Acetylation (N-term); Phosphorylation (STY)
K.N(+203.08)VITELVTEN(+.98)SEER.H Y 20.09 1835.8636 14 -30.3 459.9593 4 82.64 1 43898 AEV 2_3_RA2_01_1224.d 3.83E4 1 1 1710 1723 HexNAcylation (N); Deamidation (NQ)
K.YLGSP(-.98) Y 19.88 534.2802 5 -11.7 535.2812 1 40.65 3 19782 AEV_3_3_RA3_01_1233.d 0 1 1 2294 2298 Amidation
K.G(+42.01)EWIFQSIGGTT(+79.97)K(+42.01).I Y 19.78 1586.7018 13 39.6 529.9288 3 64.27 3 35706 AEV_3_3_RA3_01_1233.d 0 1 1 1492 1504 Acetylation (N-term); Phosphorylation (STY); Acetylation (K)
K.LPES(+79.97)LAASPK(+14.02).K Y 19.74 1105.5420 10 -81.8 369.4911 3 47.05 1 18508 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 155 164 Phosphorylation (STY); Methylation(KR)
K.FTATR.S Y 19.69 594.3126 5 1.6 595.3208 1 84.66 3 51464 AEV_3_3_RA3_01_1233.d 1.08E5 2 2 627 631
K.E(+42.01)EAAATR.L Y 19.66 788.3664 7 -77.8 789.3123 1 85.56 1 46233 AEV 2_3_RA2_01_1224.d 5.82E4 1 1 673 679 Acetylation (N-term)
K.GE(+53.92)WIFQSIGGTTK.I Y 19.57 1476.6335 13 -2.9 739.3219 2 48.94 3 25044 AEV_3_3_RA3_01_1233.d 1.45E5 2 2 1492 1504 Replacement of 2 protons by iron
R.AHLSSEAC(+57.02)IAEY(-18.01)R.K Y 19.57 1487.6826 13 -61.5 496.8710 3 72.06 1 35553 AEV 2_3_RA2_01_1224.d 1.52E5 1 1 584 596 Carbamidomethylation; Dehydration
K.A(+42.01)SEGGGGK(+42.01).G Y 19.49 745.3242 8 -18.0 746.3181 1 23.37 1 5873 AEV 2_3_RA2_01_1224.d 1.36E4 1 1 248 255 Acetylation (N-term); Acetylation (K)
K.ASEGGGGK(+42.01).G Y 19.43 703.3137 8 56.4 704.3606 1 79.00 2 39772 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 248 255 Acetylation (K)
R.SLGD(-18.01)K.I N 19.42 500.2594 5 -7.2 501.2631 1 30.78 2 11072 AEV_1_3_RA2_01_1232.d 0 1 1 178 182 Dehydration
K.VHEY(-18.01)K.V Y 19.41 656.3282 5 -13.9 329.1668 2 52.40 1 21599 AEV 2_3_RA2_01_1224.d 0 1 1 916 920 Dehydration
R.R(+42.01)DANLNTLQSW(+43.99)TGMLDR.E Y 19.41 2075.9695 17 -21.7 692.9821 3 48.64 3 24856 AEV_3_3_RA3_01_1233.d 2.27E5 2 2 2209 2225 Acetylation (N-term); Carboxylation (DKW)
K.SSGSSITLSLAALR.K Y 19.40 1361.7515 14 -16.4 681.8718 2 79.03 2 39793 AEV_1_3_RA2_01_1232.d 0 1 1 1217 1230
K.FLPADQLSK(+71.04).I Y 19.29 1088.5865 9 -11.6 545.2943 2 77.04 2 38214 AEV_1_3_RA2_01_1232.d 0 1 1 2098 2106 Propionamide (K, X@N-term)
R.MAAAAPSTTSR(+14.02).N Y 19.22 1076.5284 11 -11.6 539.2653 2 38.07 3 18240 AEV_3_3_RA3_01_1233.d 0 2 2 2175 2185 Methylation(KR)
R.MAAAAPSTT(+79.97)S(+79.97)R.N Y 19.17 1222.4454 11 26.7 612.2463 2 59.94 1 26434 AEV 2_3_RA2_01_1224.d 5.92E4 1 1 2175 2185 Phosphorylation (STY)
K.ISSISDMSYLVNK.G Y 19.12 1455.7279 13 -37.8 486.2316 3 69.89 1 33870 AEV 2_3_RA2_01_1224.d 0 1 1 1166 1178
K.A(+42.01)LNDK.F N 19.11 601.3071 5 36.6 602.3364 1 86.29 3 52571 AEV_3_3_RA3_01_1233.d 9.88E4 1 1 2093 2097 Acetylation (N-term)
K.IVQWMSFIPDK.K Y 19.03 1362.7006 11 -46.1 682.3262 2 90.44 1 49940 AEV 2_3_RA2_01_1224.d 1.55E5 1 1 1839 1849
K.DSFQETLAGWAR.T Y 19.00 1379.6470 12 42.8 345.9338 4 23.96 3 9979 AEV_3_3_RA3_01_1233.d 4.05E4 1 1 1900 1911
K.GIEK(+42.01)GQVPSK.D Y 18.91 1083.5924 10 7.5 362.2075 3 35.24 2 13184 AEV_1_3_RA2_01_1232.d 0 1 1 598 607 Acetylation (K)
R.EVLIQC(+57.02)ALPSLEER.V Y 18.81 1655.8552 14 -88.4 828.8617 2 84.64 1 45497 AEV 2_3_RA2_01_1224.d 4.77E4 1 1 1023 1036 Carbamidomethylation
K.EEAAAT(+79.96)R.L Y 18.79 826.3127 7 55.3 414.1865 2 31.97 1 10113 AEV 2_3_RA2_01_1224.d 0 1 1 673 679 Sulfation
R.S(+42.01)LGD(-18.01)K.I N 18.46 542.2700 5 -121.6 543.2114 1 66.71 1 31405 AEV 2_3_RA2_01_1224.d 7.66E4 1 1 178 182 Acetylation (N-term); Dehydration
K.YT(+79.97)VENGE(+21.98)HVK.A Y 18.43 1276.5101 10 -20.4 426.5020 3 33.44 1 10886 AEV 2_3_RA2_01_1224.d 1.22E5 1 1 709 718 Phosphorylation (STY); Sodium adduct
K.Y(+31.99)TVENGEHVK(+42.01).A Y 18.43 1248.5623 10 20.7 313.1543 4 65.17 1 30278 AEV 2_3_RA2_01_1224.d 0 1 1 709 718 Dihydroxy; Acetylation (K)
K.EVVDSK(+21.98).Y Y 18.41 697.3259 6 -66.0 698.2871 1 83.64 1 44702 AEV 2_3_RA2_01_1224.d 1.1E5 1 1 1070 1075 Sodium adduct
R.S(+43.01)LGDK.I N 18.37 561.2758 5 -2.0 562.2820 1 24.43 3 10247 AEV_3_3_RA3_01_1233.d 1.34E5 4 4 178 182 Carbamylation
R.MAAAAPS(+79.96)TTSR.N Y 18.36 1142.4696 11 22.5 381.8391 3 57.14 1 24513 AEV 2_3_RA2_01_1224.d 2.36E5 1 1 2175 2185 Sulfation
R.ALEVFPRAESQK(-.98).S Y 18.35 1372.7462 12 -4.3 344.1924 4 12.28 2 3329 AEV_1_3_RA2_01_1232.d 0 1 1 1205 1216 Amidation
R.L(+43.01)QVEHPTTEMVSGVN(+.98)LPAAQLQIAMGIPLHR.I Y 18.30 3393.7537 31 4.3 849.4493 4 83.28 3 50515 AEV_3_3_RA3_01_1233.d 1.9E5 1 1 379 409 Carbamylation; Deamidation (NQ)
K.Q(+.98)PGSTLEAGDILGILALDNPS(+79.97)R(+14.02).V Y 18.26 2331.1357 22 26.7 583.8068 4 73.22 2 35290 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 748 769 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
R.A(+42.01)LEVFPR.A Y 18.20 872.4756 7 -12.3 437.2397 2 65.13 3 36378 AEV_3_3_RA3_01_1233.d 7.9E4 1 1 1205 1211 Acetylation (N-term)
R.DANLN(+.98)T(-18.01)LQSWTGMLDR.E Y 18.17 1816.8414 16 -42.6 909.3893 2 83.67 1 44726 AEV 2_3_RA2_01_1224.d 1.73E5 1 1 2210 2225 Deamidation (NQ); Dehydration
K.FFHKC(+57.02)TELAR.K Y 18.16 1307.6444 10 -67.3 327.8964 4 54.40 1 22797 AEV 2_3_RA2_01_1224.d 1.88E5 1 1 1640 1649 Carbamidomethylation
R.EPDINVLK(+42.01)EVVDS(+79.97)K.Y Y 18.16 1705.8175 14 17.0 342.1766 5 26.33 3 11333 AEV_3_3_RA3_01_1233.d 0 1 1 1062 1075 Acetylation (K); Phosphorylation (STY)
K.VDGVAVEVAQ(+.98)LLMGN(+203.08)K.D Y 18.13 1845.9393 16 -48.2 616.2907 3 58.27 1 25281 AEV 2_3_RA2_01_1224.d 0 1 1 2254 2269 Deamidation (NQ); HexNAcylation (N)
R.AGRM(+15.99)K.A Y 18.02 577.3006 5 6.6 578.3117 1 43.55 2 17225 AEV_1_3_RA2_01_1232.d 0 1 1 2136 2140 Oxidation (M)
K.GEWIFQSIGGT(-18.01)TK(+42.01).I Y 17.93 1446.7144 13 0.1 483.2454 3 62.78 3 34563 AEV_3_3_RA3_01_1233.d 0 1 1 1492 1504 Dehydration; Acetylation (K)
R.EPGTNT(+79.97)HGMVGWMITAR.T Y 17.77 1936.8325 17 -42.2 969.3827 2 95.21 1 53270 AEV 2_3_RA2_01_1224.d 9.14E4 1 1 1593 1609 Phosphorylation (STY)
R.S(+79.97)LGDK.I N 17.67 598.2363 5 -40.3 599.2195 1 51.04 1 20790 AEV 2_3_RA2_01_1224.d 1.22E4 1 1 178 182 Phosphorylation (STY)
K.S(+79.97)S(+79.97)GSSITLSLAALRK(+42.01)PTPR.V Y 17.66 2143.0439 19 23.2 536.7807 4 77.93 3 46447 AEV_3_3_RA3_01_1233.d 0 1 1 1217 1235 Phosphorylation (STY); Acetylation (K)
R.M(+15.99)AAAAPS(+79.97)TTSR.N Y 17.62 1158.4740 11 19.4 580.2555 2 63.25 1 28972 AEV 2_3_RA2_01_1224.d 8.28E4 1 1 2175 2185 Oxidation (M); Phosphorylation (STY)
R.GSGLIAGATSK(+21.98)(+14.02).A Y 17.58 996.5215 11 11.7 499.2739 2 15.42 3 5375 AEV_3_3_RA3_01_1233.d 0 1 1 1743 1753 Sodium adduct; Methylation(KR)
R.K(+42.01)GVIIPVNY(+79.97)LDDAEEMLSRALEVFPR.A Y 17.51 3095.5403 26 -12.6 1032.8411 3 87.01 3 52989 AEV_3_3_RA3_01_1233.d 1.15E6 2 2 1186 1211 Acetylation (N-term); Phosphorylation (STY)
K.IVQWMSFIPDK(+42.02).K Y 17.51 1404.7224 11 10.8 469.2531 3 68.56 3 39102 AEV_3_3_RA3_01_1233.d 0 1 1 1839 1849 Guanidination
K.FY(+15.01)FLELNPR.L Y 17.47 1212.6292 9 -12.0 607.3146 2 77.58 3 46171 AEV_3_3_RA3_01_1233.d 0 1 1 370 378 Tyrosine oxidation to 2-aminotyrosine
R.GFSGGQR.D Y 17.42 707.3351 7 113.3 708.4225 1 101.92 1 56347 AEV 2_3_RA2_01_1224.d 3.36E5 1 1 1991 1997
K.L(+27.99)AGNAR.H Y 17.37 628.3292 6 -21.3 629.3231 1 73.78 3 43178 AEV_3_3_RA3_01_1233.d 0 1 1 287 292 Formylation
R.LRVTGAEIR.I Y 17.26 1013.5981 9 8.4 338.8762 3 33.15 2 12191 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 1445 1453
R.SLGD(-18.01)K(+14.02).I N 17.25 514.2751 5 -57.7 515.2527 1 82.64 1 43897 AEV 2_3_RA2_01_1224.d 0 1 1 178 182 Dehydration; Methylation(KR)
R.VTGAEIR.I Y 17.24 744.4130 7 -29.3 373.2029 2 15.08 2 4370 AEV_1_3_RA2_01_1232.d 0 1 1 1447 1453
R.GVQQVLSM(+15.99)LPVEER(+14.02).E Y 17.23 1613.8446 14 38.6 404.4840 4 55.70 3 29378 AEV_3_3_RA3_01_1233.d 2.44E6 1 1 2275 2288 Oxidation (M); Methylation(KR)
K.AS(-18.01)EEHSSLADK.R Y 17.17 1154.5204 11 -57.8 1155.4609 1 112.04 1 59342 AEV 2_3_RA2_01_1224.d 0 1 1 1556 1566 Dehydration
K.FLPADQ(+.98)LSK.I Y 17.16 1018.5334 9 -93.6 510.2263 2 81.28 1 42840 AEV 2_3_RA2_01_1224.d 0 1 1 2098 2106 Deamidation (NQ)
R.DANLNT(+79.97)LQSWTGMLDR(+28.03).E Y 17.05 1941.8656 16 8.8 648.3015 3 65.81 3 36918 AEV_3_3_RA3_01_1233.d 0 1 1 2210 2225 Phosphorylation (STY); Dimethylation(KR)
R.T(+42.01)PS(-18.01)PGK.L Y 17.03 609.3122 6 -31.5 610.3003 1 27.08 3 11751 AEV_3_3_RA3_01_1233.d 0 1 1 700 705 Acetylation (N-term); Dehydration
K.ASEEHS(+79.97)S(+79.97)LADK.R Y 16.96 1332.4636 11 148.6 334.1727 4 61.04 1 27247 AEV 2_3_RA2_01_1224.d 0 1 1 1556 1566 Phosphorylation (STY)
R.IYLSANSGAR(+14.02).I Y 16.94 1064.5614 10 -38.6 533.2675 2 54.94 2 22984 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 1656 1665 Methylation(KR)
K.LAELESRATS(+79.97)KVALK(+42.01).A Y 16.90 1736.9073 15 9.2 435.2381 4 70.11 3 40314 AEV_3_3_RA3_01_1233.d 1.42E5 1 1 1006 1020 Phosphorylation (STY); Acetylation (K)
R.MPQKLDS(+79.97)LLAQVVDRAK(+42.01).T Y 16.84 2033.0380 17 13.0 509.2734 4 76.59 2 37859 AEV_1_3_RA2_01_1232.d 1.11E5 1 1 849 865 Phosphorylation (STY); Acetylation (K)
K.EVVDSK.Y Y 16.80 675.3439 6 -86.3 676.2928 1 97.07 1 54421 AEV 2_3_RA2_01_1224.d 0 1 1 1070 1075
R.ATSK(+42.01)VALK.A Y 16.65 858.5175 8 -11.1 430.2612 2 32.67 3 14965 AEV_3_3_RA3_01_1233.d 0 1 1 1013 1020 Acetylation (K)
K.IVQW(+15.99)MSFIPDK(+14.02).K Y 16.65 1392.7112 11 -2.4 697.3612 2 73.45 3 42942 AEV_3_3_RA3_01_1233.d 1.61E5 1 1 1839 1849 Oxidation (HW); Methylation(KR)
K.LDSLLAQ(+.98)VVDRAKTR.K Y 16.62 1684.9471 15 6.7 422.2469 4 63.15 3 34857 AEV_3_3_RA3_01_1233.d 0 1 1 853 867 Deamidation (NQ)
K.EEAAATR(+.98).L Y 16.62 747.3398 7 8.5 748.3535 1 98.45 3 58534 AEV_3_3_RA3_01_1233.d 3.32E4 1 1 673 679 Deamidation (R)
K.YLYLTPEVK(+108.02).K Y 16.61 1232.6328 9 12.3 309.1693 4 17.81 3 6664 AEV_3_3_RA3_01_1233.d 7.71E5 1 1 1692 1700 HydroxymethylOP
K.LAELESR.A Y 16.60 816.4341 7 -99.8 409.1836 2 45.72 1 17684 AEV 2_3_RA2_01_1224.d 7.34E5 1 1 1006 1012
K.LPESLAASPK.K Y 16.58 1011.5600 10 -19.8 338.1873 3 44.14 3 22012 AEV_3_3_RA3_01_1233.d 1.66E5 2 2 155 164
K.KLAELES(+162.05)R.A Y 16.53 1106.5818 8 -36.3 554.2781 2 33.81 3 15620 AEV_3_3_RA3_01_1233.d 0 1 1 1005 1012 Hexose (NSY)
R.SLGD(+43.99)K.I N 16.50 562.2598 5 -36.7 563.2465 1 49.75 1 20112 AEV 2_3_RA2_01_1224.d 0 1 1 178 182 Carboxylation (DKW)
R.MAAAAPSTT(-18.01)SR(+14.02).N Y 16.49 1058.5178 11 38.4 530.2865 2 58.58 3 31352 AEV_3_3_RA3_01_1233.d 0 1 1 2175 2185 Dehydration; Methylation(KR)
K.ASEGGGGK(+21.98).G Y 16.48 683.2850 8 -48.7 684.2590 1 65.93 1 30819 AEV 2_3_RA2_01_1224.d 7.13E4 1 1 248 255 Sodium adduct
K.TC(+57.02)LLEEEN(+162.05)DPT(+79.97)QLR.T Y 16.42 1958.8180 14 0.8 490.7122 4 77.58 1 39921 AEV 2_3_RA2_01_1224.d 0 1 1 686 699 Carbamidomethylation; Hexose (NSY); Phosphorylation (STY)
R.AESQK(+21.98).S N 16.40 583.2578 5 6.9 584.2690 1 18.90 2 5971 AEV_1_3_RA2_01_1232.d 3.98E4 1 1 1212 1216 Sodium adduct
R.T(+42.01)PSPGK.L Y 16.36 627.3228 6 -36.3 628.3073 1 38.75 1 13686 AEV 2_3_RA2_01_1224.d 6.95E4 1 1 700 705 Acetylation (N-term)
K.Y(-18.01)LGSP Y 16.29 517.2536 5 -7.7 518.2569 1 54.65 3 28782 AEV_3_3_RA3_01_1233.d 0 1 1 2294 2298 Dehydration
R.AHLSS(+79.97)EACIAEYR.K Y 16.27 1528.6381 13 -15.0 510.5457 3 55.31 1 23364 AEV 2_3_RA2_01_1224.d 0 1 1 584 596 Phosphorylation (STY)
R.AESQK.S N 16.21 561.2758 5 -108.9 562.2220 1 58.61 1 25511 AEV 2_3_RA2_01_1224.d 7.71E3 1 1 1212 1216
R.EVYTSNLQ(+.98)LGGTQIMYK(+42.01).N Y 16.18 1986.9608 17 2.1 663.3289 3 74.04 3 43378 AEV_3_3_RA3_01_1233.d 2.93E4 1 1 1805 1821 Deamidation (NQ); Acetylation (K)
R.GVQQVLSM(+15.99)LPVEER.E Y 16.18 1599.8290 14 -24.7 534.2704 3 59.20 2 25366 AEV_1_3_RA2_01_1232.d 1.8E4 1 1 2275 2288 Oxidation (M)
K.T(+42.01)VFPVDFIYEGFR(-.98).Y Y 16.18 1629.8191 13 -14.7 408.4561 4 76.58 1 39115 AEV 2_3_RA2_01_1224.d 0 1 1 612 624 Acetylation (N-term); Amidation
R.L(+43.01)TFIC(+57.02)GHK.D Y 16.07 1017.5066 8 -50.5 340.1590 3 49.94 1 20213 AEV 2_3_RA2_01_1224.d 0 1 1 1284 1291 Carbamylation; Carbamidomethylation
K.K(+42.01)ISSISDMSYLVNK.G Y 16.06 1625.8335 14 -12.4 542.9451 3 65.84 2 29839 AEV_1_3_RA2_01_1232.d 0 1 1 1165 1178 Acetylation (N-term)
R.SLGDK(+71.04).I N 16.02 589.3071 5 -20.9 590.3021 1 69.84 2 32728 AEV_1_3_RA2_01_1232.d 2.31E3 1 1 178 182 Propionamide (K, X@N-term)
K.LDSLLAQ(+.98)VVDR.A Y 16.00 1228.6663 11 -43.2 615.3138 2 62.83 3 34602 AEV_3_3_RA3_01_1233.d 4.7E4 1 1 853 863 Deamidation (NQ)
K.IVQWMSFIPDK(+42.01)K(+42.01).N Y 15.98 1574.8167 12 -2.5 525.9448 3 32.93 2 12090 AEV_1_3_RA2_01_1232.d 0 1 1 1839 1850 Acetylation (K)
K.GEWIFQSIGGTT(-18.01)K(+42.01).I Y 15.97 1446.7144 13 21.5 362.6936 4 54.42 2 22710 AEV_1_3_RA2_01_1232.d 9.62E4 1 1 1492 1504 Dehydration; Acetylation (K)
R.AHLSS(-2.02)EAC(+57.02)IAEYR.K Y 15.92 1503.6776 13 80.8 502.2737 3 57.39 3 30505 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 584 596 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.Q(+.98)AFQN(+.98)C(+57.02)WTK(+14.02).A Y 15.92 1197.5125 9 24.8 400.1880 3 72.29 1 35742 AEV 2_3_RA2_01_1224.d 9.92E4 1 1 1547 1555 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
R.L(+43.01)SVDGK.T Y 15.84 660.3442 6 -82.7 331.1521 2 63.11 1 28863 AEV 2_3_RA2_01_1224.d 3.05E5 1 1 680 685 Carbamylation
K.W(+71.04)AYNTFGDER.A Y 15.81 1328.5785 10 -29.8 333.1420 4 58.24 1 25256 AEV 2_3_RA2_01_1224.d 0 1 1 77 86 Propionamide (K, X@N-term)
K.A(+42.01)SEGGGGK(+14.02)GIR.K Y 15.79 1043.5359 11 -47.4 1044.4937 1 106.33 1 57700 AEV 2_3_RA2_01_1224.d 0 1 1 248 258 Acetylation (N-term); Methylation(KR)
K.FYFLELNPR(+14.02).L Y 15.67 1211.6338 9 0.6 404.8855 3 38.54 3 18529 AEV_3_3_RA3_01_1233.d 0 1 1 370 378 Methylation(KR)
K.F(+42.01)YFLELNPR.L Y 15.58 1239.6288 9 -5.5 414.2146 3 42.45 3 20935 AEV_3_3_RA3_01_1233.d 1.48E5 1 1 370 378 Acetylation (N-term)
K.LPES(+79.97)LAASPKK.I Y 15.49 1219.6213 11 4.6 407.5496 3 24.59 2 8306 AEV_1_3_RA2_01_1232.d 4.16E5 1 1 155 165 Phosphorylation (STY)
R.MAAAAPS(+162.05)TTS(+79.97)R.N Y 15.44 1304.5319 11 -20.4 653.2599 2 51.34 1 20956 AEV 2_3_RA2_01_1224.d 3.13E4 1 1 2175 2185 Hexose (NSY); Phosphorylation (STY)
K.NGVSHMTAND(+43.99)DFEGIQK.I Y 15.43 1905.8163 17 8.0 477.4651 4 70.41 1 34276 AEV 2_3_RA2_01_1224.d 4.52E5 1 1 1822 1838 Carboxylation (DKW)
R.A(+42.01)IQFTVMAT(-18.01)PEDLR.A Y 15.40 1614.8075 14 5.4 539.2794 3 45.29 2 18079 AEV_1_3_RA2_01_1232.d 0 1 1 87 100 Acetylation (N-term); Dehydration
K.VHE(+14.02)YK.V Y 15.37 688.3544 5 -72.7 345.1595 2 35.21 1 11801 AEV 2_3_RA2_01_1224.d 1.86E5 1 1 916 920 Methylation(others)
K.GVN(+.98)EPMR.K Y 15.32 802.3643 7 -54.5 402.1676 2 21.85 1 5333 AEV 2_3_RA2_01_1224.d 2.98E4 1 1 1179 1185 Deamidation (NQ)
M(+226.08)GVTDTPATATNGFGSSFAAK.H Y 15.20 2256.0190 21 42.4 452.2302 5 13.39 3 4249 AEV_3_3_RA3_01_1233.d 0 1 1 1 21 Biotinylation
K.IGS(+79.96)MHLRPVSTPYPTK.E Y 15.16 1862.9019 16 25.9 932.4823 2 95.61 2 49550 AEV_1_3_RA2_01_1232.d 0 1 1 1505 1520 Sulfation
R.TPSPGK(+42.01).L Y 15.15 627.3228 6 3.2 628.3320 1 75.68 3 44667 AEV_3_3_RA3_01_1233.d 4.17E4 1 1 700 705 Acetylation (K)
K.V(+27.99)DGVAVEVAQLLMGN(+.98)K.D Y 15.15 1670.8549 16 -7.6 836.4283 2 88.26 3 53748 AEV_3_3_RA3_01_1233.d 7E4 1 1 2254 2269 Formylation; Deamidation (NQ)
R.EPDINVLK(+42.01).E Y 15.14 968.5178 8 -78.1 485.2284 2 75.56 1 38319 AEV 2_3_RA2_01_1224.d 5.44E4 1 1 1062 1069 Acetylation (K)
R.M(+15.99)AAAAPS(-18.01)TTSR.N Y 15.13 1060.4971 11 14.8 531.2637 2 25.62 2 8775 AEV_1_3_RA2_01_1232.d 3.62E4 1 1 2175 2185 Oxidation (M); Dehydration
R.HLEVQLLAD(+6.01)QYGNNISLFGR.D Y 15.07 2292.1838 20 -4.4 765.0652 3 84.25 3 51196 AEV_3_3_RA3_01_1233.d 0 1 1 293 312 Replacement of proton by lithium
K.GPES(+79.97)DKAVDK(+226.08).R Y 15.05 1350.5526 10 28.3 451.2042 3 63.13 1 28879 AEV 2_3_RA2_01_1224.d 1.25E5 1 1 1352 1361 Phosphorylation (STY); Biotinylation
R.AVVRPGR.L Y 15.02 753.4609 7 -0.6 377.7375 2 12.95 3 4014 AEV_3_3_RA3_01_1233.d 3.87E4 1 1 1367 1373
K.L(+43.01)PESLAASPK.K Y 15.02 1054.5658 10 -22.0 528.2786 2 16.17 2 4819 AEV_1_3_RA2_01_1232.d 3.49E3 1 1 155 164 Carbamylation
total 223 peptides
C1G6T3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.ASKWYPTEDEPQPK.K Y 130.10 1674.7889 14 3.6 559.2723 3 57.62 2 24427 AEV_1_3_RA2_01_1232.d 1.08E6 8 8 28 41
K.VDLTGIDDKVLEKASESEYFTR.E Y 123.89 2514.2488 22 7.0 629.5739 4 80.42 2 40893 AEV_1_3_RA2_01_1232.d 5.54E5 4 4 113 134
R.ASLQPGTILILLAGR.F Y 117.82 1521.9242 15 1.3 761.9703 2 89.90 2 47189 AEV_1_3_RA2_01_1232.d 2.6E6 7 7 54 68
R.YVIATSSKVDLTGIDDK.V Y 107.51 1823.9517 17 -4.2 608.9886 3 70.91 3 40933 AEV_3_3_RA3_01_1233.d 1.86E5 2 2 105 121
K.HLPQGVLLVTGPFK.L Y 104.41 1504.8766 14 3.9 502.6348 3 79.05 2 39800 AEV_1_3_RA2_01_1232.d 1.32E6 6 6 79 92
K.WYPTEDEPQPK.K Y 102.43 1388.6248 11 2.8 695.3216 2 62.35 2 27470 AEV_1_3_RA2_01_1232.d 2.07E6 9 9 31 41
K.HLPQGVLLVTGPFKLNGVPLRR.V Y 101.56 2410.4324 22 4.1 483.0957 5 79.67 3 47821 AEV_3_3_RA3_01_1233.d 1.86E5 1 1 79 100
K.AIDRPLLATIKKEQFLASYLSTSFSLR.K Y 100.30 3067.7070 27 0.4 614.5490 5 86.90 3 52945 AEV_3_3_RA3_01_1233.d 4.25E5 2 2 168 194
K.HLPQGVLLVTGPFKLNGVPLR.R Y 95.79 2254.3313 21 -11.5 564.5836 4 82.52 3 49966 AEV_3_3_RA3_01_1233.d 1.39E5 2 2 79 99
R.ASLQPGTILILLAGRFR.G Y 92.72 1825.0938 17 4.4 609.3745 3 90.07 3 54750 AEV_3_3_RA3_01_1233.d 1.56E5 2 2 54 70
K.VDLTGIDDKVLEK.A Y 89.18 1443.7820 13 -3.1 722.8961 2 71.28 3 41230 AEV_3_3_RA3_01_1233.d 8.19E5 6 6 113 125
K.ASKWYPTEDEPQPKK.V Y 88.36 1802.8838 15 -0.2 601.9684 3 45.73 3 23009 AEV_3_3_RA3_01_1233.d 7.29E4 1 1 28 42
K.ASKWYPTEDEPQPK(+14.02).K Y 86.59 1688.8046 14 -2.4 563.9408 3 60.10 3 32491 AEV_3_3_RA3_01_1233.d 1.81E5 1 1 28 41 Methylation(KR)
K.ASKWYPTEDE(+14.02)PQPK.K Y 83.76 1688.8046 14 0.0 563.9421 3 61.94 3 33920 AEV_3_3_RA3_01_1233.d 2.45E5 1 1 28 41 Methylation(others)
K.ASESEYFTR.E Y 83.40 1088.4774 9 11.0 545.2520 2 46.34 3 23480 AEV_3_3_RA3_01_1233.d 4.58E6 12 12 126 134
K.EQFLASYLSTSFSLR.K Y 83.37 1747.8781 15 -0.6 874.9457 2 86.82 3 52884 AEV_3_3_RA3_01_1233.d 3.94E5 2 2 180 194
K.TIHPAKPR.A Y 82.07 918.5399 8 -16.0 460.2699 2 11.89 3 3467 AEV_3_3_RA3_01_1233.d 2.2E6 13 13 46 53
R.KTIHPAKPR.A Y 80.08 1046.6349 9 -6.3 524.3214 2 10.66 3 2861 AEV_3_3_RA3_01_1233.d 5.71E5 4 4 45 53
K.ASESEYFTREK.K Y 77.46 1345.6150 11 1.6 673.8159 2 37.65 3 17980 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 126 136
K.HLPQGVLLVTGPFKLN(+.98)GVPLR.R Y 70.17 2255.3154 21 -1.3 564.8354 4 83.53 3 50688 AEV_3_3_RA3_01_1233.d 5.2E4 1 1 79 99 Deamidation (NQ)
R.YVIATSSK.V Y 69.05 867.4702 8 -0.5 434.7421 2 31.33 3 14157 AEV_3_3_RA3_01_1233.d 1.82E6 6 6 105 112
R.YVIATSSKVDLTGIDDKVLEKASESEYFTR.E Y 68.36 3363.7085 30 -2.6 841.9323 4 80.26 3 48271 AEV_3_3_RA3_01_1233.d 2.28E5 2 2 105 134
M.S(+42.01)ATLDSKSVGQTK.K Y 65.52 1362.6991 13 -9.9 682.3501 2 42.88 3 21244 AEV_3_3_RA3_01_1233.d 2.81E5 3 3 2 14 Acetylation (Protein N-term)
R.ASLQ(+.98)PGTILILLAGR.F Y 64.35 1522.9082 15 -30.4 762.4382 2 90.80 2 47620 AEV_1_3_RA2_01_1232.d 5.08E4 2 2 54 68 Deamidation (NQ)
K.ASK(+31.99)WYPTEDEPQPK.K Y 61.70 1706.7787 14 5.4 569.9366 3 41.27 2 16084 AEV_1_3_RA2_01_1232.d 1.43E5 2 2 28 41 Dihydroxy
K.KGEEAFFK.Q Y 59.87 954.4810 8 0.7 478.2481 2 39.07 3 18840 AEV_3_3_RA3_01_1233.d 1.71E6 9 9 141 148
K.WYPTEDEPQPK(+14.02).K Y 59.32 1402.6405 11 -0.4 702.3273 2 64.78 3 36104 AEV_3_3_RA3_01_1233.d 1.64E5 2 2 31 41 Methylation(KR)
R.ASLQPGTILILLAGRFRGK.R Y 58.89 2010.2102 19 -1.2 503.5592 4 86.61 3 52779 AEV_3_3_RA3_01_1233.d 3.84E4 1 1 54 72
K.HLPQGVLLVTGPFKLN(+.98)GVPLRR.V Y 58.87 2411.4165 22 2.3 483.2917 5 81.13 2 41454 AEV_1_3_RA2_01_1232.d 7.99E4 1 1 79 100 Deamidation (NQ)
K.AIDRPLLATIK.K Y 58.08 1209.7445 11 8.2 404.2588 3 66.84 2 30537 AEV_1_3_RA2_01_1232.d 1.34E5 1 1 168 178
R.ASLQPGTILILLAGR(+14.02).F Y 57.97 1535.9398 15 9.8 768.9847 2 91.01 3 55275 AEV_3_3_RA3_01_1233.d 1.33E5 3 3 54 68 Methylation(KR)
M.S(+42.01)ATLDSKSVGQTKK.F Y 56.88 1490.7939 14 6.0 497.9416 3 32.02 3 14581 AEV_3_3_RA3_01_1233.d 1.78E5 3 3 2 15 Acetylation (Protein N-term)
K.VDLTGIDDK.V Y 55.05 974.4920 9 2.0 488.2543 2 60.39 2 26128 AEV_1_3_RA2_01_1232.d 6.61E5 4 4 113 121
K.ASESEYFTR(+14.02).E Y 54.93 1102.4930 9 2.0 552.2549 2 54.71 3 28817 AEV_3_3_RA3_01_1233.d 2.03E5 3 3 126 134 Methylation(KR)
K.ASE(+14.02)SEYFTREK.K Y 53.21 1359.6306 11 3.4 680.8249 2 51.34 3 26600 AEV_3_3_RA3_01_1233.d 1.32E5 1 1 126 136 Methylation(others)
K.WYPTE(+14.02)DEPQPK.K Y 52.48 1402.6405 11 4.2 702.3305 2 65.74 2 29768 AEV_1_3_RA2_01_1232.d 3.25E5 3 3 31 41 Methylation(others)
K.HLPQGVLLVTGPFK(+14.02).L Y 51.79 1518.8922 14 -50.6 507.2791 3 79.89 3 47982 AEV_3_3_RA3_01_1233.d 0 1 1 79 92 Methylation(KR)
K.ASKW(+15.99)YPTEDEPQPK.K Y 51.69 1690.7838 14 -1.2 564.6012 3 53.28 3 27903 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 28 41 Oxidation (HW)
K.ASE(+14.02)SEYFTR.E Y 50.35 1102.4930 9 13.4 552.2612 2 59.93 3 32388 AEV_3_3_RA3_01_1233.d 3.78E5 2 2 126 134 Methylation(others)
K.WYPTEDEPQPKK.V Y 49.96 1516.7197 12 -8.9 506.5760 3 52.43 3 27328 AEV_3_3_RA3_01_1233.d 2.08E5 2 2 31 42
K.KAEKKGEEAFFK.Q Y 48.36 1410.7506 12 -1.7 706.3813 2 24.14 3 10079 AEV_3_3_RA3_01_1233.d 1.99E4 1 1 137 148
K.WYPTEDEPQ(+.98)PK.K Y 47.82 1389.6088 11 11.7 695.8198 2 61.76 3 33786 AEV_3_3_RA3_01_1233.d 4.64E5 4 4 31 41 Deamidation (NQ)
K.VLEKASESEYFTR.E Y 45.13 1557.7675 13 -5.2 520.2604 3 59.55 3 32075 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 122 134
K.LNGVPLR.R Y 43.96 767.4653 7 -66.8 384.7143 2 62.32 1 28247 AEV 2_3_RA2_01_1224.d 3.19E6 5 5 93 99
K.AIDRPLLATIKKEQFLASYLSTSFSLRK.G Y 43.83 3195.8018 28 15.0 640.1772 5 84.59 3 51423 AEV_3_3_RA3_01_1233.d 0 1 1 168 195
K.ASESEYFTR(+.98).E Y 42.23 1089.4614 9 18.4 545.7480 2 46.90 3 23750 AEV_3_3_RA3_01_1233.d 2.23E5 1 1 126 134 Deamidation (R)
K.ASESE(+14.02)YFTR.E Y 41.34 1102.4930 9 0.6 552.2542 2 53.10 3 27767 AEV_3_3_RA3_01_1233.d 5.11E5 3 3 126 134 Methylation(others)
K.HLPQ(+.98)GVLLVTGPFK.L Y 39.68 1505.8606 14 7.1 502.9644 3 80.30 2 40803 AEV_1_3_RA2_01_1232.d 5.51E4 1 1 79 92 Deamidation (NQ)
R.Y(+41.03)VIATSSK.V Y 35.43 908.4967 8 -18.3 455.2473 2 31.27 3 14132 AEV_3_3_RA3_01_1233.d 0 1 1 105 112 Amidination of lysines or N-terminal amines with methyl acetimidate
K.AIDRPLLATIKK.E Y 33.68 1337.8394 12 -0.2 335.4670 4 59.09 3 31754 AEV_3_3_RA3_01_1233.d 6.58E5 2 2 168 179
R.ASLQPGTILILLAGRFRGKR.V Y 33.53 2166.3113 20 14.2 542.5928 4 83.83 3 50895 AEV_3_3_RA3_01_1233.d 1.12E5 2 2 54 73
K.ASKWYPTEDEPQ(+.98)PK.K Y 32.58 1675.7729 14 14.5 559.6064 3 57.74 2 24498 AEV_1_3_RA2_01_1232.d 7.01E4 1 1 28 41 Deamidation (NQ)
R.YVIATSSK(+14.02).V Y 32.18 881.4858 8 -92.4 441.7095 2 55.80 1 23693 AEV 2_3_RA2_01_1224.d 1.62E5 1 1 105 112 Methylation(KR)
K.WYPTEDEPQP(+13.98)K.K Y 31.61 1402.6041 11 -62.3 702.2656 2 71.11 1 34808 AEV 2_3_RA2_01_1224.d 1.97E5 1 1 31 41 Proline oxidation to pyroglutamic acid
K.KGEEAFFKQGEKPEK.K Y 31.32 1750.8889 15 3.6 438.7311 4 35.38 3 16561 AEV_3_3_RA3_01_1233.d 5.5E5 2 2 141 155
K.W(+31.99)YPTEDEPQPK.K Y 30.71 1420.6146 11 23.6 711.3314 2 52.78 3 27567 AEV_3_3_RA3_01_1233.d 1.58E5 2 2 31 41 Dihydroxy
K.WYPTED(+14.02)EPQPK.K Y 30.57 1402.6405 11 0.6 702.3279 2 65.19 3 36424 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 31 41 Methylation(others)
R.TIPSQK.A Y 29.28 672.3806 6 -46.8 673.3564 1 75.77 2 37210 AEV_1_3_RA2_01_1232.d 0 1 1 22 27
K.ASK(+14.02)W(+15.99)YPTEDEPQPK.K Y 29.26 1704.7994 14 58.4 569.3069 3 39.81 3 19290 AEV_3_3_RA3_01_1233.d 0 1 1 28 41 Methylation(KR); Oxidation (HW)
R.VVLLK.H N 29.24 570.4105 5 -89.5 571.3667 1 60.75 1 27038 AEV 2_3_RA2_01_1224.d 6.88E4 1 1 74 78
K.AIDRPLLATIK(+14.02)KEQFLASYLSTSFSLR.K Y 28.96 3081.7227 27 -4.7 617.3489 5 92.18 3 55885 AEV_3_3_RA3_01_1233.d 9.13E4 1 1 168 194 Methylation(KR)
R.KT(-18.01)IHPAKPR.A Y 28.08 1028.6243 9 -2.8 515.3180 2 10.81 3 2909 AEV_3_3_RA3_01_1233.d 1.66E4 1 1 45 53 Dehydration
K.LNGVPLRR.V Y 28.06 923.5665 8 0.6 462.7908 2 39.82 2 15378 AEV_1_3_RA2_01_1232.d 5E5 3 3 93 100
R.VNARY(-18.01)VIAT(+79.97)SSK.V Y 25.68 1369.6755 12 -5.6 457.5632 3 59.22 2 25378 AEV_1_3_RA2_01_1232.d 1.48E5 1 1 101 112 Dehydration; Phosphorylation (STY)
K.SVGQ(+.98)T(+79.97)K.K Y 25.13 699.2840 6 13.9 700.3010 1 44.66 1 17133 AEV 2_3_RA2_01_1224.d 0 1 1 9 14 Deamidation (NQ); Phosphorylation (STY)
K.WYPTEDE(+14.02)PQPK.K Y 24.36 1402.6405 11 9.8 702.3344 2 67.70 2 31152 AEV_1_3_RA2_01_1232.d 4.09E4 1 1 31 41 Methylation(others)
K.KFGKGER.T Y 24.09 820.4555 7 2.1 411.2359 2 9.51 3 2355 AEV_3_3_RA3_01_1233.d 3.11E4 1 1 15 21
K.SVGQTK(-2.02).K Y 23.74 616.3181 6 -3.2 617.3234 1 70.50 2 33220 AEV_1_3_RA2_01_1232.d 1.35E4 1 1 9 14 2-amino-3-oxo-butanoic_acid
K.LN(+.98)GVPLR.R Y 22.55 768.4493 7 -114.2 385.1880 2 61.98 1 27981 AEV 2_3_RA2_01_1224.d 1.39E5 6 6 93 99 Deamidation (NQ)
K.LN(-17.03)GVPLRR.V Y 22.54 906.5399 8 -2.9 454.2759 2 62.19 3 34109 AEV_3_3_RA3_01_1233.d 4.54E5 2 2 93 100 Ammonia-loss (N)
K.FGKGER.T Y 22.25 692.3605 6 22.4 347.1953 2 9.40 2 2291 AEV_1_3_RA2_01_1232.d 0 1 1 16 21
K.GEEAFFKQGEKPEKK.K Y 21.86 1750.8889 15 3.6 438.7311 4 34.96 3 16312 AEV_3_3_RA3_01_1233.d 3.52E5 1 1 142 156
MS(-18.01)ATLDSK.S Y 21.78 833.3953 8 -92.7 834.3253 1 88.24 1 48296 AEV 2_3_RA2_01_1224.d 1.56E5 1 1 1 8 Dehydration
K.KGE(+14.02)EAFFK.Q Y 21.57 968.4967 8 -0.5 485.2554 2 52.26 3 27225 AEV_3_3_RA3_01_1233.d 0 1 1 141 148 Methylation(others)
K.KVVSARAND(-18.01)QK.A Y 21.30 1196.6625 11 -27.4 1197.6370 1 102.56 1 56566 AEV 2_3_RA2_01_1224.d 0 1 1 157 167 Dehydration
K.TIHPAKPR(+14.02).A Y 20.17 932.5555 8 -74.8 467.2502 2 18.04 2 5598 AEV_1_3_RA2_01_1232.d 0 1 1 46 53 Methylation(KR)
R.TIPSQK(+42.01).A Y 19.94 714.3912 6 75.9 715.4527 1 101.68 1 56270 AEV 2_3_RA2_01_1224.d 2.45E5 1 1 22 27 Acetylation (K)
K.ASESEYF(+31.99)TR.E Y 19.28 1120.4673 9 7.4 561.2451 2 51.95 1 21329 AEV 2_3_RA2_01_1224.d 0 1 1 126 134 Dihydroxy
K.QGEK(+28.03)PEK.K Y 18.80 842.4498 7 4.7 422.2341 2 11.91 3 3461 AEV_3_3_RA3_01_1233.d 0 1 1 149 155 Dimethylation(KR)
K.S(+43.01)VGQTK.K Y 18.53 661.3395 6 3.2 662.3489 1 70.32 2 33082 AEV_1_3_RA2_01_1232.d 0 1 1 9 14 Carbamylation
K.VVSAR(+14.02)ANDQK.A Y 18.32 1100.5938 10 4.6 367.8735 3 20.77 3 8227 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 158 167 Methylation(KR)
K.VDLTGIDDK(+42.01)VLEK.A Y 18.09 1485.7926 13 -7.8 743.8978 2 57.53 3 30607 AEV_3_3_RA3_01_1233.d 4.92E4 1 1 113 125 Acetylation (K)
K.QGEKPEK(+31.99).K Y 18.02 846.4083 7 16.1 847.4292 1 91.87 3 55740 AEV_3_3_RA3_01_1233.d 0 1 1 149 155 Dihydroxy
K.VDLTGIDDK(+14.02).V Y 17.69 988.5077 9 -14.2 495.2541 2 25.41 3 10800 AEV_3_3_RA3_01_1233.d 3.66E4 1 1 113 121 Methylation(KR)
K.QGEKPEK(+42.01)K(+42.01).K Y 17.65 1026.5345 8 6.5 514.2779 2 10.26 2 2578 AEV_1_3_RA2_01_1232.d 0 1 1 149 156 Acetylation (K)
K.FGKGERTIPSQK.A Y 16.99 1346.7306 12 -33.9 674.3497 2 83.00 2 42875 AEV_1_3_RA2_01_1232.d 0 1 1 16 27
R.Y(+42.01)VIATSSKVD(-18.01)LTGIDDK.V Y 16.68 1847.9517 17 -2.8 924.9805 2 90.33 3 54883 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 105 121 Acetylation (N-term); Dehydration
K.HLPQGVLLVT(+79.97)GPFK.L Y 16.49 1584.8429 14 12.4 397.2229 4 60.24 2 26038 AEV_1_3_RA2_01_1232.d 0 1 1 79 92 Phosphorylation (STY)
K.ASESE(+28.03)YFTR.E Y 16.34 1116.5087 9 5.1 373.1787 3 31.08 1 9571 AEV 2_3_RA2_01_1224.d 0 1 1 126 134 Ethylation
K.AS(+14.02)ESEYFTR.E Y 16.22 1102.4930 9 -88.5 552.2050 2 67.48 1 32008 AEV 2_3_RA2_01_1224.d 1.71E5 1 1 126 134 Methylation(others)
K.LNGVPLR(-.98).R Y 16.21 766.4813 7 -36.8 384.2338 2 83.11 3 50388 AEV_3_3_RA3_01_1233.d 3.93E4 1 1 93 99 Amidation
K.KEQFLASYLSTS(+79.97)FSLRK(+42.01).G Y 15.28 2126.0449 17 51.2 426.2380 5 74.71 3 43909 AEV_3_3_RA3_01_1233.d 0 1 1 179 195 Phosphorylation (STY); Acetylation (K)
K.KKVVSARANDQK.A Y 15.16 1342.7681 12 -120.2 336.6589 4 24.19 1 6208 AEV 2_3_RA2_01_1224.d 9.73E3 1 1 156 167
K.VVSARAN(+.98)DQK(+14.02).A Y 15.15 1101.5778 10 -23.3 551.7833 2 89.99 1 49610 AEV 2_3_RA2_01_1224.d 2.01E6 1 1 158 167 Deamidation (NQ); Methylation(KR)
K.K(+43.99)VVSARANDQK.A Y 15.10 1258.6630 11 -29.9 420.5491 3 29.56 3 13134 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 157 167 Carboxylation (DKW)
R.K(+43.01)TIHPAKPR.A Y 15.05 1089.6406 9 -55.9 364.2005 3 11.11 2 2909 AEV_1_3_RA2_01_1232.d 3.67E4 1 1 45 53 Carbamylation
K.FGK(+27.99)GER.T Y 15.03 720.3555 6 -87.1 361.1536 2 30.05 1 8994 AEV 2_3_RA2_01_1224.d 0 1 1 16 21 Formylation
total 97 peptides
C1FYR6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AIVIFVPVPLLQGFHK.I Y 133.29 1777.0654 16 -3.1 593.3606 3 89.82 2 47168 AEV_1_3_RA2_01_1232.d 2.21E6 9 9 61 76
R.Q(-17.03)HPSELETAIAGALSDLEANTPDLKAALRPLQFVSAR.E Y 130.05 3912.0381 37 1.7 979.0184 4 96.97 3 58004 AEV_3_3_RA3_01_1233.d 2.07E5 1 1 15 51 Pyro-glu from Q
R.QHPSELETAIAGALSDLEANTPDLK.A Y 128.27 2619.3027 25 -1.4 655.8320 4 90.73 3 55108 AEV_3_3_RA3_01_1233.d 8.94E5 6 6 15 39
R.Q(-17.03)HPSELETAIAGALSDLEANTPDLK.A Y 125.04 2602.2761 25 3.8 868.4360 3 95.48 2 49520 AEV_1_3_RA2_01_1232.d 2.94E6 11 11 15 39 Pyro-glu from Q
R.TLTAVHDAILTDIVYPVEIVGKR.L Y 125.04 2522.4106 23 5.9 631.6136 4 84.88 2 44229 AEV_1_3_RA2_01_1232.d 6.96E5 3 3 125 147
K.KAIVIFVPVPLLQGFHK.I Y 122.39 1905.1604 17 -1.9 477.2964 4 85.16 2 44440 AEV_1_3_RA2_01_1232.d 6.76E5 5 5 60 76
K.AALRPLQFVSAR.E Y 107.47 1327.7725 12 -4.1 443.5963 3 69.64 3 40007 AEV_3_3_RA3_01_1233.d 2.63E6 6 6 40 51
R.TLTAVHDAILTDIVYPVEIVGK.R Y 106.17 2366.3096 22 3.4 789.7798 3 87.03 3 53007 AEV_3_3_RA3_01_1233.d 4.03E5 3 3 125 146
R.GGVDHRLDAYGEVYR.R Y 104.77 1705.8171 15 0.8 569.6135 3 60.82 3 33083 AEV_3_3_RA3_01_1233.d 7.17E5 4 4 168 182
K.AIVIFVPVPLLQGFHKIQQR.L Y 100.70 2302.3677 20 4.1 576.6016 4 86.41 3 52671 AEV_3_3_RA3_01_1233.d 1.05E5 1 1 61 80
R.GVRFEFPQSSATEF Y 97.02 1600.7521 14 7.8 801.3895 2 79.68 3 47862 AEV_3_3_RA3_01_1233.d 3.85E5 2 2 188 201
R.Q(+.98)HPSELETAIAGALSDLEANTPDLK.A Y 93.75 2620.2866 25 1.3 874.4373 3 91.62 3 55612 AEV_3_3_RA3_01_1233.d 1.74E5 2 2 15 39 Deamidation (NQ)
R.Q(-17.03)HPSELETAIAGALSDLEANTPDLK(+14.02).A Y 86.72 2616.2917 25 1.4 1309.1550 2 97.51 3 58203 AEV_3_3_RA3_01_1233.d 1.73E6 14 14 15 39 Pyro-glu from Q; Methylation(KR)
R.SRTLTAVHDAILTDIVYPVEIVGK.R Y 83.64 2609.4429 24 -5.6 653.3643 4 84.68 3 51484 AEV_3_3_RA3_01_1233.d 8.41E4 1 1 123 146
K.AALRPLQFVSAR(+14.02).E Y 77.95 1341.7881 12 -4.5 448.2679 3 71.78 3 41628 AEV_3_3_RA3_01_1233.d 1.71E5 2 2 40 51 Methylation(KR)
R.QHPSE(+14.02)LETAIAGALSDLEANTPDLK.A Y 75.45 2633.3184 25 2.6 878.7823 3 92.06 3 55939 AEV_3_3_RA3_01_1233.d 1.37E5 1 1 15 39 Methylation(others)
K.FSDRHVLIIASR.R Y 74.76 1412.7888 12 0.3 354.2046 4 61.11 3 33267 AEV_3_3_RA3_01_1233.d 8.55E5 6 6 89 100
R.QHPSELET(+14.02)AIAGALSDLEANTPDLK.A Y 72.86 2633.3184 25 1.6 659.3379 4 92.05 3 55818 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 15 39 Methylation(others)
R.LDAYGEVYR.R Y 72.07 1084.5189 9 -8.1 543.2623 2 61.73 2 27013 AEV_1_3_RA2_01_1232.d 5.34E5 4 4 174 182
R.Q(-17.03)HPSELETAIAGALSDLEAN(+.98)TPDLK.A Y 71.72 2603.2603 25 8.5 868.7681 3 95.57 3 57461 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 15 39 Pyro-glu from Q; Deamidation (NQ)
R.QH(+14.02)PSELETAIAGALSDLEANTPDLK.A Y 69.82 2633.3184 25 4.2 659.3397 4 91.83 3 55719 AEV_3_3_RA3_01_1233.d 3.44E4 1 1 15 39 Methylation(others)
R.EIEVGHGKK.A Y 69.51 995.5400 9 -7.9 498.7733 2 10.84 2 2786 AEV_1_3_RA2_01_1232.d 1.15E5 3 3 52 60
K.AALRPLQ(+.98)FVSAR.E Y 67.63 1328.7565 12 -8.2 443.9225 3 71.32 3 41291 AEV_3_3_RA3_01_1233.d 4.36E5 4 4 40 51 Deamidation (NQ)
K.AIVIFVPVPLLQ(+.98)GFHK.I Y 66.04 1778.0494 16 -0.4 593.6902 3 90.33 3 54881 AEV_3_3_RA3_01_1233.d 1.47E5 2 2 61 76 Deamidation (NQ)
R.GVR(+14.02)FEFPQSSATEF Y 64.86 1614.7678 14 3.5 808.3940 2 80.88 2 41316 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 188 201 Methylation(KR)
K.VILHEKER.G Y 62.88 1022.5872 8 -5.0 512.2983 2 15.51 3 5405 AEV_3_3_RA3_01_1233.d 4.57E5 4 4 160 167
R.SRTLTAVHDAILTDIVYPVEIVGKR.L Y 60.24 2765.5439 25 -6.5 692.3888 4 82.67 3 50071 AEV_3_3_RA3_01_1233.d 0 1 1 123 147
R.GGVDHRLDAYGEVYRR.L Y 59.60 1861.9183 16 3.2 466.4883 4 57.86 3 30854 AEV_3_3_RA3_01_1233.d 2.91E5 2 2 168 183
K.AIVIFVPVPLLQ(+.98)GFHKIQQR.L Y 58.31 2303.3518 20 2.3 576.8466 4 86.41 3 52645 AEV_3_3_RA3_01_1233.d 5.25E3 1 1 61 80 Deamidation (NQ)
R.EIEVGHGK.K Y 55.83 867.4450 8 2.6 434.7309 2 13.84 3 4525 AEV_3_3_RA3_01_1233.d 1.23E5 2 2 52 59
M.A(+42.01)ALNKIAANSPSR.Q Y 55.51 1353.7365 13 -5.8 677.8716 2 63.41 3 35052 AEV_3_3_RA3_01_1233.d 2.61E5 2 2 2 14 Acetylation (Protein N-term)
K.IAANSPSR.Q Y 55.50 814.4297 8 -86.1 408.1870 2 22.25 1 5504 AEV 2_3_RA2_01_1224.d 1.28E6 5 5 7 14
R.FEFPQSSATEF Y 54.46 1288.5612 11 22.3 645.3022 2 82.39 3 49928 AEV_3_3_RA3_01_1233.d 0 1 1 191 201
R.QHPSELE(+14.02)TAIAGALSDLEANTPDLK.A Y 53.73 2633.3184 25 4.6 878.7841 3 92.13 2 48243 AEV_1_3_RA2_01_1232.d 3.19E4 1 1 15 39 Methylation(others)
R.GVRFEFPQSSATE(+14.02)F Y 52.84 1614.7678 14 -1.3 808.3901 2 81.44 3 49164 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 188 201 Methylation(others)
K.IAANSPSRQH(+40.03)PSELETAIAGALSDLEANTPDLK.A Y 52.66 3455.7532 33 5.1 864.9500 4 95.63 3 57488 AEV_3_3_RA3_01_1233.d 1.91E5 1 1 7 39 Propionaldehyde +40
R.GVRFEFPQSSATEF(-.98) Y 51.13 1599.7681 14 -10.3 800.8831 2 79.69 3 47834 AEV_3_3_RA3_01_1233.d 1.75E4 1 1 188 201 Amidation
R.Q(+.98)HPSELETAIAGALSDLEAN(+.98)TPDLK.A Y 49.56 2621.2708 25 9.9 656.3314 4 91.61 3 55595 AEV_3_3_RA3_01_1233.d 2.97E4 1 1 15 39 Deamidation (NQ)
R.HVLIIASR.R Y 48.15 907.5603 8 2.1 303.5280 3 47.44 3 24097 AEV_3_3_RA3_01_1233.d 1.26E5 3 3 93 100
R.QHPSELET(-2.02)AIAGALSDLEANTPDLK.A Y 47.13 2617.2871 25 15.6 873.4500 3 91.72 3 55662 AEV_3_3_RA3_01_1233.d 7.35E4 1 1 15 39 2-amino-3-oxo-butanoic_acid
K.FSDRHVLIIASRR.I Y 46.45 1568.8899 13 0.1 314.7853 5 56.72 3 30058 AEV_3_3_RA3_01_1233.d 5.26E5 2 2 89 101
R.TLT(+79.97)AVHDAILTDIVY(+162.05)PVEIVGK.R Y 46.12 2608.3289 22 41.7 653.1167 4 84.65 3 51457 AEV_3_3_RA3_01_1233.d 0 2 2 125 146 Phosphorylation (STY); Hexose (NSY)
R.Q(+.98)HPSELETAIAGALSDLEANT(-18.01)PDLK.A Y 42.81 2602.2761 25 3.5 868.4357 3 90.19 3 54805 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 15 39 Deamidation (NQ); Dehydration
R.ILPRPK.R Y 42.26 722.4802 6 -11.9 362.2431 2 22.18 3 8990 AEV_3_3_RA3_01_1233.d 5.69E5 2 2 102 107
R.GVRFEFPQSSATEF(+14.02) Y 40.90 1614.7678 14 7.1 808.3969 2 82.25 3 49820 AEV_3_3_RA3_01_1233.d 1.54E5 2 2 188 201 Methylation(C-term)
R.LDAYGEVYRR.L Y 40.56 1240.6200 10 0.1 621.3173 2 54.37 3 28600 AEV_3_3_RA3_01_1233.d 1.6E5 1 1 174 183
K.AIVIFVPVPLLQGFHK(+14.02).I Y 39.77 1791.0811 16 3.5 598.0364 3 88.14 3 53667 AEV_3_3_RA3_01_1233.d 8.25E4 2 2 61 76 Methylation(KR)
R.QHPSELETAIAGALS(+13.03)DLEANTPDLK.A Y 38.94 2632.3345 25 -5.3 659.0874 4 92.30 3 55950 AEV_3_3_RA3_01_1233.d 1.82E5 1 1 15 39 Michael addition with methylamine
R.GVRFEFPQ(+.98)SSATEF(-.98) Y 36.25 1600.7521 14 5.6 801.3878 2 80.61 3 48543 AEV_3_3_RA3_01_1233.d 3.21E4 1 1 188 201 Deamidation (NQ); Amidation
R.QHPS(-18.01)ELETAIAGALSDLEANTPDLK.A Y 35.46 2601.2922 25 -2.3 868.1027 3 96.31 3 57775 AEV_3_3_RA3_01_1233.d 0 1 1 15 39 Dehydration
R.QHPSELETAIAGALSDLEANTPDLKAALRPLQFVSAR.E Y 34.82 3929.0645 37 53.2 786.8619 5 93.96 3 56772 AEV_3_3_RA3_01_1233.d 0 1 1 15 51
K.I(+42.01)AANSPSRQHPSELE(+43.99)TAIAGALSDLEANTPDLK.A Y 34.40 3501.7222 33 14.2 876.4503 4 91.14 3 55329 AEV_3_3_RA3_01_1233.d 0 1 1 7 39 Acetylation (Protein N-term); Carboxylation (E)
R.GVRFEFPQ(+.98)SSATEF Y 32.92 1601.7361 14 6.4 801.8804 2 80.93 2 41299 AEV_1_3_RA2_01_1232.d 2.51E5 1 1 188 201 Deamidation (NQ)
K.IAANSPSRQHPSELETAIAGALSDLEANTPDLK(-.98).A Y 31.59 3414.7378 33 -13.2 854.6804 4 87.43 3 53262 AEV_3_3_RA3_01_1233.d 1.48E5 1 1 7 39 Amidation
R.E(-18.01)IEVGHGKK.A Y 31.34 977.5294 9 6.6 326.8526 3 10.87 2 2795 AEV_1_3_RA2_01_1232.d 3.53E5 2 2 52 60 Pyro-glu from E
K.I(+42.01)AANS(+79.97)PSR.Q Y 30.89 936.4066 8 -33.6 937.3824 1 95.27 1 53304 AEV 2_3_RA2_01_1224.d 3.24E5 2 2 7 14 Acetylation (Protein N-term); Phosphorylation (STY)
R.TLTAVHDAILTDIVYPVEIVGK(+14.02)R.L Y 27.17 2536.4265 23 22.8 635.1284 4 86.05 2 45013 AEV_1_3_RA2_01_1232.d 0 1 1 125 147 Methylation(KR)
R.E(+42.01)(+21.98)IEVGHGKK.A Y 27.08 1059.5325 9 14.8 354.1900 3 10.96 3 2984 AEV_3_3_RA3_01_1233.d 5.75E5 1 1 52 60 Acetylation (N-term); Sodium adduct
K.IAANSP(+13.98)SR.Q Y 26.65 828.4089 8 -45.8 415.1928 2 30.34 1 9138 AEV 2_3_RA2_01_1224.d 2.92E5 1 1 7 14 Proline oxidation to pyroglutamic acid
R.TKEDGS(+79.97)K.L Y 24.91 843.3375 7 -35.1 844.3152 1 112.37 1 59442 AEV 2_3_RA2_01_1224.d 0 1 1 150 156 Phosphorylation (STY)
R.FEFP(+31.99)QSSATEF Y 23.94 1320.5509 11 -4.8 661.2795 2 79.85 1 41724 AEV 2_3_RA2_01_1224.d 1.48E5 1 1 191 201 Dihydroxy
R.RILPRPK.R Y 23.36 878.5814 7 -38.6 440.2810 2 28.34 3 12436 AEV_3_3_RA3_01_1233.d 0 1 1 101 107
K.AALRPLQFVS(-18.01)AR(+14.02).E Y 23.00 1323.7775 12 -48.0 442.2452 3 69.61 3 39941 AEV_3_3_RA3_01_1233.d 5E4 1 1 40 51 Dehydration; Methylation(KR)
MAALN(+.98)K.I Y 22.62 647.3312 6 -3.9 648.3360 1 55.89 2 23471 AEV_1_3_RA2_01_1232.d 1.22E6 1 1 1 6 Deamidation (NQ)
R.G(+42.01)GVD(-18.01)HR.L Y 22.32 663.3088 6 33.6 664.3384 1 78.29 2 39206 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 168 173 Acetylation (N-term); Dehydration
K.KAIVIFVPVPLLQ(+.98)GFHK.I Y 21.90 1906.1444 17 -89.9 477.5005 4 94.58 1 52874 AEV 2_3_RA2_01_1224.d 3.76E4 1 1 60 76 Deamidation (NQ)
R.HVLIIASRR.I Y 21.76 1063.6614 9 1.0 355.5614 3 38.02 3 18210 AEV_3_3_RA3_01_1233.d 1.32E5 1 1 93 101
R.QHPSELETAIAGALSD(+14.02)LEANTPDLK.A Y 20.89 2633.3184 25 -4.4 659.3340 4 92.56 2 48401 AEV_1_3_RA2_01_1232.d 8.44E4 1 1 15 39 Methylation(others)
K.EDGSK.L N 20.88 534.2285 5 32.1 535.2529 1 27.10 2 9415 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 152 156
K.ERGGVDHR.L Y 20.40 924.4525 8 40.0 925.4968 1 73.86 1 36981 AEV 2_3_RA2_01_1224.d 7.05E4 2 2 166 173
K.IAAN(+.98)SPSR(+21.98).Q Y 20.27 837.3956 8 6.5 838.4084 1 85.78 3 52226 AEV_3_3_RA3_01_1233.d 7.4E3 1 1 7 14 Deamidation (NQ); Sodium adduct
M(+15.99)AALNKIAANS(+79.96)PSR.Q Y 19.83 1538.7181 14 89.2 385.7211 4 59.41 3 31971 AEV_3_3_RA3_01_1233.d 0 1 1 1 14 Oxidation (M); Sulfation
R.EIEVGHGK(+14.02).K Y 19.77 881.4606 8 -95.9 441.6953 2 39.53 1 14141 AEV 2_3_RA2_01_1224.d 7.14E4 1 1 52 59 Methylation(KR)
K.I(+42.01)AAN(+.98)SPSR.Q Y 19.27 857.4243 8 -85.4 858.3583 1 87.85 1 47994 AEV 2_3_RA2_01_1224.d 0 1 1 7 14 Acetylation (Protein N-term); Deamidation (NQ)
K.EDGSK(+97.02).L N 19.09 631.2449 5 15.8 632.2622 1 21.93 3 8859 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 152 156 Maleimide
MAALNK(+43.99).I Y 18.63 690.3370 6 8.0 691.3499 1 111.97 3 62522 AEV_3_3_RA3_01_1233.d 6.01E4 1 1 1 6 Carboxylation (DKW)
K.EDGSK(+21.98)(+14.02).L N 18.54 570.2261 5 -10.8 571.2272 1 112.62 2 54473 AEV_1_3_RA2_01_1232.d 0 1 1 152 156 Sodium adduct; Methylation(KR)
R.HVLIIASR(+17.03).R Y 18.10 924.5869 8 -22.9 463.2901 2 101.16 2 51345 AEV_1_3_RA2_01_1232.d 0 1 1 93 100 Replacement of proton with ammonium ion
R.ILP(+31.99)RPK.R Y 17.43 754.4701 6 -58.0 378.2205 2 78.85 1 40952 AEV 2_3_RA2_01_1224.d 1.3E5 1 1 102 107 Dihydroxy
K.IAANSPS(-18.01)R.Q Y 17.04 796.4191 8 2.0 399.2177 2 11.41 3 3204 AEV_3_3_RA3_01_1233.d 0 1 1 7 14 Dehydration
K.EDGS(+79.97)K.L N 17.00 614.1949 5 76.3 615.2490 1 68.55 1 32854 AEV 2_3_RA2_01_1224.d 8.32E4 1 1 152 156 Phosphorylation (STY)
K.I(+42.01)AANSPSR.Q Y 16.95 856.4402 8 -102.7 429.1834 2 22.54 1 5574 AEV 2_3_RA2_01_1224.d 2.37E5 3 3 7 14 Acetylation (Protein N-term)
K.IAANS(-20.03)PSR.Q Y 16.17 794.4034 8 8.9 795.4178 1 89.98 2 47221 AEV_1_3_RA2_01_1232.d 1.97E5 1 1 7 14 Formation of five membered aromatic heterocycle
R.QHPSE(+37.03)LETAIAGALSDLEANTPDLK.A Y 15.65 2656.3345 25 9.2 886.4603 3 95.41 2 49481 AEV_1_3_RA2_01_1232.d 5.66E4 1 1 15 39 Propargylamine
K.IQQRLTRELEK(+14.02)K.F Y 15.58 1554.9205 12 -9.5 311.9884 5 8.23 2 1938 AEV_1_3_RA2_01_1232.d 0 1 1 77 88 Methylation(KR)
R.E(+42.01)IEVGHGK(+28.03).K Y 15.42 937.4869 8 4.7 469.7529 2 18.17 2 5645 AEV_1_3_RA2_01_1232.d 3.1E4 1 1 52 59 Acetylation (N-term); Dimethylation(KR)
K.IAANS(-18.01)PSR.Q Y 15.42 796.4191 8 -54.5 399.1951 2 26.15 3 11227 AEV_3_3_RA3_01_1233.d 1.76E4 1 1 7 14 Dehydration
R.EIEVGHGK(+226.08).K Y 15.38 1093.5226 8 -0.5 1094.5293 1 93.59 3 56601 AEV_3_3_RA3_01_1233.d 0 1 1 52 59 Biotinylation
R.SRT(+79.97)S(+79.97)QK.Q Y 15.37 865.3096 6 45.8 866.3565 1 96.25 1 53928 AEV 2_3_RA2_01_1224.d 1.37E5 1 1 112 117 Phosphorylation (STY)
R.GGVD(+43.99)HR.L Y 15.16 683.2987 6 -20.1 684.2922 1 87.14 1 47459 AEV 2_3_RA2_01_1224.d 1.08E5 1 1 168 173 Carboxylation (DKW)
R.GGVD(+31.97)HR.L Y 15.15 671.2809 6 13.8 336.6524 2 61.49 1 27599 AEV 2_3_RA2_01_1224.d 4.08E5 1 1 168 173 Persulfide
R.FEFPQSS(+114.04)ATEF Y 15.09 1402.6040 11 -66.3 468.5109 3 51.75 1 21200 AEV 2_3_RA2_01_1224.d 2.83E5 1 1 191 201 Ubiquitin
total 92 peptides
C1G3C4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.GVAGAGVLSIYDQVQLLLFGK.A Y 142.47 2147.1990 21 1.8 716.7416 3 97.64 2 50236 AEV_1_3_RA2_01_1232.d 2.95E5 6 6 286 306
R.IKLLIQNQDEMLK.T Y 133.39 1584.8909 13 2.7 529.3057 3 73.58 2 35632 AEV_1_3_RA2_01_1232.d 2.69E5 1 1 37 49
R.YFPTQALNFAFR.D Y 122.75 1473.7405 12 2.3 737.8792 2 84.56 2 44039 AEV_1_3_RA2_01_1232.d 1.09E6 4 4 87 98
R.GFGPSVLGIVVYR.G Y 112.55 1362.7659 13 -2.0 682.3889 2 84.57 2 44019 AEV_1_3_RA2_01_1232.d 2.92E5 4 4 183 195
K.WMAGNLASGGAAGATSLLFVYSLDYAR.T Y 109.22 2761.3533 27 0.7 1381.6848 2 93.37 2 48732 AEV_1_3_RA2_01_1232.d 2.82E5 4 4 117 143
R.GVAGAGVLSIYDQVQLLLFGKAFK Y 107.34 2493.3994 24 5.6 624.3606 4 96.00 3 57668 AEV_3_3_RA3_01_1233.d 2.64E5 3 3 286 309
K.TLASDGIAGLYR.G Y 102.97 1235.6510 12 2.2 618.8341 2 73.76 2 35725 AEV_1_3_RA2_01_1232.d 2.49E6 7 7 171 182
R.YFPTQALNFAFRDTYK.S Y 97.94 1980.9734 16 -0.3 991.4937 2 81.83 3 49465 AEV_3_3_RA3_01_1233.d 7.48E5 5 5 87 102
K.LLIQNQDEMLK.T Y 94.93 1343.7119 11 1.2 672.8640 2 70.84 2 33478 AEV_1_3_RA2_01_1232.d 4.86E5 4 4 39 49
R.SFFKGAGANILR.G Y 87.62 1279.7036 12 -2.2 427.5742 3 69.28 3 39692 AEV_3_3_RA3_01_1233.d 1.06E6 4 4 274 285
R.KYN(+.98)GIMDC(+57.02)FSR.T Y 85.29 1390.6010 11 -3.4 464.5394 3 69.89 2 32766 AEV_1_3_RA2_01_1232.d 6.49E4 1 1 56 66 Deamidation (NQ); Carbamidomethylation
K.YSSSFDAAR.Q Y 83.95 1002.4406 9 4.9 502.2300 2 39.02 2 15017 AEV_1_3_RA2_01_1232.d 2.63E6 9 9 256 264
R.Q(-17.03)FNGLVDVYRK.T Y 76.22 1320.6826 11 -1.6 661.3475 2 78.05 3 46538 AEV_3_3_RA3_01_1233.d 9.53E5 4 4 160 170 Pyro-glu from Q
R.MMMTSGEAVKYSSSFDAAR.Q Y 75.12 2067.9062 19 8.0 690.3149 3 70.93 2 33544 AEV_1_3_RA2_01_1232.d 8.21E4 1 1 246 264
K.LLIQNQDEM(+15.99)LK.T Y 72.99 1359.7068 11 -5.1 680.8572 2 63.31 3 34974 AEV_3_3_RA3_01_1233.d 2.05E3 1 1 39 49 Oxidation (M)
R.KYNGIMDC(+57.02)FSR.T Y 72.28 1389.6169 11 23.3 464.2237 3 66.12 2 30033 AEV_1_3_RA2_01_1232.d 2.94E4 2 2 56 66 Carbamidomethylation
K.NEGIVSLWR.G Y 66.12 1072.5665 9 1.9 537.2916 2 76.40 3 45217 AEV_3_3_RA3_01_1233.d 9.54E4 1 1 70 78
R.Q(-17.03)FN(+.98)GLVDVYRK.T Y 64.98 1321.6666 11 3.2 661.8427 2 79.15 2 39955 AEV_1_3_RA2_01_1232.d 9.09E5 6 6 160 170 Pyro-glu from Q; Deamidation (NQ)
R.IKLLIQNQDEM(+15.99)LK.T Y 64.56 1600.8857 13 -7.1 534.6321 3 67.24 3 38040 AEV_3_3_RA3_01_1233.d 1.27E5 2 2 37 49 Oxidation (M)
R.MM(+15.99)MTSGEAVKYSSSFDAAR.Q Y 64.50 2083.9014 19 2.4 695.6427 3 68.01 2 31372 AEV_1_3_RA2_01_1232.d 3.41E4 1 1 246 264 Oxidation (M)
R.QFNGLVDVYRK.T Y 64.34 1337.7091 11 -8.0 446.9067 3 65.88 3 36985 AEV_3_3_RA3_01_1233.d 9.91E5 3 3 160 170
K.TAAAPIER.I Y 63.71 827.4501 8 -0.7 414.7320 2 23.83 3 9893 AEV_3_3_RA3_01_1233.d 3.38E6 10 10 29 36
R.Q(-17.03)FNGLVDVYR.K Y 63.39 1192.5876 10 5.2 597.3042 2 84.28 2 43830 AEV_1_3_RA2_01_1232.d 3.33E5 3 3 160 169 Pyro-glu from Q
R.GNTANVIR.Y Y 61.31 843.4562 8 -0.8 422.7350 2 21.35 3 8571 AEV_3_3_RA3_01_1233.d 1.23E6 4 4 79 86
R.QFNGLVDVYR.K Y 59.16 1209.6141 10 -3.5 605.8123 2 73.20 3 42741 AEV_3_3_RA3_01_1233.d 3.79E5 3 3 160 169
R.TMKNEGIVSLWR.G Y 55.40 1432.7496 12 2.9 478.5919 3 71.68 3 41550 AEV_3_3_RA3_01_1233.d 2.96E5 2 2 67 78
R.Q(-17.03)IAAKEGVR.S Y 52.79 953.5294 9 3.6 477.7737 2 37.27 2 14160 AEV_1_3_RA2_01_1232.d 1.28E5 3 3 265 273 Pyro-glu from Q
K.SFM(+15.99)GMPGFVVDFMMGGVSAAVSK.T Y 50.24 2367.0771 23 4.8 1184.5515 2 96.24 2 49776 AEV_1_3_RA2_01_1232.d 1.36E5 2 2 6 28 Oxidation (M)
K.TLASDGIAGLYR(+14.02).G Y 47.94 1249.6666 12 7.7 625.8454 2 76.32 2 37647 AEV_1_3_RA2_01_1232.d 2.12E5 3 3 171 182 Methylation(KR)
R.KYN(+.98)GIM(+15.99)DC(+57.02)FSR.T Y 47.26 1406.5958 11 13.4 469.8788 3 57.82 3 30820 AEV_3_3_RA3_01_1233.d 1.08E5 2 2 56 66 Deamidation (NQ); Oxidation (M); Carbamidomethylation
R.YFPTQ(+.98)ALNFAFRDTYK.S Y 43.58 1981.9574 16 -6.6 661.6554 3 81.81 3 49453 AEV_3_3_RA3_01_1233.d 0 1 1 87 102 Deamidation (NQ)
K.YSSSFDAAR(+14.02).Q Y 42.00 1016.4563 9 3.8 509.2374 2 47.16 3 23905 AEV_3_3_RA3_01_1233.d 3.72E5 4 4 256 264 Methylation(KR)
K.TAAAPIER(+14.02).I Y 40.93 841.4658 8 7.9 421.7435 2 33.04 2 12141 AEV_1_3_RA2_01_1232.d 6.78E5 3 3 29 36 Methylation(KR)
R.KYNGIM(+15.99)DC(+57.02)FSR.T Y 39.26 1405.6118 11 12.9 469.5506 3 53.17 3 27822 AEV_3_3_RA3_01_1233.d 7.9E4 1 1 56 66 Oxidation (M); Carbamidomethylation
R.QFN(+.98)GLVDVYRK.T Y 39.00 1338.6931 11 1.3 447.2389 3 68.28 2 31567 AEV_1_3_RA2_01_1232.d 6.45E5 3 3 160 170 Deamidation (NQ)
K.GAGANILR.G Y 38.88 770.4399 8 6.9 386.2299 2 38.44 2 14723 AEV_1_3_RA2_01_1232.d 2.03E6 8 8 278 285
R.IKLLIQNQ(+.98)DEMLK.T Y 36.61 1585.8749 13 8.8 529.6369 3 72.55 3 42226 AEV_3_3_RA3_01_1233.d 1.42E2 1 1 37 49 Deamidation (NQ)
R.KTLASDGIAGLYR.G Y 36.51 1363.7460 13 -98.4 455.5446 3 75.17 1 38012 AEV 2_3_RA2_01_1224.d 1.75E5 1 1 170 182
R.GN(+.98)TANVIR.Y Y 35.85 844.4402 8 -49.8 423.2064 2 22.08 2 7253 AEV_1_3_RA2_01_1232.d 0 3 3 79 86 Deamidation (NQ)
R.LANDAKSAK(+21.98).G Y 32.18 938.4797 9 33.3 470.2628 2 60.27 2 26060 AEV_1_3_RA2_01_1232.d 0 1 1 146 154 Sodium adduct
R.Q(-17.03)FNGLVDVYRK(+14.02).T Y 30.76 1334.6982 11 6.3 668.3606 2 78.86 2 39654 AEV_1_3_RA2_01_1232.d 7.02E4 1 1 160 170 Pyro-glu from Q; Methylation(KR)
R.YFPTQ(+.98)ALNFAFR.D Y 29.04 1474.7245 12 -0.5 738.3691 2 85.70 2 44785 AEV_1_3_RA2_01_1232.d 2.04E5 2 2 87 98 Deamidation (NQ)
K.G(+108.00)AGANILR.G Y 27.45 878.4375 8 33.2 440.2406 2 69.34 3 39720 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 278 285 O-Ethylphosphorylation
MAQDK.S Y 27.41 591.2686 5 -94.6 592.2200 1 47.07 1 18522 AEV 2_3_RA2_01_1224.d 1.73E4 2 2 1 5
K.EGVRSFFKGAGANILR.G Y 26.40 1720.9373 16 0.3 431.2417 4 72.42 3 42123 AEV_3_3_RA3_01_1233.d 0 1 1 270 285
R.GNTANVIR(+14.02).Y Y 25.40 857.4719 8 -88.8 429.7052 2 50.94 1 20737 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 79 86 Methylation(KR)
R.GNTANVIRYFPTQALNFAFR.D Y 24.60 2299.1860 20 -17.4 767.3893 3 85.46 3 52010 AEV_3_3_RA3_01_1233.d 5.78E4 1 1 79 98
R.SFFKGAGANILR(+14.02).G Y 24.51 1293.7194 12 1.7 432.2478 3 73.77 2 35707 AEV_1_3_RA2_01_1232.d 0 1 1 274 285 Methylation(KR)
K.GAGANILR(+14.02).G Y 24.02 784.4555 8 -2.6 393.2340 2 47.16 3 23906 AEV_3_3_RA3_01_1233.d 1.9E5 3 3 278 285 Methylation(KR)
M(+42.01)AQDK.S Y 23.31 633.2792 5 -92.1 634.2281 1 36.00 1 12190 AEV 2_3_RA2_01_1224.d 1.15E5 2 2 1 5 Acetylation (Protein N-term)
R.LAN(+.98)DAK(+21.98).S Y 22.76 653.2996 6 -74.9 654.2579 1 56.58 1 24171 AEV 2_3_RA2_01_1224.d 6.25E4 1 1 146 151 Deamidation (NQ); Sodium adduct
R.LANDAK(+43.01).S Y 20.94 673.3395 6 -72.8 674.2977 1 58.67 1 25552 AEV 2_3_RA2_01_1224.d 0 1 1 146 151 Carbamylation
K.GT(+79.97)GER(+21.98).Q Y 19.78 620.1931 5 98.8 621.2617 1 86.43 1 46906 AEV 2_3_RA2_01_1224.d 1.94E4 1 1 155 159 Phosphorylation (STY); Sodium adduct
R.LANDAK(+42.01)SAK(+42.01)GT(+79.97)GER.Q Y 19.21 1580.7195 14 82.8 396.2199 4 41.33 3 20218 AEV_3_3_RA3_01_1233.d 1.97E5 1 1 146 159 Acetylation (K); Phosphorylation (STY)
K.ERDGYAK(+54.01).W Y 19.18 891.4086 7 -65.2 892.3578 1 92.69 1 51549 AEV 2_3_RA2_01_1224.d 1.22E4 1 1 110 116 MDA adduct +54
K.T(+41.03)LASDGIAGLYR.G Y 19.16 1276.6775 12 19.6 426.5748 3 73.32 3 42835 AEV_3_3_RA3_01_1233.d 2.7E4 1 1 171 182 Amidination of lysines or N-terminal amines with methyl acetimidate
M.A(+42.01)QDKSFM(+15.99)GMPGFVVDFMMGGVSAAVSK.T Y 19.15 2851.3052 27 33.4 951.4741 3 96.36 3 57803 AEV_3_3_RA3_01_1233.d 4.53E4 2 2 2 28 Acetylation (Protein N-term); Oxidation (M)
R.LANDAKSAK(+31.99)GTGER.Q Y 19.13 1448.7219 14 -16.5 483.9066 3 67.48 1 32015 AEV 2_3_RA2_01_1224.d 1.1E5 1 1 146 159 Dihydroxy
R.LAN(+.98)D(-18.01)AK.S Y 18.86 613.3071 6 1.3 614.3152 1 74.20 2 36028 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 146 151 Deamidation (NQ); Dehydration
K.T(+43.01)LASDGIAGLY(+79.97)R.G Y 18.82 1358.6230 12 -50.3 453.8588 3 72.21 1 35677 AEV 2_3_RA2_01_1224.d 6.15E5 1 1 171 182 Carbamylation; Phosphorylation (STY)
R.RRMMMTSGEAVK(+27.99).Y Y 18.30 1423.6735 12 -22.3 475.5545 3 44.54 1 17021 AEV 2_3_RA2_01_1224.d 1.31E5 1 1 244 255 Formylation
K.YSSSFDAARQ(+.98)IAAK(+226.08)EGVR.S Y 17.58 2182.0476 18 -11.0 1092.0190 2 92.03 3 55808 AEV_3_3_RA3_01_1233.d 9.41E4 1 1 256 273 Deamidation (NQ); Biotinylation
M(+15.99)AQDK.S Y 17.45 607.2635 5 -6.7 608.2668 1 46.92 1 18425 AEV 2_3_RA2_01_1224.d 3.8E4 1 1 1 5 Oxidation (M)
K.NEGIVSLWR(+14.02).G Y 17.24 1086.5822 9 10.5 544.3041 2 78.22 3 46681 AEV_3_3_RA3_01_1233.d 1.6E5 1 1 70 78 Methylation(KR)
K.SAKGTGER.Q Y 16.87 804.4089 8 -23.6 403.2022 2 73.64 1 36800 AEV 2_3_RA2_01_1224.d 0 1 1 152 159
K.YSSSFDAAR(+.98).Q Y 16.73 1003.4246 9 22.4 502.7308 2 39.14 2 15051 AEV_1_3_RA2_01_1232.d 1.9E4 1 1 256 264 Deamidation (R)
R.QIAAK.E N 16.73 529.3224 5 -192.7 530.2277 1 80.74 1 42414 AEV 2_3_RA2_01_1224.d 2.52E3 1 1 265 269
K.E(+43.01)R(+14.02)DGYAK.W Y 16.71 894.4195 7 -66.1 448.1875 2 59.66 1 26234 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 110 116 Carbamylation; Methylation(KR)
R.L(+27.99)ANDAKS(+79.97)AK.G Y 16.65 1024.4590 9 -38.8 513.2169 2 40.62 1 14776 AEV 2_3_RA2_01_1224.d 0 1 1 146 154 Formylation; Phosphorylation (STY)
R.RRM(+15.99)M(+15.99)MTSGEAVK.Y Y 16.64 1427.6683 12 28.6 476.9103 3 74.27 1 37291 AEV 2_3_RA2_01_1224.d 0 1 1 244 255 Oxidation (M)
K.Y(+43.01)NGIMDC(+57.02)FSR.T Y 16.57 1304.5278 10 1.9 653.2725 2 86.30 1 46807 AEV 2_3_RA2_01_1224.d 1.05E5 1 1 57 66 Carbamylation; Carbamidomethylation
R.TMK(+14.02)NEGIVSLWR.G Y 16.53 1446.7653 12 -25.8 483.2499 3 68.81 3 39299 AEV_3_3_RA3_01_1233.d 0 1 1 67 78 Methylation(KR)
K.G(+42.01)AGANILR(+14.02).G Y 16.52 826.4661 8 -60.2 827.4236 1 88.47 3 53871 AEV_3_3_RA3_01_1233.d 4.07E4 1 1 278 285 Acetylation (N-term); Methylation(KR)
R.T(+79.97)MK(+14.02)NEGIVSLWR.G Y 16.34 1526.7317 12 13.4 509.9247 3 48.13 2 19505 AEV_1_3_RA2_01_1232.d 0 1 1 67 78 Phosphorylation (STY); Methylation(KR)
K.T(+42.01)AAAPIER(+14.02).I Y 16.28 883.4763 8 1.8 442.7462 2 56.62 3 29954 AEV_3_3_RA3_01_1233.d 0 1 1 29 36 Acetylation (N-term); Methylation(KR)
R.Q(+42.01)FNGLVDVY(-18.01)R.K Y 15.93 1233.6141 10 -8.3 617.8092 2 31.31 3 14148 AEV_3_3_RA3_01_1233.d 4.42E4 1 1 160 169 Acetylation (N-term); Dehydration
R.LANDAKSAKGT(-18.01)GER.Q Y 15.90 1398.7214 14 5.9 700.3721 2 94.76 2 49254 AEV_1_3_RA2_01_1232.d 1.27E5 1 1 146 159 Dehydration
R.MMM(+15.99)TSGEAVKYSSSFDAAR.Q Y 15.18 2083.9014 19 -39.7 521.9619 4 75.65 1 38386 AEV 2_3_RA2_01_1224.d 0 1 1 246 264 Oxidation (M)
R.LANDAKSAK.G Y 15.13 916.4977 9 81.4 306.5314 3 9.57 3 2377 AEV_3_3_RA3_01_1233.d 5.32E3 1 1 146 154
total 79 peptides
C1GHJ0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.NAEANADTKGLDTSNLIVQHIQVNQAPK.Q Y 153.71 2988.5264 28 1.7 748.1401 4 73.06 2 35156 AEV_1_3_RA2_01_1232.d 1.6E6 6 6 155 182
K.GLDTSNLIVQHIQVNQAPK.Q Y 140.68 2074.1172 19 1.5 692.3807 3 75.10 2 36710 AEV_1_3_RA2_01_1232.d 5.1E6 11 11 164 182
R.INPYMSSPC(+57.02)HIELILTEGSEEVQKPSTEIK.A Y 105.36 3428.6843 30 4.5 1143.9072 3 81.17 3 48970 AEV_3_3_RA3_01_1233.d 1.74E5 2 2 194 223 Carbamidomethylation
R.WPVKSAEFLLSLLK.N Y 104.79 1629.9493 14 2.5 544.3251 3 89.42 3 54414 AEV_3_3_RA3_01_1233.d 4.24E5 2 2 141 154
K.SAEFLLSLLK.N Y 104.67 1119.6539 10 3.1 560.8360 2 87.33 2 45824 AEV_1_3_RA2_01_1232.d 5.12E6 10 10 145 154
K.ARWPVKSAEFLLSLLK.N Y 102.64 1857.0875 16 9.8 620.0425 3 87.19 3 53155 AEV_3_3_RA3_01_1233.d 9.56E5 8 8 139 154
K.SAEFLLSLLKNAEANADTK.G Y 102.09 2034.0632 19 1.2 679.0292 3 86.83 2 45511 AEV_1_3_RA2_01_1232.d 5.19E5 4 4 145 163
R.AVAYLENVMAHK.E Y 98.92 1344.6860 12 1.3 673.3512 2 68.54 2 31755 AEV_1_3_RA2_01_1232.d 9.97E5 6 6 102 113
R.YAAQSIQSTK.S Y 94.49 1095.5560 10 4.8 548.7879 2 29.17 2 10376 AEV_1_3_RA2_01_1232.d 2.8E6 8 8 62 71
K.GLDTSNLIVQHIQVN(+.98)QAPK.Q Y 91.55 2075.1011 19 0.5 692.7080 3 75.94 2 37343 AEV_1_3_RA2_01_1232.d 2.68E5 1 1 164 182 Deamidation (NQ)
K.SAEFLLSLLK(+14.02).N Y 79.32 1133.6696 10 2.1 567.8433 2 89.40 2 46938 AEV_1_3_RA2_01_1232.d 7.5E5 3 3 145 154 Methylation(KR)
R.AVAYLENVM(+15.99)AHK.E Y 77.01 1360.6809 12 -1.5 681.3467 2 57.19 3 30362 AEV_3_3_RA3_01_1233.d 1.02E6 6 6 102 113 Oxidation (M)
R.ETAQAINGWK.L Y 76.52 1116.5564 10 0.3 559.2856 2 52.60 3 27450 AEV_3_3_RA3_01_1233.d 1.09E6 4 4 89 98
K.NAEANADTKGLDTSNLIVQHIQVN(+.98)QAPK.Q Y 74.37 2989.5105 28 -3.4 748.3823 4 73.37 3 42877 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 155 182 Deamidation (NQ)
R.C(+58.01)AQGKQFGVSK.A Y 72.01 1209.5812 11 -2.8 605.7961 2 26.81 3 11589 AEV_3_3_RA3_01_1233.d 8.59E4 1 1 128 138 Carboxymethyl
K.GLDTSNLIVQHIQVNQAPK(+14.02).Q Y 71.53 2088.1328 19 -0.6 523.0402 4 76.42 2 37719 AEV_1_3_RA2_01_1232.d 3.8E5 2 2 164 182 Methylation(KR)
R.AVAYLENVMAHKEAVPMR.R Y 70.16 2028.0284 18 9.1 508.0190 4 71.73 3 41617 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 102 119
K.NAEANADTKGLDTSNLIVQHIQVNQAPKQR.R Y 68.32 3272.6860 30 18.8 655.5568 5 69.12 3 39553 AEV_3_3_RA3_01_1233.d 0 1 1 155 184
R.YAAQ(+.98)SIQSTK.S Y 65.22 1096.5400 10 -1.5 549.2765 2 31.60 3 14330 AEV_3_3_RA3_01_1233.d 2.36E5 2 2 62 71 Deamidation (NQ)
R.ETAQAIN(+.98)GWKLQR.A Y 63.15 1514.7841 13 0.3 505.9355 3 62.79 3 34568 AEV_3_3_RA3_01_1233.d 7.68E5 5 5 89 101 Deamidation (NQ)
R.AVAYLE(+14.02)NVMAHK.E Y 62.73 1358.7017 12 -6.2 680.3539 2 69.89 3 40142 AEV_3_3_RA3_01_1233.d 4.38E5 2 2 102 113 Methylation(others)
K.GLDTSNLIVQHIQVNQ(+.98)APK.Q Y 62.28 2075.1011 19 2.5 692.7094 3 75.45 3 44481 AEV_3_3_RA3_01_1233.d 5.15E5 1 1 164 182 Deamidation (NQ)
R.WPVKSAEFLLSLLKNAEANADTK.G Y 59.72 2544.3586 23 6.5 637.1011 4 89.20 3 54273 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 141 163
K.GLDTSNLIVQ(+.98)HIQVNQAPK.Q Y 57.97 2075.1011 19 1.1 692.7084 3 75.89 3 44839 AEV_3_3_RA3_01_1233.d 5.15E5 1 1 164 182 Deamidation (NQ)
R.ETAQAINGWKLQR.A Y 57.61 1513.8000 13 6.0 505.6103 3 63.72 2 28376 AEV_1_3_RA2_01_1232.d 7.57E4 2 2 89 101
K.ARWPVKSAEFLLSLLKNAEANADTK.G Y 57.31 2771.4968 25 3.5 555.3086 5 88.19 3 53702 AEV_3_3_RA3_01_1233.d 4.8E5 2 2 139 163
K.SAE(+14.02)FLLSLLK.N Y 55.79 1133.6696 10 -1.5 567.8412 2 88.16 3 53678 AEV_3_3_RA3_01_1233.d 5.78E5 2 2 145 154 Methylation(others)
K.SAEFLLSLLKNAEANADTK(+14.02).G Y 54.03 2048.0789 19 2.5 683.7020 3 87.49 2 45906 AEV_1_3_RA2_01_1232.d 5.4E4 1 1 145 163 Methylation(KR)
R.SRGSYLR.V Y 51.67 837.4457 7 0.6 419.7303 2 15.65 3 5487 AEV_3_3_RA3_01_1233.d 1.56E6 6 6 75 81
R.C(+57.02)AQGKQFGVSK.A Y 51.60 1208.5972 11 2.6 403.8741 3 20.55 3 8110 AEV_3_3_RA3_01_1233.d 5.05E5 2 2 128 138 Carbamidomethylation
R.VSFKNTR.E Y 49.70 850.4661 7 1.3 426.2408 2 16.12 3 5757 AEV_3_3_RA3_01_1233.d 7.43E5 4 4 82 88
K.GLDTSNLIVQ(+.98)HIQVNQAPKQR.R Y 48.90 2359.2607 21 4.6 590.8252 4 71.58 3 41470 AEV_3_3_RA3_01_1233.d 0 1 1 164 184 Deamidation (NQ)
R.YAAQSIQ(+.98)STK.S Y 45.69 1096.5400 10 -0.4 549.2771 2 35.03 2 13092 AEV_1_3_RA2_01_1232.d 2.95E5 4 4 62 71 Deamidation (NQ)
K.GLDTSNLIVQHIQ(+.98)VNQAPK.Q Y 44.68 2075.1011 19 -22.6 692.6920 3 76.37 2 37683 AEV_1_3_RA2_01_1232.d 8.89E4 2 2 164 182 Deamidation (NQ)
K.NAEANADTKGLDTSNLIVQHIQVNQ(+.98)APK.Q Y 44.24 2989.5105 28 0.3 748.3851 4 73.90 2 35805 AEV_1_3_RA2_01_1232.d 1.49E5 1 1 155 182 Deamidation (NQ)
R.INPYMSSPC(+57.02)HIELILTEGSE(+14.02)EVQKPSTEIK.A Y 42.08 3442.7000 30 -0.6 861.6818 4 81.59 3 49279 AEV_3_3_RA3_01_1233.d 8.02E4 1 1 194 223 Carbamidomethylation; Methylation(others)
R.ETAQAIN(+.98)GWK.L Y 41.93 1117.5404 10 2.6 559.7789 2 52.54 2 21745 AEV_1_3_RA2_01_1232.d 3.88E5 3 3 89 98 Deamidation (NQ)
R.YAAQSIQSTK(+14.02).S Y 41.29 1109.5717 10 45.7 555.8185 2 38.84 3 18718 AEV_3_3_RA3_01_1233.d 0 1 1 62 71 Methylation(KR)
R.ETAQ(+.98)AIN(+.98)GWK.L Y 38.43 1118.5244 10 9.9 560.2750 2 55.09 3 29013 AEV_3_3_RA3_01_1233.d 5.37E4 1 1 89 98 Deamidation (NQ)
R.C(+57.02)AQGKQ(+.98)FGVSK.A Y 38.24 1209.5812 11 4.0 605.8003 2 28.12 2 9863 AEV_1_3_RA2_01_1232.d 4.44E4 1 1 128 138 Carbamidomethylation; Deamidation (NQ)
K.NT(+136.03)RETAQAINGWKLQR.A Y 36.49 2021.0208 16 20.8 506.2729 4 63.77 2 28404 AEV_1_3_RA2_01_1232.d 0 1 1 86 101 O-Diethylphosphorylation
R.AVAYLENVMAHK(+14.02).E Y 36.29 1358.7017 12 -3.9 680.3555 2 69.61 3 39938 AEV_3_3_RA3_01_1233.d 2.13E5 2 2 102 113 Methylation(KR)
R.INPYM(+15.99)SSPC(+57.02)HIELILTEGSEEVQKPSTEIK.A Y 36.26 3444.6792 30 -4.5 862.1732 4 79.73 2 40348 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 194 223 Oxidation (M); Carbamidomethylation
R.IN(+15.00)PYMSSPC(+57.02)HIELILTEGSEEVQKPSTEIK.A Y 36.04 3443.6841 30 2.3 861.9303 4 82.12 3 49682 AEV_3_3_RA3_01_1233.d 0 1 1 194 223 Deamidation followed by a methylation; Carbamidomethylation
K.GLD(+6.01)TSNLIVQHIQVNQAPK.Q Y 34.54 2080.1252 19 -34.0 694.3588 3 75.42 2 36934 AEV_1_3_RA2_01_1232.d 1.07E5 1 1 164 182 Replacement of proton by lithium
R.Q(-17.03)RGAQIR.R Y 33.65 810.4460 7 -8.8 406.2267 2 18.14 2 5631 AEV_1_3_RA2_01_1232.d 4.95E5 3 3 230 236 Pyro-glu from Q
R.YAAQSIQ(+.98)STK(+14.02).S Y 33.15 1110.5557 10 25.4 556.2992 2 47.81 2 19339 AEV_1_3_RA2_01_1232.d 9E4 1 1 62 71 Deamidation (NQ); Methylation(KR)
K.QFGVSK.A Y 31.26 664.3544 6 -89.2 333.1548 2 36.02 1 12245 AEV 2_3_RA2_01_1224.d 1.54E6 5 5 133 138
K.NAE(+14.02)ANADTKGLDTSNLIVQHIQVNQAPK.Q Y 31.26 3002.5420 28 16.6 751.6552 4 74.26 2 36072 AEV_1_3_RA2_01_1232.d 0 1 1 155 182 Methylation(others)
R.ETAQAINGWK(+14.02).L Y 30.17 1130.5720 10 2.2 566.2946 2 61.83 3 33843 AEV_3_3_RA3_01_1233.d 2.98E5 1 1 89 98 Methylation(KR)
K.GLDTSNLIVQ(+.98)HIQ(+.98)VNQAPK.Q Y 28.98 2076.0852 19 -8.5 693.0298 3 76.52 3 45318 AEV_3_3_RA3_01_1233.d 8.6E4 1 1 164 182 Deamidation (NQ)
K.ARWPVKSAEFLLSLLK(+14.02).N Y 28.83 1871.1033 16 7.8 468.7867 4 89.11 3 54216 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 139 154 Methylation(KR)
K.EAVPMR.R Y 27.49 701.3530 6 -13.4 702.3509 1 94.45 2 49136 AEV_1_3_RA2_01_1232.d 1.72E5 2 2 114 119
R.ETAQ(+.98)AINGWKLQR.A Y 26.90 1514.7841 13 -2.8 505.9339 3 64.63 3 35980 AEV_3_3_RA3_01_1233.d 2.32E5 1 1 89 101 Deamidation (NQ)
R.YAAQSIQSTK(+14.96).S Y 25.62 1110.5193 10 -45.0 556.2419 2 59.20 1 25908 AEV 2_3_RA2_01_1224.d 6.68E4 1 1 62 71 Alpha-amino adipic acid
R.RGPS(+79.97)FT(+79.97)TTTVPR.W Y 25.56 1478.6320 12 32.3 370.6772 4 10.01 2 2489 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 36 47 Phosphorylation (STY)
K.QFGVSK(+14.02).A Y 25.30 678.3701 6 -91.4 340.1613 2 49.00 1 19644 AEV 2_3_RA2_01_1224.d 0 1 1 133 138 Methylation(KR)
R.Q(-17.03)RGAQIRR.A Y 25.11 966.5471 8 5.3 323.1913 3 14.76 3 4979 AEV_3_3_RA3_01_1233.d 6.78E5 2 2 230 237 Pyro-glu from Q
M(+15.99)VGPHTVTNK.A Y 24.75 1098.5492 10 -26.3 1099.5276 1 94.91 2 49305 AEV_1_3_RA2_01_1232.d 0 2 2 1 10 Oxidation (M)
M(+31.99)VGPHTVTNKAAK.A Y 24.00 1384.7133 13 0.4 347.1857 4 11.21 3 3114 AEV_3_3_RA3_01_1233.d 0 1 1 1 13 Sulphone
R.ETAQAINGWKLQR(+14.02).A Y 23.77 1527.8158 13 -20.2 510.2689 3 65.29 2 29455 AEV_1_3_RA2_01_1232.d 0 1 1 89 101 Methylation(KR)
R.INPYMS(+13.03)SPC(+57.02)HIELILTEGSEEVQKPSTEIK.A Y 23.22 3441.7158 30 0.8 861.4369 4 82.87 3 50220 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 194 223 Michael addition with methylamine; Carbamidomethylation
K.NAEANADTK(+14.02).G Y 21.65 946.4355 9 -80.2 474.1871 2 20.20 1 4834 AEV 2_3_RA2_01_1224.d 3.96E4 1 1 155 163 Methylation(KR)
K.N(+.98)TRETAQAIN(+.98)GWK.L Y 21.48 1489.7161 13 -114.6 373.3936 4 34.41 1 11416 AEV 2_3_RA2_01_1224.d 4.25E5 1 1 86 98 Deamidation (NQ)
R.ETAQ(+.98)AINGW(+15.99)K.L Y 21.11 1133.5353 10 -68.0 1134.4655 1 102.90 1 56669 AEV 2_3_RA2_01_1224.d 3.79E4 1 1 89 98 Deamidation (NQ); Oxidation (HW)
R.GAQIR.R N 21.09 543.3129 5 -37.0 544.3000 1 25.61 3 10917 AEV_3_3_RA3_01_1233.d 0 1 1 232 236
R.C(+57.02)AQ(+.98)GK.Q Y 21.02 563.2374 5 -24.4 564.2309 1 58.46 1 25406 AEV 2_3_RA2_01_1224.d 9.07E4 1 1 128 132 Carbamidomethylation; Deamidation (NQ)
R.RYAGSTGR.C Y 20.80 866.4359 8 1.0 434.2256 2 9.50 3 2351 AEV_3_3_RA3_01_1233.d 1.1E4 1 1 120 127
K.ARLSSRQRGAQIR.R Y 20.66 1497.8600 13 8.6 300.5818 5 49.63 3 25509 AEV_3_3_RA3_01_1233.d 9.88E4 1 1 224 236
K.N(+162.05)AEANADTK.G Y 20.20 1094.4727 9 -66.3 548.2073 2 50.47 1 20482 AEV 2_3_RA2_01_1224.d 4.87E4 1 1 155 163 Hexose (NSY)
K.Q(-17.03)FGVSK(+14.02).A Y 20.12 661.3435 6 -97.6 662.2863 1 67.72 1 32211 AEV 2_3_RA2_01_1224.d 2.65E5 2 2 133 138 Pyro-glu from Q; Methylation(KR)
R.R(+42.01)R(+31.99)GPSFTTTTVPR.W Y 19.47 1548.8008 13 -1.5 775.4065 2 57.57 3 30636 AEV_3_3_RA3_01_1233.d 0 1 1 35 47 Acetylation (N-term); Dihydroxy
K.GLDTSN(+.98)LIVQHIQVNQAPK.Q Y 19.43 2075.1011 19 10.2 519.7878 4 75.02 3 44138 AEV_3_3_RA3_01_1233.d 3.36E5 1 1 164 182 Deamidation (NQ)
R.ETAQAINGW(+31.99)K.L Y 19.28 1148.5461 10 -4.0 575.2781 2 29.90 2 10662 AEV_1_3_RA2_01_1232.d 7.87E4 1 1 89 98 Dihydroxy
R.GPSFT(+79.97)TTTVPR(+14.02).W Y 19.16 1256.5802 11 17.3 315.1578 4 54.33 1 22758 AEV 2_3_RA2_01_1224.d 0 1 1 37 47 Phosphorylation (STY); Methylation(KR)
R.Y(+314.19)AAQSIQSTK.S Y 18.98 1409.7443 10 -42.4 470.9021 3 35.41 3 16585 AEV_3_3_RA3_01_1233.d 0 1 1 62 71 Levuglandinyl-lysine anhydrolactam adduct
R.T(+42.01)QVRYAAQSIQSTK(+42.01).S Y 18.72 1663.8529 14 3.4 416.9719 4 50.66 2 20866 AEV_1_3_RA2_01_1232.d 7.11E5 1 1 58 71 Acetylation (N-term); Acetylation (K)
R.A(+42.01)ITAA(+21.98) Y 18.66 509.2462 5 -56.8 510.2245 1 67.00 1 31646 AEV 2_3_RA2_01_1224.d 7.6E4 1 1 238 242 Acetylation (N-term); Sodium adduct
R.L(+42.01)SSRQRGAQIR.R Y 18.46 1312.7323 11 1.0 329.1907 4 56.71 3 30009 AEV_3_3_RA3_01_1233.d 5.59E4 1 1 226 236 Acetylation (N-term)
R.G(+42.01)PSFTTTTVPR.W Y 18.14 1204.6088 11 39.8 302.1714 4 12.66 2 3471 AEV_1_3_RA2_01_1232.d 0 1 1 37 47 Acetylation (N-term)
R.YAAQSIQSTK(+21.98)(+14.02).S Y 17.75 1131.5536 10 -72.9 566.7428 2 46.62 1 18235 AEV 2_3_RA2_01_1224.d 6.92E5 3 3 62 71 Sodium adduct; Methylation(KR)
K.S(+13.03)AEFLLSLLK.N Y 17.75 1132.6855 10 -46.5 567.3237 2 88.41 2 46437 AEV_1_3_RA2_01_1232.d 9.19E3 1 1 145 154 Michael addition with methylamine
R.TQVRYAAQSIQSTK(-.98).S Y 17.75 1578.8478 14 6.2 395.7216 4 70.57 2 33277 AEV_1_3_RA2_01_1232.d 0 1 1 58 71 Amidation
M(+42.01)VGPHTVTNK(+226.08).A Y 17.75 1350.6425 10 -12.0 676.3204 2 68.77 3 39269 AEV_3_3_RA3_01_1233.d 0 1 1 1 10 Acetylation (Protein N-term); Biotinylation
R.TQVRYAAQS(+79.97)IQ(+.98)STKSAR.S Y 17.49 1974.9524 17 5.2 494.7479 4 67.44 2 30964 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 58 74 Phosphorylation (STY); Deamidation (NQ)
R.AVAYLENVMAHKEAVPMRR.Y Y 17.45 2184.1296 19 -10.4 437.8287 5 68.71 2 31883 AEV_1_3_RA2_01_1232.d 0 1 1 102 120
K.NTRETAQAINGWK(+21.98).L Y 17.45 1509.7300 13 10.6 504.2560 3 13.45 2 3757 AEV_1_3_RA2_01_1232.d 0 1 1 86 98 Sodium adduct
R.Q(+.98)R(+14.02)GAQIR.R Y 17.45 842.4722 7 -8.1 843.4727 1 83.55 3 50712 AEV_3_3_RA3_01_1233.d 3.67E4 1 1 230 236 Deamidation (NQ); Methylation(KR)
R.AIT(-18.01)AA Y 17.44 427.2431 5 -68.8 428.2209 1 62.20 1 28153 AEV 2_3_RA2_01_1224.d 1.07E5 2 2 238 242 Dehydration
R.SRGSYLR(+14.02).V Y 17.34 851.4613 7 0.8 426.7383 2 23.59 3 9749 AEV_3_3_RA3_01_1233.d 1.48E5 1 1 75 81 Methylation(KR)
K.N(+.98)AEANADTK.G Y 17.33 933.4039 9 -8.7 312.1392 3 29.61 1 8775 AEV 2_3_RA2_01_1224.d 8.03E4 1 1 155 163 Deamidation (NQ)
R.S(+79.96)RGSYLR.V Y 17.20 917.4025 7 131.3 306.8482 3 17.65 2 5418 AEV_1_3_RA2_01_1232.d 9.07E3 1 1 75 81 Sulfation
R.W(+43.01)DASLTYVSR.T Y 17.15 1239.5884 10 -15.2 414.1971 3 60.45 1 26813 AEV 2_3_RA2_01_1224.d 9.66E4 1 1 48 57 Carbamylation
R.RRGPSFTT(+79.97)T(-18.01)TVPR.W Y 17.06 1536.7562 13 26.3 385.2064 4 72.12 3 41893 AEV_3_3_RA3_01_1233.d 5.2E4 1 1 35 47 Phosphorylation (STY); Dehydration
R.Y(+43.01)AGSTGRC(+57.02)AQ(+.98)GK.Q Y 16.95 1298.5674 12 -88.8 650.2333 2 87.96 1 48077 AEV 2_3_RA2_01_1224.d 0 1 1 121 132 Carbamylation; Carbamidomethylation; Deamidation (NQ)
R.RY(-18.01)AGSTGR.C Y 16.85 848.4253 8 -11.1 425.2152 2 23.16 3 9525 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 120 127 Dehydration
R.GPSFTT(-18.01)TTVPR.W Y 16.59 1144.5876 11 -11.8 573.2944 2 43.13 2 17063 AEV_1_3_RA2_01_1232.d 3.47E4 1 1 37 47 Dehydration
K.Q(+.98)FGVS(+79.97)K(+42.01)AR.W Y 16.01 1014.4536 8 71.3 508.2702 2 65.93 2 29899 AEV_1_3_RA2_01_1232.d 0 1 1 133 140 Deamidation (NQ); Phosphorylation (STY); Acetylation (K)
K.Q(+.98)FGVSK.A Y 15.99 665.3384 6 17.1 666.3571 1 28.18 2 9889 AEV_1_3_RA2_01_1232.d 7.08E4 1 1 133 138 Deamidation (NQ)
K.S(+56.06)AEFLLSLLKNAEANADTK.G Y 15.66 2090.1260 19 -1.4 697.7150 3 86.36 3 52610 AEV_3_3_RA3_01_1233.d 0 1 1 145 163 Diethylation
R.A(+27.99)ITAA Y 15.55 473.2485 5 8.9 474.2600 1 44.97 2 17923 AEV_1_3_RA2_01_1232.d 0 2 2 238 242 Formylation
K.L(+42.01)QRAVAYLENVMAHK.E Y 15.10 1783.9403 15 -41.2 892.9407 2 84.88 2 44234 AEV_1_3_RA2_01_1232.d 4.5E4 1 1 99 113 Acetylation (N-term)
K.NAEANADTK.G Y 15.01 932.4199 9 -67.1 467.1860 2 23.80 1 6040 AEV 2_3_RA2_01_1224.d 8.51E4 1 1 155 163
total 103 peptides
C1G3L4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IQTDHIGHTGYINTVTISPDGSLC(+57.02)ASGGK.D Y 140.81 2998.4453 29 3.2 750.6210 4 72.58 2 34799 AEV_1_3_RA2_01_1232.d 5.49E5 3 3 184 212 Carbamidomethylation
R.FSPNPQNPVIVSAGWDKLVK.V Y 122.44 2195.1738 20 1.6 732.7330 3 80.23 2 40744 AEV_1_3_RA2_01_1232.d 5.36E5 3 3 156 175
R.TFVGHTNDVLSVSFSADNRQIVSGSR.D Y 117.18 2792.3840 26 -2.9 699.1013 4 75.91 2 37323 AEV_1_3_RA2_01_1232.d 1.32E5 2 2 100 125
R.GTLEGHNGWVTSLATSLENPNMLLSASR.D Y 116.70 2954.4556 28 -0.4 985.8254 3 87.25 3 53154 AEV_3_3_RA3_01_1233.d 3.18E5 1 1 9 36
R.TFVGHTNDVLSVSFSADNR.Q Y 109.58 2064.9863 19 23.5 517.2660 4 75.79 2 37262 AEV_1_3_RA2_01_1232.d 7.03E5 4 4 100 118
R.SLHGHSHIVSDC(+57.02)VISSDGAYALSSSWDK.T Y 104.43 3014.3828 28 7.2 754.6084 4 73.74 3 43155 AEV_3_3_RA3_01_1233.d 5.74E4 1 1 58 85 Carbamidomethylation
R.DKTLIIWNLTRDDTAYGYPKR.S Y 97.67 2538.3230 21 -9.8 508.6669 5 77.96 2 38939 AEV_1_3_RA2_01_1232.d 6.37E5 5 5 37 57
R.TFVGHTNDVLSVSFSADNRQIVSGSRDR.T Y 92.85 3063.5122 28 -16.0 613.6999 5 73.40 2 35421 AEV_1_3_RA2_01_1232.d 1.19E5 2 2 100 127
K.FTITDKGHTEWVSC(+57.02)VR.F Y 88.34 1934.9309 16 4.2 645.9869 3 67.05 3 37893 AEV_3_3_RA3_01_1233.d 4.49E5 3 3 140 155 Carbamidomethylation
K.SREPEC(+57.02)ISLAWSADGQTLFAGYTDNKIR.A Y 86.44 3184.5247 28 6.4 797.1436 4 81.69 2 41889 AEV_1_3_RA2_01_1232.d 1.68E5 2 2 281 308 Carbamidomethylation
R.FSPNPQNPVIVSAGWDK.L Y 86.44 1854.9264 17 -2.6 928.4681 2 77.23 3 45883 AEV_3_3_RA3_01_1233.d 3.2E5 5 5 156 172
K.VDELKPEYVEK.G Y 81.98 1347.6921 11 0.7 674.8538 2 52.11 3 27180 AEV_3_3_RA3_01_1233.d 1.32E6 7 7 267 277
R.DDTAYGYPKR.S Y 79.60 1184.5461 10 -22.5 593.2670 2 33.19 3 15254 AEV_3_3_RA3_01_1233.d 6.33E5 9 9 48 57
K.SKVDELKPEYVEK.G Y 77.63 1562.8191 13 2.7 521.9484 3 52.65 2 21803 AEV_1_3_RA2_01_1232.d 1.4E6 5 5 265 277
R.GTLEGHNGWVTSLATSLENPNM(+15.99)LLSASR.D Y 77.00 2970.4504 28 2.8 991.1602 3 85.66 3 52140 AEV_3_3_RA3_01_1233.d 1.86E5 2 2 9 36 Oxidation (M)
R.DKTLIIWNLTR.D Y 75.99 1371.7874 11 1.2 458.2703 3 79.78 2 40387 AEV_1_3_RA2_01_1232.d 3.27E5 3 3 37 47
R.LWELATGNTTR.T Y 75.84 1260.6462 11 -2.7 631.3287 2 69.20 3 39608 AEV_3_3_RA3_01_1233.d 1.26E6 3 3 89 99
R.TIKLWNTLGDC(+57.02)K.F Y 75.79 1447.7493 12 14.9 483.5975 3 70.71 3 40857 AEV_3_3_RA3_01_1233.d 0 2 2 128 139 Carbamidomethylation
K.LWNTLGDC(+57.02)K.F Y 65.07 1105.5226 9 1.1 553.7692 2 63.36 3 35011 AEV_3_3_RA3_01_1233.d 3.36E5 2 2 131 139 Carbamidomethylation
R.DDTAYGYPK.R Y 64.57 1028.4451 9 -73.9 515.1918 2 51.40 1 20987 AEV 2_3_RA2_01_1224.d 4.09E5 7 7 48 56
K.VWELSSC(+57.02)R.I Y 60.61 1035.4807 8 3.5 518.7495 2 61.92 2 27135 AEV_1_3_RA2_01_1232.d 1.16E6 4 4 176 183 Carbamidomethylation
R.AWGVVSRT Y 55.16 874.4661 8 -1.0 438.2399 2 52.76 3 27554 AEV_3_3_RA3_01_1233.d 1.99E6 5 5 309 316
K.VDELKPE(+14.02)YVEK.G Y 52.64 1361.7078 11 -2.2 681.8597 2 59.75 3 32232 AEV_3_3_RA3_01_1233.d 3.08E4 2 2 267 277 Methylation(others)
K.KSREPEC(+57.02)ISLAWSADGQTLFAGYTDNKIR.A Y 52.24 3312.6196 29 -23.7 663.5155 5 79.11 3 47376 AEV_3_3_RA3_01_1233.d 0 1 1 280 308 Carbamidomethylation
K.TLIIWNLTR.D Y 50.22 1128.6655 9 -2.9 565.3384 2 82.05 3 49627 AEV_3_3_RA3_01_1233.d 2.08E5 3 3 39 47
R.DKTLIIWNLTRDDTAYGYPK.R Y 46.98 2382.2219 20 -79.0 596.5157 4 86.53 1 46984 AEV 2_3_RA2_01_1224.d 3.09E5 2 2 37 56
K.GHTEWVSC(+57.02)VR.F Y 46.16 1229.5612 10 30.0 615.8063 2 46.77 3 23666 AEV_3_3_RA3_01_1233.d 2.79E4 2 2 146 155 Carbamidomethylation
R.Q(-17.03)IVSGSRDR.T Y 43.09 999.5097 9 8.1 500.7662 2 30.28 2 10881 AEV_1_3_RA2_01_1232.d 5.42E5 2 2 119 127 Pyro-glu from Q
R.IQ(+.98)TDHIGHTGYINTVTISPDGSLC(+57.02)ASGGK.D Y 42.17 2999.4294 29 3.8 750.8675 4 73.68 2 35635 AEV_1_3_RA2_01_1232.d 1.02E5 1 1 184 212 Deamidation (NQ); Carbamidomethylation
R.FSPNPQNPVIVS(+340.09)AGWDK.L Y 41.80 2195.0122 17 -14.9 732.6671 3 85.45 1 46141 AEV 2_3_RA2_01_1224.d 2.56E5 1 1 156 172 Phosphopantetheine
K.DGTTMLWDLNESK.H Y 41.56 1508.6816 13 15.0 755.3594 2 79.79 3 47975 AEV_3_3_RA3_01_1233.d 7.56E4 2 2 213 225
K.VDELKPEYVEK(+14.02).G Y 41.08 1361.7078 11 0.9 681.8618 2 60.71 2 26344 AEV_1_3_RA2_01_1232.d 1.79E5 2 2 267 277 Methylation(KR)
R.GTLEGHNGWVTSLAT(-2.02)SLENPNMLLSASR.D Y 40.68 2952.4399 28 -4.3 985.1497 3 87.50 2 45911 AEV_1_3_RA2_01_1232.d 0 1 1 9 36 2-amino-3-oxo-butanoic_acid
M.A(+42.01)EQLVHR.G Y 40.31 893.4719 7 -1.4 447.7426 2 49.80 3 25643 AEV_3_3_RA3_01_1233.d 4.72E6 8 8 2 8 Acetylation (Protein N-term)
M.A(+42.01)EQ(+.98)LVHR.G Y 37.87 894.4559 7 1.5 448.2359 2 54.19 3 28481 AEV_3_3_RA3_01_1233.d 7.54E5 3 3 2 8 Acetylation (Protein N-term); Deamidation (NQ)
R.QIVSGSRDR.T Y 36.22 1016.5363 9 -15.0 509.2678 2 13.24 3 4165 AEV_3_3_RA3_01_1233.d 3.15E3 2 2 119 127
R.LWE(+14.02)LATGNTTR.T Y 35.50 1274.6619 11 -4.1 638.3356 2 72.26 3 42073 AEV_3_3_RA3_01_1233.d 3.64E4 1 1 89 99 Methylation(others)
K.V(+42.01)DELKPEYVEK.G Y 32.00 1389.7028 11 1.7 464.2423 3 54.76 2 22882 AEV_1_3_RA2_01_1232.d 0 1 1 267 277 Acetylation (N-term)
K.VD(-18.01)ELK(+14.02)PEYVEK.G Y 28.99 1343.6973 11 -10.6 448.9016 3 54.39 2 22698 AEV_1_3_RA2_01_1232.d 1.02E5 1 1 267 277 Dehydration; Methylation(KR)
R.AWGVVSR.T Y 28.95 773.4184 7 5.9 387.7188 2 51.77 2 21343 AEV_1_3_RA2_01_1232.d 7.35E5 3 3 309 315
K.VDELK(+43.01)PEYVEK(+14.02).G Y 28.05 1404.7136 11 22.9 469.2559 3 54.39 2 22696 AEV_1_3_RA2_01_1232.d 0 1 1 267 277 Carbamylation; Methylation(KR)
M.A(+42.01)EQLVHR(+14.02).G Y 27.52 907.4875 7 -1.4 454.7504 2 53.73 3 28187 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 2 8 Acetylation (Protein N-term); Methylation(KR)
K.FTITDK.G Y 27.48 723.3803 6 -90.3 362.6648 2 54.33 1 22754 AEV 2_3_RA2_01_1224.d 1.9E5 2 2 140 145
R.DR(+14.02)T(+79.97)IKLWNT(+79.97)LGDC(+57.02)K.F Y 24.34 1892.8257 14 -10.4 474.2088 4 82.26 1 43599 AEV 2_3_RA2_01_1224.d 1.72E5 1 1 126 139 Methylation(KR); Phosphorylation (STY); Carbamidomethylation
R.AWGVVS(-18.01)R.T Y 24.25 755.4078 7 -42.0 378.6953 2 52.33 1 21549 AEV 2_3_RA2_01_1224.d 4.04E5 1 1 309 315 Dehydration
K.FTITD(-18.01)K.G Y 23.66 705.3698 6 -68.9 353.6678 2 38.19 1 13388 AEV 2_3_RA2_01_1224.d 0 2 2 140 145 Dehydration
R.DK(-1.03)TLIIWNLTRDDTAYGYPK.R Y 22.36 2381.1902 20 24.7 596.3195 4 80.25 3 48262 AEV_3_3_RA3_01_1233.d 2.73E2 2 2 37 56 Lysine oxidation to aminoadipic semialdehyde
K.DGT(+79.97)TMLWDLNES(+79.97)K.H Y 21.73 1668.6144 13 53.8 835.3594 2 92.37 1 51324 AEV 2_3_RA2_01_1224.d 0 1 1 213 225 Phosphorylation (STY)
K.S(-2.02)KVDELKPEYVEK.G Y 21.53 1560.8035 13 -22.7 521.2633 3 50.07 3 25782 AEV_3_3_RA3_01_1233.d 0 1 1 265 277 2-amino-3-oxo-butanoic_acid
K.T(+79.97)LIIWNLTR.D Y 21.36 1208.6318 9 29.9 303.1743 4 37.89 3 18137 AEV_3_3_RA3_01_1233.d 7.44E4 1 1 39 47 Phosphorylation (STY)
K.GK(+27.99)KSREPEC(+57.02)ISLAWSADGQTLFAGY(+79.97)TDNK.I Y 20.68 3336.5122 29 -21.6 835.1173 4 90.29 1 49835 AEV 2_3_RA2_01_1224.d 6.43E5 1 1 278 306 Formylation; Carbamidomethylation; Phosphorylation (STY)
R.LWELATGNT(+14.02)TR.T Y 20.60 1274.6619 11 -9.9 638.3319 2 71.87 2 34282 AEV_1_3_RA2_01_1232.d 2.33E5 1 1 89 99 Methylation(others)
R.Q(+.98)IVSGSR(+14.02).D Y 19.86 760.4079 7 4.1 381.2128 2 20.20 3 7920 AEV_3_3_RA3_01_1233.d 4.86E5 1 1 119 125 Deamidation (NQ); Methylation(KR)
K.FT(+79.96)IT(+79.97)DK.G Y 17.97 883.3035 6 28.5 884.3359 1 94.63 1 52902 AEV 2_3_RA2_01_1224.d 0 1 1 140 145 Sulfation; Phosphorylation (STY)
K.VDELKPEYVEKGK(+31.99)K.S Y 17.77 1692.8933 14 -16.2 847.4402 2 93.22 3 56421 AEV_3_3_RA3_01_1233.d 0 1 1 267 280 Dihydroxy
R.DDTAYGYPK(+42.01).R Y 17.67 1070.4556 9 -9.8 536.2298 2 19.90 1 4750 AEV 2_3_RA2_01_1224.d 3.43E4 1 1 48 56 Acetylation (K)
R.T(+42.01)(+79.97)FVGHTNDVLSVSFSADNR.Q Y 17.46 2186.9634 19 -15.3 729.9839 3 80.41 1 42161 AEV 2_3_RA2_01_1224.d 4.54E4 1 1 100 118 Acetylation (N-term); Phosphorylation (STY)
R.GTLEGHNGWVTSLATSLENPNMLLSASRDK.T Y 16.67 3197.5774 30 -0.6 800.4011 4 86.55 2 45332 AEV_1_3_RA2_01_1232.d 4.57E4 1 1 9 38
K.F(+42.01)TITDK.G Y 15.91 765.3909 6 -31.7 766.3739 1 39.86 3 19318 AEV_3_3_RA3_01_1233.d 0 1 1 140 145 Acetylation (N-term)
K.FTITDK(+114.04).G Y 15.77 837.4232 6 -95.6 419.6789 2 36.43 1 12421 AEV 2_3_RA2_01_1224.d 4.75E4 1 1 140 145 Ubiquitin
R.LWELAT(+79.97)GNTT(+79.97)R(+14.02).T Y 15.29 1434.5946 11 1.3 718.3055 2 84.71 1 45546 AEV 2_3_RA2_01_1224.d 0 1 1 89 99 Phosphorylation (STY); Methylation(KR)
total 61 peptides
C1G371
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.ATQEMLTIVNPYITYGYPNLK.T Y 141.44 2428.2349 21 2.7 810.4211 3 86.63 2 45404 AEV_1_3_RA2_01_1232.d 1.11E6 5 5 127 147
K.FKHFVEGGDLGNREENINALVK.Q Y 114.72 2485.2712 22 -1.2 622.3243 4 69.60 3 39928 AEV_3_3_RA3_01_1233.d 1.34E6 4 4 224 245
R.VALSDNQIIEENLGK.F Y 114.60 1641.8573 15 1.6 821.9373 2 74.93 2 36563 AEV_1_3_RA2_01_1232.d 1.28E6 4 4 166 180
K.FGIVC(+57.02)MEDLIHEIYTVGPNFK.Q Y 109.66 2481.2073 21 -1.3 828.0753 3 93.45 2 48764 AEV_1_3_RA2_01_1232.d 5.47E5 3 3 181 201 Carbamidomethylation
K.HFVEGGDLGNREENINALVK.Q Y 108.59 2210.1079 20 -1.7 553.5333 4 69.13 3 39587 AEV_3_3_RA3_01_1233.d 6.76E5 3 3 226 245
R.LAKQQGNFEVPAEPK.L Y 97.60 1654.8678 15 -2.4 552.6285 3 57.12 3 30305 AEV_3_3_RA3_01_1233.d 3E5 3 3 73 87
K.QASNFLWPFKLSNPTGGFR.T Y 97.55 2166.1011 19 1.4 723.0420 3 84.70 3 51495 AEV_3_3_RA3_01_1233.d 6.65E5 4 4 202 220
R.VALSDNQIIEENLGKFGIVC(+57.02)MEDLIHEIYTVGPNFK.Q Y 94.90 4105.0542 36 2.9 1027.2738 4 97.41 2 50129 AEV_1_3_RA2_01_1232.d 3.61E5 3 3 166 201 Carbamidomethylation
K.ATQEMLTIVN(+.98)PYITYGYPNLK.T Y 92.58 2429.2188 21 10.0 810.7549 3 86.67 2 45412 AEV_1_3_RA2_01_1232.d 1.37E5 1 1 127 147 Deamidation (NQ)
K.Q(-17.03)ASNFLWPFKLSNPTGGFR.T Y 92.13 2149.0745 19 -0.8 1075.5437 2 90.36 3 54919 AEV_3_3_RA3_01_1233.d 9.39E5 5 5 202 220 Pyro-glu from Q
K.QQGNFEVPAEPK.L Y 89.59 1342.6517 12 1.3 672.3340 2 60.57 2 26294 AEV_1_3_RA2_01_1232.d 1.7E6 6 6 76 87
R.LLQINNGVFIR.L Y 89.08 1285.7506 11 2.6 643.8843 2 78.51 2 39377 AEV_1_3_RA2_01_1232.d 9.07E5 6 6 113 123
R.KILQLLRLLQINNGVFIR.L Y 85.80 2150.3416 18 0.7 538.5930 4 88.57 3 53935 AEV_3_3_RA3_01_1233.d 1.69E5 2 2 106 123
R.LTKATQEMLTIVNPYITYGYPNLK.T Y 84.56 2770.4614 24 0.7 924.4951 3 85.69 3 52160 AEV_3_3_RA3_01_1233.d 1.53E5 2 2 124 147
K.Q(-17.03)QGNFEVPAEPK.L Y 82.75 1325.6251 12 2.8 663.8217 2 69.94 2 32846 AEV_1_3_RA2_01_1232.d 2.11E6 5 5 76 87 Pyro-glu from Q
K.Q(-17.03)ASNFLWPFK.L Y 82.03 1219.6025 10 1.4 610.8094 2 91.68 2 48050 AEV_1_3_RA2_01_1232.d 1.98E6 6 6 202 211 Pyro-glu from Q
K.FGIVC(+57.02)M(+15.99)EDLIHEIYTVGPNFK.Q Y 77.53 2497.2021 21 2.2 833.4099 3 86.67 3 52834 AEV_3_3_RA3_01_1233.d 2.19E5 2 2 181 201 Carbamidomethylation; Oxidation (M)
R.KFKHFVEGGDLGNREENINALVK.Q Y 76.64 2613.3662 23 -6.7 523.6770 5 67.58 3 38319 AEV_3_3_RA3_01_1233.d 3.23E5 1 1 223 245
K.QASNFLWPFK.L Y 76.55 1236.6292 10 3.8 619.3242 2 83.60 2 43349 AEV_1_3_RA2_01_1232.d 1.49E6 7 7 202 211
K.Q(-17.03)QGNFEVPAEPK(+14.02).L Y 76.19 1339.6407 12 0.9 670.8282 2 75.18 2 36754 AEV_1_3_RA2_01_1232.d 6.32E5 4 4 76 87 Pyro-glu from Q; Methylation(KR)
R.VALSDNQIIEEN(+.98)LGKFGIVC(+57.02)MEDLIHEIYTVGPNFK.Q Y 76.05 4106.0381 36 -7.6 1027.5090 4 97.03 3 58021 AEV_3_3_RA3_01_1233.d 6.79E4 1 1 166 201 Deamidation (NQ); Carbamidomethylation
K.Q(+.98)QGNFEVPAEPK.L Y 75.54 1343.6357 12 0.3 672.8253 2 61.00 3 33228 AEV_3_3_RA3_01_1233.d 4.13E4 1 1 76 87 Deamidation (NQ)
K.Q(-17.03)QGN(+.98)FEVPAEPK.L Y 75.12 1326.6091 12 -1.8 664.3107 2 71.51 3 41416 AEV_3_3_RA3_01_1233.d 4.37E5 5 5 76 87 Pyro-glu from Q; Deamidation (NQ)
R.AAANAELLKR.K Y 75.06 1055.6086 10 -0.5 528.8113 2 33.52 3 15479 AEV_3_3_RA3_01_1233.d 3.47E6 11 11 29 38
R.AESYVKEYR.D Y 73.84 1143.5560 9 1.5 572.7861 2 30.60 3 13743 AEV_3_3_RA3_01_1233.d 1.5E6 10 10 53 61
K.Q(-17.03)QGNFEVPAEPKLVFVIR.I Y 70.14 2053.0996 18 -4.0 1027.5530 2 85.69 2 44819 AEV_1_3_RA2_01_1232.d 3.1E5 4 4 76 93 Pyro-glu from Q
K.Q(+.98)ASNFLWPFKLSNPTGGFR.T Y 70.07 2167.0850 19 1.0 723.3696 3 85.61 3 52105 AEV_3_3_RA3_01_1233.d 0 2 2 202 220 Deamidation (NQ)
R.VALSDNQIIEE(+14.02)NLGK.F Y 66.61 1655.8729 15 -21.9 828.9256 2 77.00 3 45723 AEV_3_3_RA3_01_1233.d 1.7E4 2 2 166 180 Methylation(others)
R.VALSDNQ(+.98)IIEENLGK.F Y 66.41 1642.8413 15 -2.6 822.4258 2 75.73 3 44701 AEV_3_3_RA3_01_1233.d 6.39E4 1 1 166 180 Deamidation (NQ)
K.QAS(-2.02)NFLWPFKLSNPTGGFR.T Y 65.72 2164.0854 19 5.9 722.3734 3 84.79 3 51551 AEV_3_3_RA3_01_1233.d 7.13E4 1 1 202 220 2-amino-3-oxo-butanoic_acid
K.ATQEMLTIVNPYITYGYPNLK(+14.02).T Y 65.58 2442.2505 21 8.5 815.0977 3 87.60 2 45972 AEV_1_3_RA2_01_1232.d 2.87E5 2 2 127 147 Methylation(KR)
R.LLQINN(+.98)GVFIR.L Y 65.15 1286.7346 11 6.8 429.9217 3 80.59 2 41034 AEV_1_3_RA2_01_1232.d 3.69E5 6 6 113 123 Deamidation (NQ)
K.LSNPTGGFR.T Y 64.47 947.4824 9 -0.6 474.7482 2 47.89 3 24383 AEV_3_3_RA3_01_1233.d 7.66E6 8 8 212 220
R.AESYVKEYRDAEREK.I Y 62.87 1871.9012 15 5.2 375.3895 5 36.80 3 17478 AEV_3_3_RA3_01_1233.d 1.58E6 4 4 53 67
K.LVFVIR.I Y 62.28 745.4850 6 2.4 373.7507 2 73.14 2 35221 AEV_1_3_RA2_01_1232.d 2.39E6 6 6 88 93
M.A(+42.01)TSVPTQDQVLVPETLLK.K Y 62.27 1980.0779 18 2.1 991.0483 2 86.98 2 45635 AEV_1_3_RA2_01_1232.d 2.08E6 4 4 2 19 Acetylation (Protein N-term)
M.A(+42.01)TSVPTQDQVLVPETLLKK.R Y 61.61 2108.1729 19 2.6 703.7334 3 81.77 2 41960 AEV_1_3_RA2_01_1232.d 7.34E5 4 4 2 20 Acetylation (Protein N-term)
K.FKHFVEGGDLGNR(+14.02)EENINALVK.Q Y 61.20 2499.2869 22 0.2 500.8647 5 72.46 3 42161 AEV_3_3_RA3_01_1233.d 3.52E5 1 1 224 245 Methylation(KR)
K.Q(-17.03)Q(+.98)GNFEVPAEPK.L Y 59.56 1326.6091 12 15.2 664.3219 2 70.05 2 32882 AEV_1_3_RA2_01_1232.d 3.18E5 2 2 76 87 Pyro-glu from Q; Deamidation (NQ)
K.Q(-17.03)QGN(+.98)FEVPAEPKLVFVIR.I Y 55.33 2054.0835 18 7.9 685.7072 3 85.70 2 44804 AEV_1_3_RA2_01_1232.d 1.62E5 1 1 76 93 Pyro-glu from Q; Deamidation (NQ)
R.AAANAELLK.R Y 54.63 899.5076 9 -1.7 450.7603 2 40.08 3 19448 AEV_3_3_RA3_01_1233.d 1.77E6 7 7 29 37
K.Q(-17.03)ASNFLWPFK(+14.02).L Y 54.20 1233.6182 10 -18.5 617.8049 2 92.58 3 56114 AEV_3_3_RA3_01_1233.d 6.54E4 2 2 202 211 Pyro-glu from Q; Methylation(KR)
M.A(+42.01)TSVPTQDQVLVPETLLK(+14.02).K Y 53.63 1994.0935 18 2.1 998.0562 2 88.56 3 53930 AEV_3_3_RA3_01_1233.d 8.52E5 5 5 2 19 Acetylation (Protein N-term); Methylation(KR)
K.Q(-17.03)ASN(+.98)FLWPFK.L Y 53.38 1220.5865 10 0.8 611.3010 2 93.10 3 56359 AEV_3_3_RA3_01_1233.d 2.27E5 3 3 202 211 Pyro-glu from Q; Deamidation (NQ)
R.LLQ(+.98)INNGVFIR.L Y 50.09 1286.7346 11 -4.9 644.3715 2 79.02 3 47298 AEV_3_3_RA3_01_1233.d 1.16E4 1 1 113 123 Deamidation (NQ)
K.QAS(-18.01)N(+.98)FLWPFK.L Y 48.66 1219.6025 10 -1.1 1220.6085 1 91.49 3 55529 AEV_3_3_RA3_01_1233.d 2.95E5 1 1 202 211 Dehydration; Deamidation (NQ)
R.AAANAELLK(+14.02).R Y 45.89 913.5233 9 -1.6 457.7682 2 52.61 3 27454 AEV_3_3_RA3_01_1233.d 2.55E5 2 2 29 37 Methylation(KR)
K.QQ(+.98)GNFEVPAEPK.L Y 45.83 1343.6357 12 2.7 672.8270 2 61.39 3 33563 AEV_3_3_RA3_01_1233.d 1.56E5 3 3 76 87 Deamidation (NQ)
K.LSNPTGGFR(+14.02).T Y 44.95 961.4981 9 -1.0 481.7559 2 58.84 3 31586 AEV_3_3_RA3_01_1233.d 5.21E5 3 3 212 220 Methylation(KR)
M.A(+42.01)TSVPTQDQVLVPETLLK(+14.02)K.R Y 43.94 2122.1885 19 -3.6 708.4009 3 83.18 3 50451 AEV_3_3_RA3_01_1233.d 8.67E4 2 2 2 20 Acetylation (Protein N-term); Methylation(KR)
K.QQGNFEVPAE(+14.02)PK.L Y 41.00 1356.6674 12 3.2 679.3431 2 65.56 3 36719 AEV_3_3_RA3_01_1233.d 2.36E5 2 2 76 87 Methylation(others)
R.AESYVKEYRDAER.E Y 40.89 1614.7637 13 10.7 539.2676 3 37.13 3 17671 AEV_3_3_RA3_01_1233.d 1.33E5 2 2 53 65
K.QASN(-17.03)FLWPFK.L Y 38.74 1219.6025 10 -92.6 610.7521 2 96.12 1 53847 AEV 2_3_RA2_01_1224.d 7.53E5 1 1 202 211 Ammonia-loss (N)
K.IAPKPR.K Y 38.64 680.4333 6 -88.6 341.1938 2 23.31 1 5883 AEV 2_3_RA2_01_1224.d 3.94E5 3 3 100 105
R.A(+43.01)AANAELLKR.K Y 33.59 1098.6145 10 2.0 367.2128 3 35.76 2 13431 AEV_1_3_RA2_01_1232.d 3.91E5 1 1 29 38 Carbamylation
R.ELIYKR.G Y 32.80 820.4807 6 -1.1 411.2471 2 26.40 3 11384 AEV_3_3_RA3_01_1233.d 7.56E5 3 3 151 156
R.AVIFK.R Y 32.22 576.3635 5 -5.6 577.3676 1 37.67 3 17991 AEV_3_3_RA3_01_1233.d 1.46E5 4 4 47 51
K.LVFVIR(+14.02).I Y 31.93 759.5007 6 2.9 380.7587 2 76.75 3 45497 AEV_3_3_RA3_01_1233.d 1.35E5 3 3 88 93 Methylation(KR)
K.ILQLLR.L N 31.75 754.5065 6 -4.1 378.2590 2 70.04 2 32870 AEV_1_3_RA2_01_1232.d 1.11E5 2 2 107 112
R.AVIFKR.A Y 31.18 732.4646 6 -1.1 367.2392 2 28.45 3 12500 AEV_3_3_RA3_01_1233.d 2.98E5 2 2 47 52
K.LSN(+.98)PTGGFR.T Y 30.77 948.4665 9 -69.3 475.2077 2 60.81 1 27080 AEV 2_3_RA2_01_1224.d 1.65E5 1 1 212 220 Deamidation (NQ)
R.VALSDNQIIEEN(+.98)LGK.F Y 28.24 1642.8413 15 -5.0 822.4238 2 76.22 2 37566 AEV_1_3_RA2_01_1232.d 6.07E4 1 1 166 180 Deamidation (NQ)
M.A(+42.01)TSVPTQ(+.98)DQVLVPETLLK.K Y 27.65 1981.0619 18 3.1 991.5413 2 87.94 2 46162 AEV_1_3_RA2_01_1232.d 1.56E5 1 1 2 19 Acetylation (Protein N-term); Deamidation (NQ)
K.FGIVC(+57.02)MEDLIHE(+14.02)IYTVGPNFK.Q Y 27.10 2495.2229 21 4.9 832.7523 3 95.01 2 49341 AEV_1_3_RA2_01_1232.d 6.57E4 1 1 181 201 Carbamidomethylation; Methylation(others)
K.Q(+.98)Q(+.98)GNFEVPAEPK.L Y 26.78 1344.6198 12 15.1 673.3273 2 61.45 3 33549 AEV_3_3_RA3_01_1233.d 2.98E5 1 1 76 87 Deamidation (NQ)
K.QQGNFEVPAEPK(+14.02).L Y 25.81 1356.6674 12 -17.7 679.3289 2 66.60 3 37543 AEV_3_3_RA3_01_1233.d 8.41E4 1 1 76 87 Methylation(KR)
K.QQGNFE(+14.02)VPAEPK.L Y 25.55 1356.6674 12 -0.4 679.3407 2 63.29 3 34960 AEV_3_3_RA3_01_1233.d 2.92E5 2 2 76 87 Methylation(others)
K.FKHFVE(+14.02)GGDLGNREENINALVK.Q Y 25.51 2499.2869 22 -11.5 625.8218 4 71.55 3 41446 AEV_3_3_RA3_01_1233.d 4.38E5 2 2 224 245 Methylation(others)
R.EEN(+.98)IN(+.98)ALVK.Q Y 25.07 1030.5182 9 -14.0 516.2592 2 59.46 3 32010 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 237 245 Deamidation (NQ)
K.HFVEGGDLGNR(+14.02)EENINALVK.Q Y 25.04 2224.1235 20 -5.5 742.3777 3 71.60 3 41488 AEV_3_3_RA3_01_1233.d 1E5 2 2 226 245 Methylation(KR)
R.AESYVKEYR(+14.02)DAEREK.I Y 24.89 1885.9169 15 4.3 472.4885 4 44.85 3 22461 AEV_3_3_RA3_01_1233.d 9.79E4 2 2 53 67 Methylation(KR)
K.Q(-17.03)ASNFLWPFKLSNPTGGFR(+14.02).T Y 24.89 2163.0901 19 -8.9 1082.5427 2 90.84 3 55179 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 202 220 Pyro-glu from Q; Methylation(KR)
R.E(+42.01)ENINALVK(+226.08).Q Y 23.94 1296.6383 9 13.2 433.2258 3 47.78 2 19324 AEV_1_3_RA2_01_1232.d 5.44E4 1 1 237 245 Acetylation (N-term); Biotinylation
K.QQGNFEVPAEP(+13.98)K.L Y 23.53 1356.6310 12 -58.6 679.2830 2 70.01 1 33965 AEV 2_3_RA2_01_1224.d 7.55E4 1 1 76 87 Proline oxidation to pyroglutamic acid
K.LSNPTGGFRTR.K Y 23.14 1204.6312 11 -0.4 402.5508 3 42.85 3 21196 AEV_3_3_RA3_01_1233.d 2.41E5 1 1 212 222
R.ELIYK.R Y 22.27 664.3795 5 -33.6 665.3645 1 86.22 2 45124 AEV_1_3_RA2_01_1232.d 5.82E4 1 1 151 155
R.AAANAELLK(+43.99).R Y 22.22 943.4974 9 7.1 315.5087 3 29.01 3 12820 AEV_3_3_RA3_01_1233.d 9.91E4 1 1 29 37 Carboxylation (DKW)
K.ATQEMLTIVN(+15.00)PYITYGYPNLK.T Y 22.17 2443.2344 21 4.5 815.4224 3 83.67 3 50784 AEV_3_3_RA3_01_1233.d 0 1 1 127 147 Deamidation followed by a methylation
R.KILQLLR.L Y 22.03 882.6014 7 -27.6 442.2958 2 64.18 3 35643 AEV_3_3_RA3_01_1233.d 0 1 1 106 112
R.AAAN(+.98)AELLK.R Y 21.94 900.4916 9 -7.1 451.2499 2 42.54 2 16733 AEV_1_3_RA2_01_1232.d 1.04E5 3 3 29 37 Deamidation (NQ)
R.LLQIN(+.98)N(+.98)GVFIR.L Y 21.92 1287.7186 11 -26.8 644.8494 2 81.39 2 41655 AEV_1_3_RA2_01_1232.d 5.78E4 1 1 113 123 Deamidation (NQ)
R.KFKHFVEGGDLGNREENINALVK(-2.02).Q Y 21.84 2611.3506 23 7.9 523.2815 5 67.76 3 38459 AEV_3_3_RA3_01_1233.d 0 1 1 223 245 2-amino-3-oxo-butanoic_acid
R.AE(+43.99)SYVKEYR.D Y 21.66 1187.5458 9 88.7 396.8910 3 30.57 3 13727 AEV_3_3_RA3_01_1233.d 0 1 1 53 61 Carboxylation (E)
K.ATQEMLTIVN(+.98)PYITYGYPNLKTVR.E Y 21.60 2785.4360 24 5.5 929.4910 3 84.06 2 43654 AEV_1_3_RA2_01_1232.d 1.05E4 1 1 127 150 Deamidation (NQ)
R.IKGINK.I Y 21.18 671.4330 6 1.8 336.7244 2 12.78 2 3510 AEV_1_3_RA2_01_1232.d 4.55E4 1 1 94 99
K.H(+27.99)FVEGGDLGNR.E Y 21.06 1227.5632 11 -32.5 410.1817 3 49.92 1 20198 AEV 2_3_RA2_01_1224.d 0 1 1 226 236 Formylation
K.QAS(-20.03)NFLWPFK.L Y 20.58 1216.6029 10 9.0 609.3142 2 91.59 2 47990 AEV_1_3_RA2_01_1232.d 0 1 1 202 211 Formation of five membered aromatic heterocycle
K.SQEQARAAANAELLK(+226.08).R Y 20.39 1824.9152 15 1.4 457.2367 4 27.87 2 9759 AEV_1_3_RA2_01_1232.d 0 1 1 23 37 Biotinylation
K.T(+27.99)VRELIYKR.G Y 20.32 1204.6927 9 21.2 302.1869 4 26.62 3 11491 AEV_3_3_RA3_01_1233.d 0 1 1 148 156 Formylation
R.E(-18.01)LIYKR.G Y 20.23 802.4701 6 3.3 402.2437 2 26.67 3 11511 AEV_3_3_RA3_01_1233.d 2.71E5 2 2 151 156 Pyro-glu from E
K.HFVEGGD(+43.04)LGNREENINALVK.Q Y 19.93 2253.1501 20 2.1 564.2960 4 70.13 2 32946 AEV_1_3_RA2_01_1232.d 0 1 1 226 245 Carboxyl modification with ethanolamine
R.KS(+79.96)QEQARAAANAELLK(+42.01).R Y 19.78 1848.8999 16 -33.7 463.2167 4 21.43 2 6986 AEV_1_3_RA2_01_1232.d 4.64E4 1 1 22 37 Sulfation; Acetylation (K)
R.AAANAE(+43.99)LLKR.K Y 19.77 1099.5985 10 -16.2 367.5342 3 33.73 3 15573 AEV_3_3_RA3_01_1233.d 9.38E4 1 1 29 38 Carboxylation (E)
R.LLQ(+.98)INNGVFIR(+31.99).L Y 19.21 1318.7245 11 -25.3 330.6801 4 52.27 3 27232 AEV_3_3_RA3_01_1233.d 6.75E4 1 1 113 123 Deamidation (NQ); Dihydroxy
R.KSQEQAR.A Y 18.98 845.4355 7 -45.7 423.7057 2 58.27 1 25280 AEV 2_3_RA2_01_1224.d 2.51E4 1 1 22 28
R.AES(+79.96)YVKEYR.D Y 18.77 1223.5128 9 115.7 408.8921 3 30.44 3 13637 AEV_3_3_RA3_01_1233.d 1.69E5 1 1 53 61 Sulfation
K.LSNPTGGF(+31.99)RTRK.F Y 17.88 1364.7161 12 -15.7 342.1809 4 14.60 3 4887 AEV_3_3_RA3_01_1233.d 2.25E4 1 1 212 223 Dihydroxy
R.LLQINN(-17.03)GVFIR.L Y 17.81 1268.7241 11 -25.1 635.3534 2 80.74 2 41147 AEV_1_3_RA2_01_1232.d 0 1 1 113 123 Ammonia-loss (N)
K.EY(-18.01)RDAEREK.I Y 17.60 1176.5522 9 8.1 393.1945 3 10.12 2 2529 AEV_1_3_RA2_01_1232.d 1.94E4 1 1 59 67 Dehydration
K.RAE(+21.98)SYVKEYR.D Y 17.59 1321.6390 10 -3.5 1322.6417 1 76.99 2 38174 AEV_1_3_RA2_01_1232.d 1.88E5 1 1 52 61 Sodium adduct
R.AVIFKRAESYVK(+42.01).E Y 17.05 1451.8136 12 -14.4 363.9554 4 46.70 2 18780 AEV_1_3_RA2_01_1232.d 8.52E3 1 1 47 58 Acetylation (K)
K.ATQEMLTIVNPYITYGYPNLK(-.98).T Y 16.86 2427.2507 21 -5.8 810.0861 3 86.57 2 45347 AEV_1_3_RA2_01_1232.d 2.23E5 1 1 127 147 Amidation
K.EYRD(-18.01)AEREKIR.L Y 16.56 1445.7374 11 9.5 362.4451 4 19.82 3 7734 AEV_3_3_RA3_01_1233.d 2.55E5 1 1 59 69 Dehydration
K.EYRDAEREK.I Y 16.54 1194.5629 9 12.2 598.2960 2 10.36 3 2701 AEV_3_3_RA3_01_1233.d 6.97E3 1 1 59 67
R.AAANAELLK(+21.98).R Y 16.33 921.4896 9 -24.9 308.1628 3 8.94 2 2133 AEV_1_3_RA2_01_1232.d 0 1 1 29 37 Sodium adduct
R.AESYVKEYR(+14.02).D Y 15.30 1157.5717 9 20.3 386.8723 3 41.90 2 16409 AEV_1_3_RA2_01_1232.d 0 1 1 53 61 Methylation(KR)
R.KSQEQAR(+14.02)AAANAELLK.R Y 15.15 1740.9482 16 -5.9 436.2418 4 58.32 3 31177 AEV_3_3_RA3_01_1233.d 0 1 1 22 37 Methylation(KR)
R.AAANAELLK(+183.04)RK.K Y 15.13 1366.7390 11 3.5 684.3792 2 76.96 2 38149 AEV_1_3_RA2_01_1232.d 0 1 1 29 39 Aminoethylbenzenesulfonylation
K.S(-18.01)QEQ(+.98)AR.A Y 15.03 700.3140 6 -2.8 351.1633 2 30.54 1 9244 AEV 2_3_RA2_01_1224.d 4.04E5 1 1 23 28 Dehydration; Deamidation (NQ)
total 109 peptides
C1G942
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.KKANVDEFPLC(+57.02)VHMVSNEYEQLSSEALEAAR.I Y 127.57 3563.7024 31 -5.2 713.7440 5 83.39 2 43159 AEV_1_3_RA2_01_1232.d 4.43E5 3 3 39 69 Carbamidomethylation
R.VNIGQILLSVR.T Y 114.27 1210.7397 11 -0.7 606.3767 2 84.77 2 44186 AEV_1_3_RA2_01_1232.d 1.01E7 12 12 129 139
K.ANVDEFPLC(+57.02)VHMVSNEYEQLSSEALEAAR.I Y 113.81 3307.5125 29 0.3 1103.5117 3 88.08 3 53659 AEV_3_3_RA3_01_1233.d 4.79E5 3 3 41 69 Carbamidomethylation
R.VKIDGAYVQFLR.N Y 110.23 1407.7874 12 -0.8 470.2693 3 76.58 2 37865 AEV_1_3_RA2_01_1232.d 5E6 10 10 190 201
K.MLSC(+57.02)AGADRLQTGMR.G Y 102.74 1665.7749 15 0.1 556.2656 3 61.05 3 33224 AEV_3_3_RA3_01_1233.d 1.04E6 4 4 102 116 Carbamidomethylation
R.FPEAYENLS(+79.97)QV Y 97.11 1375.5697 11 3.7 688.7947 2 83.27 2 43073 AEV_1_3_RA2_01_1232.d 1.31E6 5 5 213 223 Phosphorylation (STY)
K.IDGAYVQFLR.N Y 93.23 1180.6240 10 1.0 591.3199 2 77.93 2 38915 AEV_1_3_RA2_01_1232.d 5.53E5 3 3 192 201
R.NKGNIEENMK.R Y 91.24 1175.5604 10 3.3 588.7894 2 17.60 3 6543 AEV_3_3_RA3_01_1233.d 5.1E5 4 4 202 211
K.RFPEAYENLS(+79.97)QV Y 91.03 1531.6708 12 0.4 766.8430 2 78.73 2 39545 AEV_1_3_RA2_01_1232.d 2.5E6 6 6 212 223 Phosphorylation (STY)
R.GAFGKPNGTVAR.V Y 89.46 1173.6254 12 -1.1 392.2153 3 30.94 3 13925 AEV_3_3_RA3_01_1233.d 5.61E6 11 11 117 128
K.KANVDEFPLC(+57.02)VHMVSNEYEQLSSEALEAAR.I Y 85.79 3435.6074 30 3.9 1146.2142 3 85.28 3 51891 AEV_3_3_RA3_01_1233.d 3.72E4 1 1 40 69 Carbamidomethylation
K.M(+15.99)LSC(+57.02)AGADRLQTGMR.G Y 83.53 1681.7698 15 5.7 561.6004 3 58.08 2 24726 AEV_1_3_RA2_01_1232.d 7.82E5 4 4 102 116 Oxidation (M); Carbamidomethylation
R.KKANVDEFPLC(+57.02)VHMVSNEY(-2.02)EQLSSEALEAAR.I Y 82.88 3561.6868 31 27.6 713.3643 5 83.00 3 50313 AEV_3_3_RA3_01_1233.d 1.37E4 1 1 39 69 Carbamidomethylation; 2-amino-3-oxo-butanoic_acid
R.SMYKFPGR.Q Y 82.61 984.4851 8 3.1 493.2514 2 53.38 2 22179 AEV_1_3_RA2_01_1232.d 2.05E6 11 11 155 162
R.VNIGQILLSVR(+14.02).T Y 81.87 1224.7554 11 -0.4 613.3847 2 87.88 2 46139 AEV_1_3_RA2_01_1232.d 1.2E6 3 3 129 139 Methylation(KR)
R.AHPYHVVR.I Y 80.77 977.5195 8 2.7 489.7684 2 16.33 3 5869 AEV_3_3_RA3_01_1233.d 5.08E6 14 14 91 98
R.GAFGKPN(+.98)GTVAR.V Y 80.68 1174.6094 12 -0.1 392.5437 3 36.93 2 14030 AEV_1_3_RA2_01_1232.d 1.19E7 30 30 117 128 Deamidation (NQ)
R.DAHRATAVEALRR.S Y 79.85 1464.7909 13 1.9 489.2718 3 30.77 3 13823 AEV_3_3_RA3_01_1233.d 1.86E6 6 6 142 154
R.VRAHPYHVVR.I Y 78.61 1232.6890 10 -5.4 411.9014 3 22.36 3 9141 AEV_3_3_RA3_01_1233.d 3.42E6 12 12 89 98
R.VKIDGAYVQ(+.98)FLR.N Y 77.81 1408.7714 12 9.5 470.6022 3 76.12 3 45015 AEV_3_3_RA3_01_1233.d 3.82E5 2 2 190 201 Deamidation (NQ)
R.VKIDGAYVQFLR(+14.02).N Y 76.52 1421.8030 12 4.9 474.9439 3 78.41 2 39294 AEV_1_3_RA2_01_1232.d 6.06E5 2 2 190 201 Methylation(KR)
R.IC(+57.02)ANKYLVK.I Y 76.45 1107.6111 9 -0.4 554.8126 2 45.85 3 23082 AEV_3_3_RA3_01_1233.d 6.18E6 10 10 70 78 Carbamidomethylation
K.IAGKEGFHLR.V Y 74.72 1126.6246 10 0.4 564.3198 2 40.45 3 19663 AEV_3_3_RA3_01_1233.d 3.55E6 15 15 79 88
K.M(+15.99)LSC(+57.02)AGADR.L Y 74.34 995.4164 9 -84.2 498.6736 2 28.07 1 8003 AEV 2_3_RA2_01_1224.d 1.55E6 31 31 102 110 Oxidation (M); Carbamidomethylation
K.ANVDEFPLC(+57.02)VHM(+15.99)VSNEYEQLSSEALEAAR.I Y 73.99 3323.5073 29 -1.5 1108.8414 3 86.09 3 52433 AEV_3_3_RA3_01_1233.d 8.5E4 1 1 41 69 Carbamidomethylation; Oxidation (M)
R.YC(+57.02)KNKPYPK.S Y 72.66 1196.6012 9 -2.9 599.3062 2 12.60 3 3814 AEV_3_3_RA3_01_1233.d 2.44E4 1 1 11 19 Carbamidomethylation
R.NKGNIEENM(+15.99)KR.F Y 68.84 1347.6565 11 7.9 450.2296 3 9.68 2 2373 AEV_1_3_RA2_01_1232.d 7.41E4 3 3 202 212 Oxidation (M)
R.KKANVDEFPLC(+57.02)VHMVSNEYE(+14.02)QLSSEALEAAR.I Y 68.36 3577.7180 31 13.9 716.5608 5 83.46 3 50637 AEV_3_3_RA3_01_1233.d 3.08E5 1 1 39 69 Carbamidomethylation; Methylation(others)
K.MLSC(+57.02)AGADR.L Y 67.46 979.4215 9 2.3 490.7192 2 27.83 3 12140 AEV_3_3_RA3_01_1233.d 5.44E5 4 4 102 110 Carbamidomethylation
K.IRIFDLGR.K Y 67.33 988.5818 8 3.5 330.5357 3 73.19 2 35263 AEV_1_3_RA2_01_1232.d 2.73E6 10 10 31 38
R.NKGNIEENM(+15.99)K.R Y 65.71 1191.5554 10 1.1 596.7856 2 9.84 2 2428 AEV_1_3_RA2_01_1232.d 2.27E5 5 5 202 211 Oxidation (M)
R.DAHRATAVEALR.R Y 65.13 1308.6898 12 2.4 437.2383 3 33.76 3 15591 AEV_3_3_RA3_01_1233.d 3.63E5 4 4 142 153
K.NWGFTPLRREEYVR.L Y 64.97 1821.9274 14 3.4 456.4907 4 71.00 2 33623 AEV_1_3_RA2_01_1232.d 7.11E5 2 2 170 183
R.VNIGQ(+.98)ILLSVR.T Y 63.08 1211.7238 11 4.8 606.8721 2 85.80 2 44839 AEV_1_3_RA2_01_1232.d 5.5E5 3 3 129 139 Deamidation (NQ)
R.GAFGKPN(+.98)GTVAR(+14.02).V Y 62.32 1188.6251 12 -1.6 397.2150 3 43.66 3 21717 AEV_3_3_RA3_01_1233.d 6.78E5 4 4 117 128 Deamidation (NQ); Methylation(KR)
K.MLSC(+57.02)AGADR(+.98)LQTGMR.G Y 61.66 1666.7589 15 10.0 556.5991 3 61.18 3 33327 AEV_3_3_RA3_01_1233.d 1.53E5 1 1 102 116 Carbamidomethylation; Deamidation (R)
K.RFPEAYENLSQV Y 60.57 1451.7045 12 -2.2 726.8579 2 74.68 3 43893 AEV_3_3_RA3_01_1233.d 4.15E5 4 4 212 223
R.NKGNIEENMKR.F Y 60.37 1331.6616 11 -1.9 666.8368 2 16.91 3 6153 AEV_3_3_RA3_01_1233.d 3.34E5 2 2 202 212
R.ATAVEALRR.S Y 58.75 985.5668 9 4.9 493.7931 2 32.58 2 11972 AEV_1_3_RA2_01_1232.d 5.99E6 10 10 146 154
R.Q(-17.03)KIIVSK.N Y 58.66 797.5010 7 3.5 399.7592 2 39.44 2 15229 AEV_1_3_RA2_01_1232.d 2.33E6 7 7 163 169 Pyro-glu from Q
K.ANVDEFPLC(+57.02)VHMVSNEYEQLSSE(+14.02)ALEAAR.I Y 58.21 3321.5281 29 4.9 1108.1887 3 89.37 3 54364 AEV_3_3_RA3_01_1233.d 9.03E4 1 1 41 69 Carbamidomethylation; Methylation(others)
R.G(+42.01)AFGKPNGTVAR.V Y 57.69 1215.6360 12 -5.5 406.2170 3 33.01 2 12122 AEV_1_3_RA2_01_1232.d 4.57E5 1 1 117 128 Acetylation (N-term)
K.ANVDEFPLC(+57.02)VHMVSNEYEQLSSEALEAAR(+14.02).I Y 57.55 3321.5281 29 0.6 1108.1840 3 88.40 3 53829 AEV_3_3_RA3_01_1233.d 1.69E5 3 3 41 69 Carbamidomethylation; Methylation(KR)
R.DAHR(+14.02)ATAVEALRR.S Y 55.37 1478.8065 13 -33.3 370.6966 4 30.92 3 13912 AEV_3_3_RA3_01_1233.d 9.18E5 1 1 142 154 Methylation(KR)
K.NWGFTPLR.R Y 55.06 989.5083 8 2.9 495.7629 2 75.65 2 37112 AEV_1_3_RA2_01_1232.d 9.01E5 5 5 170 177
K.IRIFDLGR(+14.02).K Y 55.06 1002.5974 8 2.8 335.2073 3 73.37 2 35412 AEV_1_3_RA2_01_1232.d 3.6E5 3 3 31 38 Methylation(KR)
K.IDGAYVQFLR(+14.02).N Y 53.17 1194.6396 10 -5.8 598.3236 2 79.82 3 47925 AEV_3_3_RA3_01_1233.d 1.36E5 2 2 192 201 Methylation(KR)
R.GAFGKPNGTVAR(+14.02).V Y 53.15 1187.6411 12 -0.4 594.8276 2 37.99 3 18197 AEV_3_3_RA3_01_1233.d 1.86E5 3 3 117 128 Methylation(KR)
K.RFPEAYEN(+.98)LS(+79.97)QV Y 53.03 1532.6548 12 11.4 767.3434 2 78.62 3 46996 AEV_3_3_RA3_01_1233.d 2.45E5 1 1 212 223 Deamidation (NQ); Phosphorylation (STY)
R.IFDLGR.K Y 52.53 719.3966 6 -4.2 360.7041 2 64.23 3 35723 AEV_3_3_RA3_01_1233.d 5.18E6 8 8 33 38
R.VN(+.98)IGQILLSVR.T Y 50.83 1211.7238 11 4.7 606.8720 2 86.24 2 45133 AEV_1_3_RA2_01_1232.d 2.89E5 2 2 129 139 Deamidation (NQ)
R.V(+43.01)K(+14.02)IDGAYVQFLR.N Y 50.69 1464.8088 12 -3.4 489.2752 3 76.87 3 45593 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 190 201 Carbamylation; Methylation(KR)
R.FPEAYENLSQV Y 49.83 1295.6034 11 -84.8 648.7540 2 82.52 1 43854 AEV 2_3_RA2_01_1224.d 2.6E5 3 3 213 223
R.VKID(-18.01)GAYVQFLR.N Y 49.67 1389.7769 12 -4.7 464.2640 3 78.74 2 39552 AEV_1_3_RA2_01_1232.d 8.43E4 2 2 190 201 Dehydration
K.NWGFTPLRR.E Y 48.27 1145.6094 9 -3.3 382.8758 3 66.99 3 37847 AEV_3_3_RA3_01_1233.d 9.85E5 4 4 170 178
R.KKANVDEFPLC(+57.02)VHMVSN(+.98)EYEQLSSEALEAAR.I Y 48.07 3564.6865 31 -2.6 1189.2330 3 82.97 3 50292 AEV_3_3_RA3_01_1233.d 6.98E3 1 1 39 69 Carbamidomethylation; Deamidation (NQ)
R.KK(+14.02)AN(+.98)VDEFPLC(+57.02)VHMVSNEYEQLSSEALEAAR.I Y 47.94 3578.7021 31 -10.9 716.7399 5 85.31 2 44525 AEV_1_3_RA2_01_1232.d 0 1 1 39 69 Methylation(KR); Deamidation (NQ); Carbamidomethylation
R.FNRGVPDAK.I Y 47.42 1002.5247 9 0.7 502.2700 2 24.99 3 10565 AEV_3_3_RA3_01_1233.d 3.75E5 5 5 22 30
R.GAFGK(+42.01)PNGTVAR.V Y 46.37 1215.6360 12 -81.0 406.1865 3 49.99 1 20240 AEV 2_3_RA2_01_1224.d 2.59E4 1 1 117 128 Acetylation (K)
K.IIVSKNWGFTPLR.R Y 46.11 1529.8718 13 -29.1 510.9497 3 76.17 3 45051 AEV_3_3_RA3_01_1233.d 0 1 1 165 177
R.ATAVEALR.R Y 45.67 829.4658 8 4.8 415.7421 2 38.27 2 14642 AEV_1_3_RA2_01_1232.d 1.57E6 8 8 146 153
R.NKGNIEENMKRFPEAYENLS(+79.97)QV Y 44.40 2689.2207 22 3.2 673.3146 4 76.25 3 45110 AEV_3_3_RA3_01_1233.d 3.16E5 1 1 202 223 Phosphorylation (STY)
K.ANVDEFPLC(+57.02)VHMVSN(+15.00)EYEQLSSEALEAAR.I Y 43.80 3322.5122 29 7.8 1108.5200 3 88.85 3 54084 AEV_3_3_RA3_01_1233.d 0 1 1 41 69 Carbamidomethylation; Deamidation followed by a methylation
R.SM(+15.99)YKFPGR.Q Y 43.52 1000.4800 8 -85.1 501.2047 2 57.78 1 24931 AEV 2_3_RA2_01_1224.d 1.58E6 13 13 155 162 Oxidation (M)
K.NWGFTPLR(+14.02)REEYVR.L Y 42.11 1835.9430 14 2.5 459.9942 4 74.03 2 35895 AEV_1_3_RA2_01_1232.d 1.43E5 1 1 170 183 Methylation(KR)
K.ID(-18.01)GAYVQFLR.N Y 41.81 1162.6134 10 15.8 582.3232 2 86.44 2 45261 AEV_1_3_RA2_01_1232.d 1.99E4 1 1 192 201 Dehydration
K.EGFHLR.V Y 41.17 757.3871 6 3.6 379.7022 2 37.75 2 14429 AEV_1_3_RA2_01_1232.d 1.62E6 8 8 83 88
K.IAGKE(+14.02)GFHLR.V Y 40.48 1140.6404 10 1.1 381.2212 3 53.55 2 22262 AEV_1_3_RA2_01_1232.d 2.83E5 1 1 79 88 Methylation(others)
K.R(+14.02)FPEAYENLS(+79.97)QV Y 40.03 1545.6864 12 19.6 773.8656 2 80.55 3 48496 AEV_3_3_RA3_01_1233.d 4.44E5 3 3 212 223 Methylation(KR); Phosphorylation (STY)
K.ANVDEFPLC(+57.02)VHMVSNEYEQ(+.98)LSSEALEAAR.I Y 39.23 3308.4966 29 -13.9 1103.8241 3 88.54 3 53921 AEV_3_3_RA3_01_1233.d 0 1 1 41 69 Carbamidomethylation; Deamidation (NQ)
K.NKPYPK.S Y 38.13 745.4122 6 -85.6 373.6815 2 20.27 1 4853 AEV 2_3_RA2_01_1224.d 2.33E5 3 3 14 19
K.NWGFTPLRREEYVR(+14.02).L Y 37.34 1835.9430 14 -7.0 459.9898 4 71.83 3 41668 AEV_3_3_RA3_01_1233.d 3.6E5 1 1 170 183 Methylation(KR)
K.I(+43.01)RIFDLGR.K Y 37.09 1031.5875 8 13.1 344.8743 3 72.79 2 34959 AEV_1_3_RA2_01_1232.d 6.99E4 1 1 31 38 Carbamylation
K.IRIFD(+14.02)LGR.K Y 35.56 1002.5974 8 -16.3 335.2010 3 73.45 3 42941 AEV_3_3_RA3_01_1233.d 7.7E4 2 2 31 38 Methylation(others)
K.GNIEENMK.R Y 35.37 933.4225 8 0.8 467.7189 2 24.94 3 10534 AEV_3_3_RA3_01_1233.d 5.16E4 1 1 204 211
R.C(+57.02)YRYC(+57.02)K.N Y 33.74 948.3946 6 20.9 475.2145 2 13.53 3 4342 AEV_3_3_RA3_01_1233.d 2.15E4 2 2 8 13 Carbamidomethylation
R.GAFGKPN(+15.00)GTVAR.V Y 33.24 1188.6251 12 5.0 397.2176 3 38.35 3 18406 AEV_3_3_RA3_01_1233.d 0 1 1 117 128 Deamidation followed by a methylation
R.ATAVE(+14.02)ALRR.S Y 33.02 999.5825 9 -5.9 500.7956 2 37.49 2 14305 AEV_1_3_RA2_01_1232.d 2.02E5 2 2 146 154 Methylation(others)
K.I(+43.01)R(+14.02)IFDLGR.K Y 33.01 1045.6033 8 2.8 349.5427 3 73.93 2 35825 AEV_1_3_RA2_01_1232.d 2.1E5 3 3 31 38 Carbamylation; Methylation(KR)
R.IFDLGR(+14.02).K Y 32.91 733.4122 6 -3.9 367.7119 2 66.51 3 37466 AEV_3_3_RA3_01_1233.d 7.78E5 4 4 33 38 Methylation(KR)
R.IC(+57.02)AN(+.98)KYLVK.I Y 32.44 1108.5951 9 15.6 370.5447 3 45.78 3 23047 AEV_3_3_RA3_01_1233.d 5.18E5 1 1 70 78 Carbamidomethylation; Deamidation (NQ)
R.G(+42.01)AFGKPN(+.98)GTVAR.V Y 31.67 1216.6200 12 24.9 406.5574 3 36.81 2 13923 AEV_1_3_RA2_01_1232.d 4.77E4 1 1 117 128 Acetylation (N-term); Deamidation (NQ)
K.R(+28.03)FPEAYENLS(+79.97)QV Y 31.29 1559.7020 12 2.6 780.8603 2 83.47 3 50651 AEV_3_3_RA3_01_1233.d 3.17E4 1 1 212 223 Dimethylation(KR); Phosphorylation (STY)
R.NKGNIEENMK(+14.02).R Y 30.89 1189.5760 10 -4.9 595.7924 2 24.39 3 10227 AEV_3_3_RA3_01_1233.d 2.19E4 1 1 202 211 Methylation(KR)
K.IIVSKNWGFTPLRREEYVR.L Y 30.60 2362.2910 19 2.3 473.4666 5 72.19 3 41940 AEV_3_3_RA3_01_1233.d 1.84E5 1 1 165 183
R.ATAVEALRR(+14.02).S Y 30.24 999.5825 9 -1.6 500.7978 2 37.10 3 17694 AEV_3_3_RA3_01_1233.d 2.29E5 2 2 146 154 Methylation(KR)
R.SMYKFPGR(+14.02).Q Y 30.14 998.5007 8 3.9 333.8422 3 56.58 2 23865 AEV_1_3_RA2_01_1232.d 1.72E5 2 2 155 162 Methylation(KR)
K.M(+15.99)LSC(+57.02)AGADR(+14.02).L Y 30.07 1009.4321 9 15.0 505.7309 2 25.51 3 10898 AEV_3_3_RA3_01_1233.d 1.68E4 2 2 102 110 Oxidation (M); Carbamidomethylation; Methylation(KR)
R.FNRGVPDAKIR.I Y 29.35 1271.7098 11 -8.5 318.9320 4 40.58 3 19748 AEV_3_3_RA3_01_1233.d 1.38E5 1 1 22 32
K.M(+15.99)LSC(+57.02)AGADRLQTGM(+15.99)R.G Y 28.75 1697.7648 15 18.1 566.9391 3 44.55 3 22267 AEV_3_3_RA3_01_1233.d 2.34E5 1 1 102 116 Oxidation (M); Carbamidomethylation
R.EEYVR.L Y 28.35 694.3286 5 -87.7 348.1411 2 26.57 1 7250 AEV 2_3_RA2_01_1224.d 8.84E4 1 1 179 183
K.N(+.98)KPYPK(-.98).S Y 28.27 745.4122 6 1.2 373.7138 2 9.75 3 2439 AEV_3_3_RA3_01_1233.d 6.89E4 1 1 14 19 Deamidation (NQ); Amidation
K.RFPEAYENLS(+79.97)Q(+.98)V Y 27.37 1532.6548 12 23.3 767.3525 2 79.55 3 47718 AEV_3_3_RA3_01_1233.d 2.45E5 1 1 212 223 Phosphorylation (STY); Deamidation (NQ)
R.REEYVR.L Y 27.35 850.4297 6 2.2 426.2231 2 13.73 3 4427 AEV_3_3_RA3_01_1233.d 1.34E5 2 2 178 183
K.E(-18.01)GFHLR.V Y 27.29 739.3765 6 -6.6 370.6931 2 34.80 3 16221 AEV_3_3_RA3_01_1233.d 8.58E5 2 2 83 88 Pyro-glu from E
R.GVPDAK.I Y 27.10 585.3122 6 -93.9 586.2645 1 18.34 1 4349 AEV 2_3_RA2_01_1224.d 1.3E4 1 1 25 30
K.MLSC(+57.02)AGADRLQTGM(+15.99)R.G Y 27.00 1681.7698 15 6.1 561.6006 3 55.23 2 23130 AEV_1_3_RA2_01_1232.d 1.94E5 1 1 102 116 Carbamidomethylation; Oxidation (M)
K.ANVDEFPLC(+57.02)VHMVSNE(+55.92)YEQLSSEALEAAR.I Y 26.67 3363.4321 29 24.8 841.8862 4 82.06 2 42176 AEV_1_3_RA2_01_1232.d 0 1 1 41 69 Carbamidomethylation; Replacement of 2 protons by nickel
R.VKIDGAYVQFLRNKGNIEENMK(+156.12).R Y 26.57 2721.4524 22 -5.8 681.3665 4 86.55 3 52739 AEV_3_3_RA3_01_1233.d 1.41E5 1 1 190 211 4-hydroxynonenal (HNE)
R.GVPDAKIR.I Y 26.56 854.4974 8 4.4 428.2578 2 28.48 2 10021 AEV_1_3_RA2_01_1232.d 2.69E5 4 4 25 32
R.FPEAYENLS(+79.97)Q(+.98)V Y 26.14 1376.5537 11 38.0 689.3103 2 84.03 3 51045 AEV_3_3_RA3_01_1233.d 0 1 1 213 223 Phosphorylation (STY); Deamidation (NQ)
K.RFPEAYENLSQ(+.98)V Y 26.06 1452.6885 12 8.3 727.3575 2 75.58 3 44583 AEV_3_3_RA3_01_1233.d 1.22E5 2 2 212 223 Deamidation (NQ)
R.FNR(+14.02)GVPDAK(+42.01).I Y 25.52 1058.5509 9 -13.6 530.2755 2 8.92 3 2142 AEV_3_3_RA3_01_1233.d 9.32E3 1 1 22 30 Methylation(KR); Acetylation (K)
R.IFD(+14.02)LGR.K Y 25.18 733.4122 6 -2.2 367.7126 2 67.73 3 38436 AEV_3_3_RA3_01_1233.d 1.31E5 2 2 33 38 Methylation(others)
R.EEYVR(+14.02).L Y 25.17 708.3442 5 -2.3 709.3499 1 27.20 3 11800 AEV_3_3_RA3_01_1233.d 6.62E4 1 1 179 183 Methylation(KR)
R.GVPDAK(+14.02).I Y 24.86 599.3278 6 -6.9 600.3309 1 18.45 2 5754 AEV_1_3_RA2_01_1232.d 2.08E4 1 1 25 30 Methylation(KR)
K.ANVDE(+14.02)FPLC(+57.02)VHMVSNEYEQLSSEALEAAR.I Y 24.52 3321.5281 29 9.7 1108.1941 3 88.97 2 46708 AEV_1_3_RA2_01_1232.d 1.4E5 1 1 41 69 Methylation(others); Carbamidomethylation
K.I(+42.01)AGK(+43.99)EGFHLR.V Y 24.22 1212.6251 10 -6.9 304.1615 4 40.53 3 19717 AEV_3_3_RA3_01_1233.d 0 1 1 79 88 Acetylation (N-term); Carboxylation (DKW)
K.Q(+71.04)EGRVKIDGAYVQFLR.N Y 23.84 1949.0482 16 15.3 488.2768 4 76.99 3 45692 AEV_3_3_RA3_01_1233.d 4.95E4 1 1 186 201 Propionamide (K, X@N-term)
R.NKGNIEE(+14.02)NMK.R Y 23.68 1189.5760 10 -6.0 595.7917 2 26.43 3 11382 AEV_3_3_RA3_01_1233.d 1.64E4 1 1 202 211 Methylation(others)
R.VRAHPY(+79.96)HVVR.I Y 23.42 1312.6459 10 80.1 329.1950 4 22.67 3 9249 AEV_3_3_RA3_01_1233.d 0 1 1 89 98 Sulfation
R.SM(-48.00)YKFPGR.Q Y 23.06 936.4817 8 1.9 313.1684 3 26.17 3 11237 AEV_3_3_RA3_01_1233.d 6.1E6 3 3 155 162 Dethiomethyl
R.QKIIVSK.N Y 22.35 814.5276 7 -6.9 408.2682 2 18.80 2 5906 AEV_1_3_RA2_01_1232.d 5.02E4 1 1 163 169
R.IC(+57.02)ANKY(+79.96)LVK.I Y 22.25 1187.5679 9 65.4 396.8891 3 49.25 2 20068 AEV_1_3_RA2_01_1232.d 6.65E4 1 1 70 78 Carbamidomethylation; Sulfation
R.TRD(-18.01)AHR.A Y 22.13 736.3729 6 2.8 737.3822 1 78.32 2 39226 AEV_1_3_RA2_01_1232.d 3.91E4 1 1 140 145 Dehydration
R.A(+41.03)TAVEALRR.S Y 21.92 1026.5934 9 -41.3 343.1909 3 32.77 2 12020 AEV_1_3_RA2_01_1232.d 0 1 1 146 154 Amidination of lysines or N-terminal amines with methyl acetimidate
R.A(+43.01)TAVEALRR.S Y 21.90 1028.5726 9 -52.7 343.8467 3 31.11 3 14036 AEV_3_3_RA3_01_1233.d 0 1 1 146 154 Carbamylation
R.GAFGK(+14.02)PN(+.98)GTVAR.V Y 21.45 1188.6251 12 -5.6 397.2134 3 38.14 2 14587 AEV_1_3_RA2_01_1232.d 1.11E5 1 1 117 128 Methylation(KR); Deamidation (NQ)
R.A(+42.01)T(+79.96)AVEALRR.S Y 21.03 1107.5342 9 96.3 370.2209 3 32.57 2 11917 AEV_1_3_RA2_01_1232.d 7.27E4 1 1 146 154 Acetylation (N-term); Sulfation
K.YLVK(+14.02)IAGKEGF(+31.99)HLR.V Y 20.65 1675.9409 14 26.0 336.2042 5 53.32 2 22153 AEV_1_3_RA2_01_1232.d 0 1 1 75 88 Methylation(KR); Dihydroxy
R.S(+79.96)MYKFPGR.Q Y 20.65 1064.4419 8 128.1 355.8667 3 53.26 2 22126 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 155 162 Sulfation
R.AHPYHVVR(+14.02).I Y 20.43 991.5352 8 -19.1 496.7654 2 23.34 3 9616 AEV_3_3_RA3_01_1233.d 0 1 1 91 98 Methylation(KR)
R.AT(+79.96)AVEALRR.S Y 20.33 1065.5237 9 26.5 356.1913 3 33.48 2 12347 AEV_1_3_RA2_01_1232.d 1.26E5 1 1 146 154 Sulfation
K.IIVSK.N N 20.16 558.3741 5 -201.2 559.2690 1 20.42 2 6583 AEV_1_3_RA2_01_1232.d 0 1 1 165 169
K.SR(+31.99)FNR(+14.02)GVPDAKIR.I Y 20.13 1560.8484 13 -0.9 391.2190 4 62.97 3 34719 AEV_3_3_RA3_01_1233.d 2.06E5 1 1 20 32 Dihydroxy; Methylation(KR)
R.GVPD(-18.01)AK.I Y 19.70 567.3016 6 27.3 568.3244 1 95.06 2 49360 AEV_1_3_RA2_01_1232.d 1.13E3 1 1 25 30 Dehydration
K.EGFHLR(+14.02).V Y 19.63 771.4028 6 5.6 386.7108 2 49.24 2 20062 AEV_1_3_RA2_01_1232.d 3.69E4 1 1 83 88 Methylation(KR)
K.IIVSKN(+.98)WGFTPLRREEYVR.L Y 19.55 2363.2749 19 -7.6 473.6587 5 72.23 3 41971 AEV_3_3_RA3_01_1233.d 0 1 1 165 183 Deamidation (NQ)
R.GAFGK(+43.99)PNGTVAR.V Y 19.42 1217.6152 12 -5.0 609.8118 2 49.82 3 25617 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 117 128 Carboxylation (DKW)
R.N(+42.01)KGNIEENM(+15.99)K.R Y 19.22 1233.5659 10 -85.3 412.1608 3 48.43 1 19354 AEV 2_3_RA2_01_1224.d 2.79E5 1 1 202 211 Acetylation (N-term); Oxidation (M)
K.NKPY(-18.01)PKSRFNRGVPDAK(+14.02).I Y 19.17 1969.0646 17 -10.2 493.2684 4 77.15 3 45817 AEV_3_3_RA3_01_1233.d 7.39E4 1 1 14 30 Dehydration; Methylation(KR)
K.M(-48.00)LSC(+57.02)AGADR.L Y 18.98 931.4182 9 6.3 466.7193 2 12.51 3 3784 AEV_3_3_RA3_01_1233.d 6.9E4 1 1 102 110 Dethiomethyl; Carbamidomethylation
K.R(+14.02)FPEAYENLSQV Y 18.93 1465.7201 12 -11.0 733.8593 2 76.32 3 45162 AEV_3_3_RA3_01_1233.d 4.09E4 1 1 212 223 Methylation(KR)
R.SM(+15.99)YKFPGR(+14.02).Q Y 18.91 1014.4957 8 -6.9 508.2516 2 45.28 2 18071 AEV_1_3_RA2_01_1232.d 1.91E4 1 1 155 162 Oxidation (M); Methylation(KR)
R.ATAVEALR(+14.02)R.S Y 18.81 999.5825 9 7.9 334.2041 3 40.07 2 15522 AEV_1_3_RA2_01_1232.d 1.33E5 1 1 146 154 Methylation(KR)
R.LQTGM(+15.99)R.G Y 18.66 720.3589 6 -92.6 361.1534 2 20.13 1 4814 AEV 2_3_RA2_01_1224.d 2.2E5 1 1 111 116 Oxidation (M)
K.S(+79.97)RFNRGVPDAK(+42.01)IR.I Y 18.22 1636.8198 13 -39.2 410.1962 4 82.38 1 43696 AEV 2_3_RA2_01_1224.d 5.87E4 1 1 20 32 Phosphorylation (STY); Acetylation (K)
R.NKGNIEENM(-48.00)KR.F Y 18.20 1283.6582 11 13.0 428.8989 3 8.47 2 2000 AEV_1_3_RA2_01_1232.d 9.33E3 1 1 202 212 Dethiomethyl
R.I(+42.01)CANK.Y Y 18.19 589.2894 5 -101.4 590.2369 1 58.56 1 25472 AEV 2_3_RA2_01_1224.d 0 1 1 70 74 Acetylation (N-term)
R.G(+87.03)AFGKPNGTVAR.V Y 17.95 1260.6575 12 -27.8 631.3185 2 67.22 3 38028 AEV_3_3_RA3_01_1233.d 1.86E5 1 1 117 128 Glycidamide adduct
R.D(+42.01)AHRATAVEALR.R Y 17.93 1350.7003 12 0.2 451.2408 3 54.54 3 28704 AEV_3_3_RA3_01_1233.d 0 1 1 142 153 Acetylation (N-term)
R.A(+71.04)TAVEALR.R Y 17.89 900.5029 8 -3.3 451.2572 2 51.04 2 20972 AEV_1_3_RA2_01_1232.d 5.15E4 1 1 146 153 Propionamide (K, X@N-term)
R.ICANK.Y Y 17.89 547.2788 5 -121.5 548.2196 1 41.56 1 15324 AEV 2_3_RA2_01_1224.d 2.68E4 1 1 70 74
R.T(+42.01)RDAHRATAVE(+21.98)ALR.R Y 17.72 1629.8311 14 11.1 815.9318 2 82.90 2 42805 AEV_1_3_RA2_01_1232.d 2.8E4 1 1 140 153 Acetylation (N-term); Sodium adduct
R.GAFGKPN(+.98)GT(-18.01)VAR.V Y 17.41 1156.5989 12 6.3 386.5427 3 37.35 2 14229 AEV_1_3_RA2_01_1232.d 2.08E5 2 2 117 128 Deamidation (NQ); Dehydration
R.YC(+57.02)K(+14.02)N(+.98)K(+14.02)PYPK.S Y 17.38 1225.6165 9 -11.5 409.5414 3 43.59 3 21659 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 11 19 Carbamidomethylation; Methylation(KR); Deamidation (NQ)
R.G(+42.01)AFGKPN(+.98)GTVAR(+14.02).V Y 17.15 1230.6356 12 13.9 411.2249 3 45.78 2 18321 AEV_1_3_RA2_01_1232.d 0 1 1 117 128 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
R.INKMLSCAGADR(+14.02).L Y 17.14 1291.6377 12 12.2 646.8340 2 73.57 3 43029 AEV_3_3_RA3_01_1233.d 0 1 1 99 110 Methylation(KR)
R.A(+43.01)HPYHVVR.I Y 16.99 1020.5253 8 -46.2 341.1667 3 47.54 1 18818 AEV 2_3_RA2_01_1224.d 6.37E5 1 1 91 98 Carbamylation
R.LQTGMR.G Y 16.84 704.3640 6 2.0 353.1899 2 19.35 3 7484 AEV_3_3_RA3_01_1233.d 2.45E5 2 2 111 116
R.IFDLGRK.K Y 16.67 847.4916 7 1.1 424.7535 2 49.22 3 25228 AEV_3_3_RA3_01_1233.d 1.46E5 1 1 33 39
R.G(+43.01)VPDAK(+42.01).I Y 16.43 670.3286 6 -62.8 336.1505 2 28.63 1 8287 AEV 2_3_RA2_01_1224.d 5.19E4 1 1 25 30 Carbamylation; Acetylation (K)
R.GAFGK(+27.99)PNGT(+79.97)VAR.V Y 16.37 1281.5867 12 -1.7 428.2021 3 57.57 1 24792 AEV 2_3_RA2_01_1224.d 0 1 1 117 128 Formylation; Phosphorylation (STY)
R.GVPDAK(+42.02).I Y 15.98 627.3340 6 20.7 314.6808 2 11.93 3 3468 AEV_3_3_RA3_01_1233.d 1.67E5 1 1 25 30 Guanidination
R.DAHRATAVEALRRSM(+15.99)YK.F Y 15.80 1990.0166 17 -72.7 498.4753 4 73.04 2 35144 AEV_1_3_RA2_01_1232.d 0 1 1 142 158 Oxidation (M)
R.A(+43.01)TAVEALR.R Y 15.63 872.4716 8 4.1 437.2448 2 36.90 3 17527 AEV_3_3_RA3_01_1233.d 0 1 1 146 153 Carbamylation
K.GNIEENMKRFPEAYENLSQV Y 15.59 2367.1165 20 -23.9 592.7722 4 95.56 1 53495 AEV 2_3_RA2_01_1224.d 1.03E5 1 1 204 223
R.G(+42.01)VPDAK.I Y 15.56 627.3228 6 46.2 628.3590 1 41.86 3 20573 AEV_3_3_RA3_01_1233.d 6.86E4 1 1 25 30 Acetylation (N-term)
R.NKGNIEENMKRFPEAYENLSQV Y 15.35 2609.2544 22 18.5 653.3329 4 75.14 3 44233 AEV_3_3_RA3_01_1233.d 1.85E5 1 1 202 223
K.IAGKEGFHLR(+14.02).V Y 15.05 1140.6404 10 -6.2 571.3239 2 54.11 2 22554 AEV_1_3_RA2_01_1232.d 8.07E4 1 1 79 88 Methylation(KR)
total 160 peptides
C1GFA3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.KADTVPVLDLLPLGYSK.V Y 148.89 1828.0345 17 3.3 915.0276 2 84.92 2 44292 AEV_1_3_RA2_01_1232.d 6.98E6 11 11 95 111
K.TQNQFWKPVINLDKLWSLVPAETR.D Y 135.97 2882.5442 24 -5.6 721.6393 4 88.92 3 54120 AEV_3_3_RA3_01_1233.d 8.95E5 6 6 64 87
R.DAYVNNKKADTVPVLDLLPLGYSK.V Y 130.07 2632.4111 24 1.6 659.1111 4 83.52 2 43262 AEV_1_3_RA2_01_1232.d 1.78E6 8 8 88 111
K.TQNQFWKPVINLDKLWSLVPAETR(+14.02).D Y 127.53 2896.5598 24 1.0 725.1479 4 90.30 3 54876 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 64 87 Methylation(KR)
R.TNLDKYHPGYFGK.V Y 120.91 1538.7517 13 4.3 513.9267 3 59.45 2 25565 AEV_1_3_RA2_01_1232.d 1.24E7 18 18 43 55
K.ADTVPVLDLLPLGYSK.V Y 111.56 1699.9396 16 3.9 850.9804 2 89.40 2 46959 AEV_1_3_RA2_01_1232.d 3.14E6 6 6 96 111
K.GRLPQIPVVVR.A Y 107.28 1232.7717 11 -5.9 617.3895 2 69.71 3 40008 AEV_3_3_RA3_01_1233.d 3.13E6 5 5 116 126
R.GHVSAGYGR.V Y 103.70 902.4359 9 -4.9 452.2230 2 13.93 2 3950 AEV_1_3_RA2_01_1232.d 1.52E6 13 13 13 21
K.SRGHVSAGYGR.V Y 103.52 1145.5690 11 2.4 382.8645 3 13.12 3 4098 AEV_3_3_RA3_01_1233.d 1.23E6 7 7 11 21
R.LPQIPVVVR.A Y 101.52 1019.6491 9 -5.0 510.8293 2 75.35 3 44396 AEV_3_3_RA3_01_1233.d 9.52E5 3 3 118 126
K.KADTVPVLDLLPLGYSK(+14.02).V Y 95.46 1842.0502 17 -0.1 615.0239 3 84.88 2 44270 AEV_1_3_RA2_01_1232.d 5.92E5 4 4 95 111 Methylation(KR)
R.YFHKTQNQFWKPVINLDKLWSLVPAETR.D Y 94.84 3457.8298 28 1.8 692.5745 5 85.36 3 51940 AEV_3_3_RA3_01_1233.d 1.77E5 1 1 60 87
R.GMAGGQHHHR.T Y 91.16 1086.4890 10 1.0 544.2523 2 8.71 3 2083 AEV_3_3_RA3_01_1233.d 1.41E5 4 4 33 42
K.VLGKGRLPQIPVVVR.A Y 86.60 1630.0405 15 -31.1 544.3372 3 70.67 3 40754 AEV_3_3_RA3_01_1233.d 5.73E5 3 3 112 126
K.TQN(+.98)QFWKPVINLDKLWSLVPAETR.D Y 83.21 2883.5283 24 -0.4 721.8890 4 89.68 3 54540 AEV_3_3_RA3_01_1233.d 3.47E5 1 1 64 87 Deamidation (NQ)
R.DAYVNN(+.98)KKADTVPVLDLLPLGYSK.V Y 81.62 2633.3953 24 1.4 659.3570 4 85.26 2 44502 AEV_1_3_RA2_01_1232.d 7E4 2 2 88 111 Deamidation (NQ)
R.GM(+15.99)AGGQHHHR.T Y 74.55 1102.4839 10 -2.6 552.2478 2 7.86 3 1851 AEV_3_3_RA3_01_1233.d 4.13E4 4 4 33 42 Oxidation (M)
R.DAYVN(+.98)NKKADTVPVLDLLPLGYSK.V Y 73.56 2633.3953 24 -3.5 659.3538 4 84.99 3 51686 AEV_3_3_RA3_01_1233.d 5.41E5 3 3 88 111 Deamidation (NQ)
K.KADTVPVLD(+14.02)LLPLGYSK.V Y 68.53 1842.0502 17 -0.2 615.0239 3 84.98 3 51684 AEV_3_3_RA3_01_1233.d 6.72E5 2 2 95 111 Methylation(others)
R.TNLDKYHPGYFGK(+14.02).V Y 68.19 1552.7673 13 3.7 518.5983 3 61.16 2 26633 AEV_1_3_RA2_01_1232.d 9.84E5 3 3 43 55 Methylation(KR)
R.YFSKEAER.K Y 65.86 1028.4927 8 2.7 515.2550 2 19.62 3 7667 AEV_3_3_RA3_01_1233.d 1.89E6 5 5 129 136
K.TQNQFWKPVIN(+.98)LDKLWSLVPAETR.D Y 63.67 2883.5283 24 17.9 721.9023 4 90.58 3 55028 AEV_3_3_RA3_01_1233.d 0 1 1 64 87 Deamidation (NQ)
R.T(+42.01)NLDKYHPGYFGK.V Y 62.93 1580.7623 13 16.3 396.2043 4 59.53 2 25576 AEV_1_3_RA2_01_1232.d 3.42E4 1 1 43 55 Acetylation (N-term)
K.ADTVPVLDLLPLGYSK(+14.02).V Y 56.44 1713.9552 16 -3.9 857.9816 2 89.17 3 54250 AEV_3_3_RA3_01_1233.d 1.93E5 2 2 96 111 Methylation(KR)
R.DAYVNNKKADTVPVLDLLPLGYS(-18.01)K(+14.02).V Y 54.75 2628.4163 24 -12.0 658.1035 4 83.49 3 50661 AEV_3_3_RA3_01_1233.d 8.02E4 1 1 88 111 Dehydration; Methylation(KR)
K.G(+43.01)R(+14.02)LPQIPVVVR.A Y 52.81 1289.7931 11 -2.1 430.9374 3 70.03 3 40248 AEV_3_3_RA3_01_1233.d 5.64E4 1 1 116 126 Carbamylation; Methylation(KR)
R.ARYFSKEAER.K Y 52.39 1255.6309 10 1.6 419.5516 3 22.49 3 9206 AEV_3_3_RA3_01_1233.d 4.92E5 2 2 127 136
R.YFSKEAERK.I Y 51.86 1156.5876 9 2.0 386.5373 3 14.84 3 5064 AEV_3_3_RA3_01_1233.d 3.28E5 3 3 129 137
R.GHVSAGYGR(+14.02).V Y 51.30 916.4515 9 7.5 459.2365 2 17.76 2 5467 AEV_1_3_RA2_01_1232.d 6.69E4 2 2 13 21 Methylation(KR)
K.ADTVPVLD(+14.02)LLPLGYSK.V Y 50.56 1713.9552 16 1.6 857.9863 2 90.00 2 47231 AEV_1_3_RA2_01_1232.d 6.51E4 1 1 96 111 Methylation(others)
K.IKDAGGAVELVA Y 50.23 1141.6343 12 6.7 571.8282 2 66.38 2 30225 AEV_1_3_RA2_01_1232.d 3.28E5 2 2 138 149
K.GRLPQIPVVVR(+14.02).A Y 46.88 1246.7874 11 -30.5 416.5904 3 72.63 3 42298 AEV_3_3_RA3_01_1233.d 0 2 2 116 126 Methylation(KR)
K.TQ(+.98)NQFWKPVINLDKLWSLVPAETR(+14.02).D Y 46.40 2897.5439 24 9.1 725.3998 4 89.17 3 54252 AEV_3_3_RA3_01_1233.d 9.75E4 1 1 64 87 Deamidation (NQ); Methylation(KR)
R.T(-2.02)NLDKYHPGYFGK.V Y 44.94 1536.7361 13 -25.2 513.2397 3 58.39 3 31221 AEV_3_3_RA3_01_1233.d 0 2 2 43 55 2-amino-3-oxo-butanoic_acid
K.GRLPQ(+.98)IPVVVR.A Y 43.46 1233.7557 11 -1.1 412.2587 3 70.88 3 40911 AEV_3_3_RA3_01_1233.d 2.13E5 2 2 116 126 Deamidation (NQ)
K.ADT(+14.02)VPVLDLLPLGYSK.V Y 42.98 1713.9552 16 -4.5 857.9810 2 89.76 3 54583 AEV_3_3_RA3_01_1233.d 1.23E5 1 1 96 111 Methylation(others)
R.T(+77.99)NLDKYHPGYFGK.V Y 42.00 1616.7388 13 58.5 405.2156 4 59.65 2 25656 AEV_1_3_RA2_01_1232.d 0 1 1 43 55 Methylphosphonylation
R.T(+41.03)NLDKYHPGYFGK.V Y 37.09 1579.7783 13 20.4 395.9599 4 57.96 3 30921 AEV_3_3_RA3_01_1233.d 0 2 2 43 55 Amidination of lysines or N-terminal amines with methyl acetimidate
R.YFSKEAER(+14.02).K Y 36.56 1042.5083 8 0.9 522.2619 2 27.20 3 11835 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 129 136 Methylation(KR)
R.DAY(-94.04)VNNKKADTVPVLDLLPLGYSK.V Y 35.30 2538.3694 24 -36.4 847.0996 3 89.55 2 47039 AEV_1_3_RA2_01_1232.d 2.23E5 1 1 88 111 Dehydroalanine (Y)
R.Y(+79.96)FSKEAER.K Y 32.79 1108.4495 8 93.9 370.5251 3 19.99 3 7823 AEV_3_3_RA3_01_1233.d 7.63E4 1 1 129 136 Sulfation
R.DAYVNNK(+14.02)KADT(-18.01)VPVLDLLPLGYSK.V Y 32.60 2628.4163 24 21.2 658.1252 4 85.28 2 44504 AEV_1_3_RA2_01_1232.d 0 1 1 88 111 Methylation(KR); Dehydration
R.DAYVNNK(+14.02)K.A Y 30.53 964.4977 8 -9.8 483.2514 2 13.92 3 4532 AEV_3_3_RA3_01_1233.d 3.37E4 1 1 88 95 Methylation(KR)
R.ARY(+79.97)FS(+79.97)KEAER.K Y 28.54 1415.5635 10 -26.1 708.7705 2 29.77 1 8906 AEV 2_3_RA2_01_1224.d 0 1 1 127 136 Phosphorylation (STY)
K.GRLPQ(+.98)IPVVVR(+14.02).A Y 28.29 1247.7714 11 -35.7 416.9162 3 73.98 3 43338 AEV_3_3_RA3_01_1233.d 0 1 1 116 126 Deamidation (NQ); Methylation(KR)
R.T(-18.01)NLDK.Y Y 27.77 571.2966 5 21.8 572.3163 1 68.64 3 39163 AEV_3_3_RA3_01_1233.d 0 1 1 43 47 Dehydration
K.LWSLVPAETR.D Y 27.31 1170.6396 10 -39.0 586.3043 2 77.62 2 38665 AEV_1_3_RA2_01_1232.d 1.07E5 2 2 78 87
R.TN(+.98)LDKYHPGYFGK(+14.02).V Y 27.13 1553.7513 13 54.4 518.9526 3 61.19 2 26654 AEV_1_3_RA2_01_1232.d 0 1 1 43 55 Deamidation (NQ); Methylation(KR)
R.K(+42.01)(+42.01)IKDAGGAVELVA Y 26.47 1353.7504 13 -24.9 452.2462 3 63.77 2 28409 AEV_1_3_RA2_01_1232.d 6.54E4 1 1 137 149 Acetylation (N-term); Acetylation (K)
R.DAYVNNK(+14.02).K Y 25.86 836.4028 7 -90.9 419.1707 2 30.35 1 9145 AEV 2_3_RA2_01_1224.d 0 1 1 88 94 Methylation(KR)
K.T(+42.01)QN(+.98)QFWKPVIN(+.98)LDKLWSLVPAETR.D Y 25.19 2926.5229 24 -9.0 586.3066 5 77.16 3 45829 AEV_3_3_RA3_01_1233.d 0 1 1 64 87 Acetylation (N-term); Deamidation (NQ)
K.S(+43.01)RGHVSAGYGR.V Y 23.37 1188.5748 11 6.8 397.2016 3 14.36 2 4101 AEV_1_3_RA2_01_1232.d 2.79E4 1 1 11 21 Carbamylation
R.T(-18.01)N(+.98)LDKYHPGYFGK.V Y 23.27 1521.7252 13 18.5 508.2584 3 67.39 2 30924 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 43 55 Dehydration; Deamidation (NQ)
K.HPGGR.G N 23.26 522.2662 5 -111.4 523.2153 1 55.01 1 23181 AEV 2_3_RA2_01_1224.d 2.61E4 2 2 28 32
K.G(+42.01)R(+14.02)LPQ(+.98)IPVVVR.A Y 22.42 1289.7819 11 -18.1 430.9268 3 70.90 2 33522 AEV_1_3_RA2_01_1232.d 0 1 1 116 126 Acetylation (N-term); Methylation(KR); Deamidation (NQ)
K.K(+43.01)(+14.02)ADTVPVLDLLPLGYSK.V Y 21.92 1885.0560 17 2.5 629.3608 3 84.88 2 44238 AEV_1_3_RA2_01_1232.d 5.3E4 1 1 95 111 Carbamylation; Methylation(KR)
R.G(+87.03)MAGGQHHHR.T Y 21.86 1173.5210 10 20.9 392.1891 3 8.77 3 2092 AEV_3_3_RA3_01_1233.d 0 1 1 33 42 Glycidamide adduct
R.G(+42.01)MAGGQHHHR.T Y 21.64 1128.4995 10 48.3 377.1920 3 9.04 2 2160 AEV_1_3_RA2_01_1232.d 0 1 1 33 42 Acetylation (N-term)
K.HPGGR(+14.02).G N 19.84 536.2819 5 -22.3 537.2772 1 36.65 2 13851 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 28 32 Methylation(KR)
K.KADTVPVLDLLPLGYS(-15.99)KVLGKGR.L Y 18.90 2422.4312 23 -25.0 808.4641 3 91.08 3 55290 AEV_3_3_RA3_01_1233.d 0 1 1 95 117 Deoxy
R.K(+42.01)HPGGR(+14.02).G Y 18.73 706.3875 6 23.8 354.2094 2 23.93 2 8026 AEV_1_3_RA2_01_1232.d 1.83E5 1 1 27 32 Acetylation (N-term); Methylation(KR)
K.S(+71.04)RGHVSAGYGR.V Y 18.46 1216.6061 11 -77.0 305.1354 4 62.92 1 28726 AEV 2_3_RA2_01_1224.d 1.71E5 1 1 11 21 Propionamide (K, X@N-term)
R.T(-18.01)N(+.98)LDK.Y Y 18.38 572.2806 5 -13.4 573.2802 1 67.32 2 30880 AEV_1_3_RA2_01_1232.d 0 1 1 43 47 Dehydration; Deamidation (NQ)
R.T(+42.01)NLDK(+42.01)YHPGYFGK.V Y 18.32 1622.7728 13 -62.9 325.5414 5 40.59 1 14751 AEV 2_3_RA2_01_1224.d 0 1 1 43 55 Acetylation (N-term); Acetylation (K)
R.Y(-2.02)FSKEAER.K Y 18.12 1026.4771 8 47.2 514.2700 2 20.03 3 7843 AEV_3_3_RA3_01_1233.d 2.69E4 1 1 129 136 2-amino-3-oxo-butanoic_acid
R.Y(+43.01)FSKEAER.K Y 18.11 1071.4985 8 -53.5 358.1544 3 37.69 1 13108 AEV 2_3_RA2_01_1224.d 8.19E5 1 1 129 136 Carbamylation
R.TNLDK(+14.02).Y Y 18.10 603.3228 5 -102.5 604.2682 1 49.15 1 19751 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 43 47 Methylation(KR)
R.ARYFSK.E N 17.99 770.4075 6 3.1 386.2122 2 18.79 2 5903 AEV_1_3_RA2_01_1232.d 4.9E5 2 2 127 132
K.KADTVPVLDLLPLGYSK(+21.98)(+14.02).V Y 17.93 1864.0321 17 -35.9 622.3290 3 85.12 2 44393 AEV_1_3_RA2_01_1232.d 5.96E4 1 1 95 111 Sodium adduct; Methylation(KR)
R.TN(+203.08)LDK.Y Y 17.70 792.3865 5 -94.4 793.3190 1 112.22 1 59395 AEV 2_3_RA2_01_1224.d 2.08E5 1 1 43 47 HexNAcylation (N)
K.H(+42.01)PGGR.G N 17.33 564.2769 5 -6.6 565.2804 1 19.16 3 7385 AEV_3_3_RA3_01_1233.d 0 1 1 28 32 Acetylation (N-term)
R.YFSKE(+21.98)AER.K Y 17.22 1050.4746 8 -45.0 526.2209 2 43.66 1 16505 AEV 2_3_RA2_01_1224.d 0 1 1 129 136 Sodium adduct
K.DAGGAVELVA Y 16.92 900.4552 10 12.0 451.2403 2 20.59 3 8138 AEV_3_3_RA3_01_1233.d 0 1 1 140 149
R.G(+42.01)HVSAGYGRVGK(+28.03).H Y 16.87 1256.6625 12 32.9 315.1832 4 14.14 2 4020 AEV_1_3_RA2_01_1232.d 5.18E4 1 1 13 24 Acetylation (Protein N-term); Dimethylation(KR)
R.GHVSAGYGR(+21.98).V Y 16.79 924.4178 9 20.0 309.1527 3 31.74 1 9953 AEV 2_3_RA2_01_1224.d 8.87E3 1 1 13 21 Sodium adduct
R.KIK(+14.02)DAGGAVELVA(-.98) Y 16.73 1282.7609 13 -26.5 428.5829 3 72.20 2 34502 AEV_1_3_RA2_01_1232.d 0 1 1 137 149 Methylation(KR); Amidation
K.A(+42.01)DT(+79.96)VPVLDLLPLGYSK.V Y 16.64 1821.9070 16 40.3 608.3341 3 85.70 2 44786 AEV_1_3_RA2_01_1232.d 1.79E5 1 1 96 111 Acetylation (N-term); Sulfation
R.T(+43.01)NLDK(+42.01)YHPGYFGK.V Y 16.32 1623.7681 13 95.1 406.9879 4 58.14 3 31047 AEV_3_3_RA3_01_1233.d 0 1 1 43 55 Carbamylation; Acetylation (K)
K.D(+28.03)AGGAVELVA Y 15.77 928.4865 10 -59.7 310.4843 3 45.26 1 17427 AEV 2_3_RA2_01_1224.d 1.59E5 1 1 140 149 Ethylation
R.TN(+.98)LD(-18.01)K.Y Y 15.73 572.2806 5 25.3 573.3023 1 58.61 2 24997 AEV_1_3_RA2_01_1232.d 0 1 1 43 47 Deamidation (NQ); Dehydration
K.HPGGR(+21.98).G N 15.73 544.2482 5 -0.6 545.2552 1 28.17 3 12346 AEV_3_3_RA3_01_1233.d 0 1 1 28 32 Sodium adduct
K.T(+42.01)RK(+14.02)SRGHVSAGYGR.V Y 15.45 1586.8390 14 -6.0 397.7146 4 61.26 2 26704 AEV_1_3_RA2_01_1232.d 0 1 1 8 21 Acetylation (Protein N-term); Methylation(KR)
total 82 peptides
C1GIX7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.VAPAAPKEESTPAAEEEPVSTGER.L Y 146.47 2451.1765 24 8.7 818.0732 3 58.00 2 24656 AEV_1_3_RA2_01_1232.d 1.62E6 6 6 196 219
R.ENPHYFVTSNLSVTK.L Y 124.66 1734.8577 15 5.3 579.2962 3 68.22 2 31524 AEV_1_3_RA2_01_1232.d 8.14E5 5 5 299 313
R.FTAVINPPQSAILAVGTTR.K Y 117.70 1955.0840 19 -22.5 652.6873 3 81.76 2 41941 AEV_1_3_RA2_01_1232.d 0 4 4 438 456
R.NAHTLGLSSISSQIKDLGK.R Y 99.56 1968.0640 19 -2.1 493.0222 4 74.11 3 43431 AEV_3_3_RA3_01_1233.d 4.14E5 3 3 389 407
R.NAHTLGLSSISSQIK.D Y 98.05 1554.8365 15 3.8 519.2881 3 68.20 2 31506 AEV_1_3_RA2_01_1232.d 4.5E5 2 2 389 403
R.NAHTLGLSSISSQIKDLGKR.A Y 95.51 2124.1650 20 2.1 425.8412 5 71.13 3 41142 AEV_3_3_RA3_01_1233.d 1.12E6 5 5 389 408
K.NDVEKYQPAGTAVSGPPYEDIPASSMR.K Y 94.42 2878.3442 27 3.3 960.4586 3 73.78 3 43176 AEV_3_3_RA3_01_1233.d 7.32E4 1 1 260 286
K.EESTPAAEEEPVSTGER.L Y 88.17 1816.7963 17 5.0 909.4099 2 50.37 2 20620 AEV_1_3_RA2_01_1232.d 2.44E5 3 3 203 219
R.ELKQIVENPLELLL Y 86.07 1649.9603 14 -0.1 825.9874 2 92.90 3 56282 AEV_3_3_RA3_01_1233.d 7.78E5 3 3 498 511
K.VAPAAPK(+14.02)EESTPAAEEEPVSTGER.L Y 82.43 2465.1921 24 -0.7 822.7374 3 60.36 3 32725 AEV_3_3_RA3_01_1233.d 5.61E5 2 2 196 219 Methylation(KR)
K.YQPAGTAVSGPPYEDIPASSMR.K Y 80.55 2293.0684 22 2.2 765.3651 3 74.89 3 44043 AEV_3_3_RA3_01_1233.d 0 1 1 265 286
K.QIVENPLELLL Y 78.40 1279.7388 11 1.2 1280.7476 1 97.15 2 50048 AEV_1_3_RA2_01_1232.d 1.93E5 4 4 501 511
R.LQPSLDRESFIAPAVK.A Y 76.83 1769.9675 16 0.3 885.9913 2 71.73 3 41584 AEV_3_3_RA3_01_1233.d 1.69E6 5 5 220 235
K.TADISIAVATSVGLITPIVR.N Y 75.91 1996.1567 20 -23.7 666.3771 3 90.77 2 47603 AEV_1_3_RA2_01_1232.d 2.75E4 2 2 369 388
K.VAPAAPKEESTPAAEEEPVSTGER(+14.02).L Y 75.36 2465.1921 24 -0.2 822.7378 3 59.29 3 31884 AEV_3_3_RA3_01_1233.d 1.81E5 4 4 196 219 Methylation(KR)
R.FTAVINPPQSAILAVGTTRK.V Y 72.99 2083.1790 20 17.3 521.8110 4 78.02 2 38987 AEV_1_3_RA2_01_1232.d 0 2 2 438 457
K.YQPAGTAVSGPPYEDIPASSMRK.T Y 68.17 2421.1633 23 0.1 808.0618 3 69.29 3 39683 AEV_3_3_RA3_01_1233.d 2.2E5 2 2 265 287
K.Q(-17.03)PEQPKEELK.V Y 66.88 1207.6084 10 -1.3 604.8107 2 42.26 3 20822 AEV_3_3_RA3_01_1233.d 4.77E5 4 4 186 195 Pyro-glu from Q
K.Q(-17.03)IVENPLELLL Y 65.60 1262.7122 11 -25.8 632.3470 2 98.86 3 58684 AEV_3_3_RA3_01_1233.d 3.35E4 2 2 501 511 Pyro-glu from Q
K.IVDGAVGAEWMR.E Y 65.54 1302.6390 12 -0.5 652.3265 2 73.12 3 42679 AEV_3_3_RA3_01_1233.d 2.09E5 3 3 486 497
R.VTKNDVEKYQPAGTAVSGPPYEDIPASSMR.K Y 65.15 3206.5554 30 14.5 802.6577 4 71.97 2 34326 AEV_1_3_RA2_01_1232.d 8.41E4 1 1 257 286
K.AC(+57.02)AVALLK.V Y 56.58 844.4840 8 -94.3 423.2095 2 69.20 1 33396 AEV 2_3_RA2_01_1224.d 5.94E5 3 3 340 347 Carbamidomethylation
K.LSVNDFLVK.A Y 52.83 1033.5808 9 -1.3 517.7970 2 78.94 3 47233 AEV_3_3_RA3_01_1233.d 2.58E5 3 3 331 339
K.VAPAAPKEESTPAAE(+14.02)EEPVSTGER.L Y 50.05 2465.1921 24 3.3 822.7407 3 60.88 2 26450 AEV_1_3_RA2_01_1232.d 2.03E5 1 1 196 219 Methylation(others)
R.N(+.98)AHTLGLSSISSQIKDLGKR.A Y 49.70 2125.1492 20 7.0 532.2983 4 71.12 3 41106 AEV_3_3_RA3_01_1233.d 7.22E4 1 1 389 408 Deamidation (NQ)
R.GVPLKDIKGTGPGGR.V Y 49.13 1450.8256 15 0.5 484.6161 3 42.00 3 20647 AEV_3_3_RA3_01_1233.d 2.74E5 2 2 242 256
MAASVMS(+79.97)R(+14.02).S Y 45.29 945.3813 8 -8.1 946.3810 1 89.53 1 49273 AEV 2_3_RA2_01_1224.d 4.14E4 1 1 1 8 Phosphorylation (STY); Methylation(KR)
R.EALNTSAN(+.98)GK.Y Y 39.78 1004.4774 10 -83.8 503.2039 2 25.07 1 6575 AEV 2_3_RA2_01_1224.d 4.05E4 1 1 319 328 Deamidation (NQ)
R.VTKNDVEK(-1.03)YQPAGTAVSGPPYEDIPASSMR.K Y 39.24 3205.5237 30 6.2 802.3931 4 71.63 3 41509 AEV_3_3_RA3_01_1233.d 6.67E4 1 1 257 286 Lysine oxidation to aminoadipic semialdehyde
R.ESFIAPAVK.A Y 39.18 960.5280 9 -13.5 481.2648 2 62.00 3 33963 AEV_3_3_RA3_01_1233.d 3.06E5 2 2 227 235
R.LQPS(-2.02)LDRESFIAPAVK.A Y 38.05 1767.9519 16 -14.1 590.3163 3 72.56 2 34783 AEV_1_3_RA2_01_1232.d 7.36E4 1 1 220 235 2-amino-3-oxo-butanoic_acid
R.ENPHYFVT(-18.01)SNLSVTK(+14.02).L Y 36.71 1730.8628 15 -7.3 577.9573 3 67.53 3 38279 AEV_3_3_RA3_01_1233.d 2.65E4 1 1 299 313 Dehydration; Methylation(KR)
R.ENPHYFVTSNLSVTK(+14.02).L Y 35.55 1748.8733 15 -1.8 583.9640 3 69.34 3 39721 AEV_3_3_RA3_01_1233.d 9.44E4 1 1 299 313 Methylation(KR)
K.LK(-1.03)PEEYIGGTFTISNMGMNHAVER.F Y 35.16 2692.2625 24 11.7 674.0807 4 77.97 2 38946 AEV_1_3_RA2_01_1232.d 7.23E4 1 1 414 437 Lysine oxidation to aminoadipic semialdehyde
R.ELKQIVE(+14.02)NPLELLL Y 33.51 1663.9760 14 -8.4 832.9883 2 94.10 3 56849 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 498 511 Methylation(others)
R.ELKQIVENPLELLL(+14.02) Y 33.37 1663.9760 14 3.2 832.9979 2 95.06 3 57249 AEV_3_3_RA3_01_1233.d 1.65E5 1 1 498 511 Methylation(C-term)
R.LQPSLDR(+14.02)ESFIAPAVK.A Y 33.18 1783.9832 16 0.9 595.6689 3 75.87 2 37284 AEV_1_3_RA2_01_1232.d 1.36E5 1 1 220 235 Methylation(KR)
K.ALALER.G Y 31.81 671.3966 6 -1.3 336.7051 2 35.31 3 16572 AEV_3_3_RA3_01_1233.d 1.44E6 7 7 236 241
R.ELK(+14.02)QIVENPLELLL Y 30.36 1663.9760 14 -5.0 832.9911 2 92.63 2 48433 AEV_1_3_RA2_01_1232.d 4.54E4 1 1 498 511 Methylation(KR)
K.YKLSVNDFLVK.A Y 30.06 1324.7390 11 -86.6 442.5487 3 83.18 1 44337 AEV 2_3_RA2_01_1224.d 8.85E4 1 1 329 339
R.N(+.98)AHTLGLSSISSQ(+.98)IK.D Y 29.16 1556.8046 15 21.5 519.9533 3 69.08 3 39518 AEV_3_3_RA3_01_1233.d 7.88E4 1 1 389 403 Deamidation (NQ)
R.E(+6.01)NPHYFVTSNLSVTK.L Y 27.06 1740.8658 15 -6.3 581.2922 3 67.64 3 38363 AEV_3_3_RA3_01_1233.d 1.42E5 1 1 299 313 Replacement of proton by lithium
K.GTGPGGR(+14.02).V Y 26.34 614.3136 7 -82.2 308.1388 2 76.68 1 39200 AEV 2_3_RA2_01_1224.d 2.76E4 2 2 250 256 Methylation(KR)
R.SPPTCIRESGHM(+15.99)YRLR.D Y 26.02 1917.9302 16 -7.2 640.3127 3 72.95 3 42557 AEV_3_3_RA3_01_1233.d 8.9E4 1 1 19 34 Oxidation (M)
K.VAPAAPK(+14.02)EESTPAAEEEPVSTGER(+14.02).L Y 25.74 2479.2078 24 1.5 827.4111 3 63.61 2 28295 AEV_1_3_RA2_01_1232.d 7.87E4 1 1 196 219 Methylation(KR)
R.ELKQIVENPLE(+14.02)LLL Y 24.46 1663.9760 14 2.9 832.9977 2 93.90 2 48935 AEV_1_3_RA2_01_1232.d 4.36E4 1 1 498 511 Methylation(others)
R.N(+.98)AHTLGLSSISSQIKDLGK.R Y 24.30 1969.0480 19 -9.7 657.3502 3 74.16 3 43475 AEV_3_3_RA3_01_1233.d 0 1 1 389 407 Deamidation (NQ)
R.GVPLKDIK.G Y 24.09 868.5381 8 -103.3 435.2315 2 57.65 1 24849 AEV 2_3_RA2_01_1224.d 4.98E5 3 3 242 249
K.NDVEK(+27.99).Y Y 23.74 631.2813 5 -55.8 632.2534 1 78.04 1 40292 AEV 2_3_RA2_01_1224.d 0 1 1 260 264 Formylation
R.L(+43.01)LQSMR(+14.02)ENPHYFVTSNLSVTK.L Y 23.36 2520.2795 21 -2.3 631.0757 4 64.87 3 36171 AEV_3_3_RA3_01_1233.d 4.18E4 1 1 293 313 Carbamylation; Methylation(KR)
R.ELKQIVEN(+.98)PLELLL Y 22.82 1650.9443 14 -21.8 826.4615 2 93.72 3 56664 AEV_3_3_RA3_01_1233.d 0 1 1 498 511 Deamidation (NQ)
K.VAPAAPK(+42.01).E Y 22.74 694.4014 7 -67.5 348.1845 2 13.20 3 4140 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 196 202 Acetylation (K)
MAASVMSRSASCR.S Y 22.29 1355.6108 13 -26.9 678.7944 2 97.76 1 54863 AEV 2_3_RA2_01_1224.d 6.03E4 1 1 1 13
R.LRDASR(+14.02)YGQC(+57.02)SR(+14.02).I Y 22.08 1495.7313 12 10.3 374.9440 4 77.26 1 39657 AEV 2_3_RA2_01_1224.d 9.81E4 1 1 33 44 Methylation(KR); Carbamidomethylation
R.EAGEK.D N 21.99 532.2493 5 -105.6 533.2003 1 36.45 1 12430 AEV 2_3_RA2_01_1224.d 1.57E5 3 3 143 147
R.EALN(+.98)TS(+79.97)ANGK(+42.01)YK.L Y 21.64 1417.6125 12 -44.9 709.7817 2 78.77 1 40910 AEV 2_3_RA2_01_1224.d 2.15E5 1 1 319 330 Deamidation (NQ); Phosphorylation (STY); Acetylation (K)
K.DIK(+27.99)GTGPGGR.V Y 21.31 984.4988 10 -54.8 329.1556 3 26.14 1 7047 AEV 2_3_RA2_01_1224.d 0 1 1 247 256 Formylation
R.E(+27.99)ALNTS(+79.97)ANGK.Y Y 20.79 1111.4547 10 19.2 556.7453 2 33.04 1 10654 AEV 2_3_RA2_01_1224.d 7.77E4 1 1 319 328 Formylation; Phosphorylation (STY)
K.DIKGT(+79.97)GPGGR(+14.02).V Y 20.74 1050.4858 10 -16.7 351.1634 3 29.85 1 8885 AEV 2_3_RA2_01_1224.d 0 1 1 247 256 Phosphorylation (STY); Methylation(KR)
R.NAHTLGLS(-18.01)SISSQIK(+14.02)DLGKR.A Y 20.57 2120.1702 20 -68.5 425.0123 5 71.32 3 41265 AEV_3_3_RA3_01_1233.d 1.73E4 1 1 389 408 Dehydration; Methylation(KR)
K.DIKGT(+79.97)GPGGR(+14.02)VTKNDVEK.Y Y 20.17 1963.9728 18 -2.8 655.6630 3 76.09 2 37464 AEV_1_3_RA2_01_1232.d 1.91E4 1 1 247 264 Phosphorylation (STY); Methylation(KR)
K.DIK(+42.01)GTGPGGRVTK(+27.99).N Y 20.07 1354.7205 13 -27.7 339.6780 4 15.84 3 5567 AEV_3_3_RA3_01_1233.d 3.42E5 1 1 247 259 Acetylation (K); Formylation
R.ENPHYFVTSN(+.98)LSVT(+79.97)K(+14.02).L Y 20.01 1829.8237 15 -8.4 458.4594 4 41.89 1 15506 AEV 2_3_RA2_01_1224.d 9.79E4 1 1 299 313 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
R.R(+14.02)QLPAFAALAR.F Y 19.54 1226.7247 11 30.3 307.6978 4 58.32 3 31172 AEV_3_3_RA3_01_1233.d 3.77E5 1 1 63 73 Methylation(KR)
K.QPEQPK.E Y 19.08 725.3708 6 37.4 726.4052 1 63.34 3 34999 AEV_3_3_RA3_01_1233.d 1.13E5 2 2 186 191
R.LLQSM(+15.99)R.E N 18.91 762.4058 6 -96.1 382.1736 2 41.82 1 15464 AEV 2_3_RA2_01_1224.d 1.04E5 1 1 293 298 Oxidation (M)
R.EALNTSANGK(+27.99).Y Y 18.81 1031.4883 10 -2.8 344.8358 3 28.33 2 9958 AEV_1_3_RA2_01_1232.d 4.35E5 1 1 319 328 Formylation
K.YQPAGTAVSGPPY(+79.97)E(+21.98)DIPASSMR.K Y 18.42 2395.0166 22 36.2 480.0280 5 29.91 1 8918 AEV 2_3_RA2_01_1224.d 0 1 1 265 286 Phosphorylation (STY); Sodium adduct
R.EALNTSAN(+.98)GKY(+79.97)K.L Y 18.24 1375.6021 12 -2.9 688.8063 2 52.20 1 21481 AEV 2_3_RA2_01_1224.d 3.13E4 1 1 319 330 Deamidation (NQ); Phosphorylation (STY)
R.LQ(+.98)PSLDRESFIAPAVK.A Y 18.18 1770.9515 16 -24.8 591.3098 3 73.01 3 42592 AEV_3_3_RA3_01_1233.d 9.26E4 1 1 220 235 Deamidation (NQ)
K.GT(-18.01)GPGGR(+14.02).V Y 18.08 596.3030 7 -5.5 597.3070 1 66.11 2 30028 AEV_1_3_RA2_01_1232.d 0 1 1 250 256 Dehydration; Methylation(KR)
K.GTGPGGR.V Y 18.04 600.2980 7 3.1 601.3071 1 24.72 3 10452 AEV_3_3_RA3_01_1233.d 9.63E4 2 2 250 256
K.VAP(+31.99)AAPK.E Y 17.94 684.3806 7 -141.4 685.2911 1 78.99 1 41041 AEV 2_3_RA2_01_1224.d 6.11E4 1 1 196 202 Dihydroxy
K.GTGPGGR(+21.98)(+14.02).V Y 17.88 636.2955 7 -17.0 637.2920 1 31.31 3 14151 AEV_3_3_RA3_01_1233.d 0 1 1 250 256 Sodium adduct; Methylation(KR)
K.EELK(+14.02)VAPAAP(+31.99)K.E Y 17.83 1197.6604 11 1.7 400.2281 3 43.00 3 21286 AEV_3_3_RA3_01_1233.d 2.62E5 1 1 192 202 Methylation(KR); Dihydroxy
K.DIKGTGPGGRVTK(+21.98)(+42.01).N Y 17.67 1348.7075 13 -43.1 338.1696 4 81.00 1 42656 AEV 2_3_RA2_01_1224.d 1.25E5 1 1 247 259 Sodium adduct; Acetylation (K)
K.Q(+.98)PEQPK.E Y 17.65 726.3548 6 -51.5 364.1660 2 44.54 1 17024 AEV 2_3_RA2_01_1224.d 7.87E4 1 1 186 191 Deamidation (NQ)
K.VAPAAPK(+27.99).E Y 17.26 680.3857 7 -64.5 681.3491 1 71.64 2 34073 AEV_1_3_RA2_01_1232.d 1.23E4 1 1 196 202 Formylation
K.VAIPVEGEDSTSVK.W Y 17.23 1429.7300 14 4.8 715.8757 2 63.79 2 28422 AEV_1_3_RA2_01_1232.d 3.84E4 1 1 458 471
K.EE(+17.03)STPAAEEEPVSTGER.L Y 17.11 1833.8228 17 -54.3 612.2484 3 69.82 1 33813 AEV 2_3_RA2_01_1224.d 1.9E5 1 1 203 219 Replacement of proton with ammonium ion
R.KVAIPVEGEDSTSVK.W Y 17.03 1557.8250 15 -3.8 520.2803 3 58.40 2 24876 AEV_1_3_RA2_01_1232.d 5.83E4 1 1 457 471
K.EESTPAAEEE(+28.03)PVSTGER.L Y 16.98 1844.8275 17 8.4 462.2180 4 21.23 3 8500 AEV_3_3_RA3_01_1233.d 0 1 1 203 219 Ethylation
K.DIK(+14.02)GT(+79.97)GPGGR(+14.02).V Y 16.89 1064.5016 10 -17.0 533.2490 2 53.30 2 22147 AEV_1_3_RA2_01_1232.d 0 1 1 247 256 Methylation(KR); Phosphorylation (STY)
R.RQLPAFAALARFYASK(+42.01).S Y 16.79 1851.0155 16 -3.6 371.2090 5 51.64 3 26820 AEV_3_3_RA3_01_1233.d 3.16E5 1 1 63 78 Acetylation (K)
K.DIK(+31.99)GT(+79.97)GPGGR.V Y 16.71 1068.4601 10 47.5 1069.5181 1 102.37 1 56503 AEV 2_3_RA2_01_1224.d 7.74E4 1 1 247 256 Dihydroxy; Phosphorylation (STY)
R.E(+43.01)ALNT(+79.97)SANGK.Y Y 16.68 1126.4656 10 -14.5 564.2319 2 63.12 1 28873 AEV 2_3_RA2_01_1224.d 0 1 1 319 328 Carbamylation; Phosphorylation (STY)
K.NDVE(+21.98)K.Y Y 16.57 625.2683 5 -7.0 626.2712 1 55.11 1 23243 AEV 2_3_RA2_01_1224.d 0 1 1 260 264 Sodium adduct
K.DIK(+43.99)GTGPGGR.V Y 16.54 1000.4937 10 -87.0 501.2106 2 59.92 1 26426 AEV 2_3_RA2_01_1224.d 1.3E5 1 1 247 256 Carboxylation (DKW)
K.LR(+14.02)EALN(+.98)TS(+79.97)ANGK.Y Y 16.20 1367.6445 12 38.6 456.9064 3 42.28 3 20832 AEV_3_3_RA3_01_1233.d 0 1 1 317 328 Methylation(KR); Deamidation (NQ); Phosphorylation (STY)
K.NDVEK.Y Y 16.04 603.2864 5 -82.5 604.2439 1 28.48 1 8189 AEV 2_3_RA2_01_1224.d 0 1 1 260 264
K.DIKGTGPGGR.V Y 15.98 956.5039 10 -103.8 479.2096 2 25.93 1 6959 AEV 2_3_RA2_01_1224.d 2.18E4 1 1 247 256
K.D(+28.03)IKGTGPGGR.V Y 15.80 984.5352 10 19.8 493.2846 2 33.57 3 15487 AEV_3_3_RA3_01_1233.d 6.77E4 1 1 247 256 Ethylation
K.G(+134.05)TGPGGR.V Y 15.67 734.3459 7 -66.8 735.3042 1 106.62 1 57782 AEV 2_3_RA2_01_1224.d 0 1 1 250 256 3-methyl-2-pyridyl isocyanate
K.IVDGAVGAEWMRELK.Q Y 15.65 1672.8606 15 -20.9 837.4201 2 79.71 2 40332 AEV_1_3_RA2_01_1232.d 4E4 1 1 486 500
K.A(+43.01)LALER.G Y 15.63 714.4024 6 16.5 358.2144 2 17.56 3 6512 AEV_3_3_RA3_01_1233.d 4.6E4 1 1 236 241 Carbamylation
R.ENPHYFVTS(+162.05)NLS(+79.97)VTK.L Y 15.48 1976.8768 15 -13.5 495.2198 4 84.29 1 45211 AEV 2_3_RA2_01_1224.d 3.14E4 1 1 299 313 Hexose (NSY); Phosphorylation (STY)
K.G(+42.01)T(-18.01)GPGGR.V Y 15.46 624.2980 7 -4.7 625.3023 1 25.12 3 10646 AEV_3_3_RA3_01_1233.d 3.15E4 1 1 250 256 Acetylation (N-term); Dehydration
R.EALNTSANGK(+14.02)YK.L Y 15.35 1308.6674 12 36.7 437.2457 3 39.57 2 15263 AEV_1_3_RA2_01_1232.d 0 1 1 319 330 Methylation(KR)
R.FTAVIN(+.98)PPQSAILAVGTT(+79.97)R.K Y 15.33 2036.0343 19 -22.9 510.0042 4 62.47 3 34324 AEV_3_3_RA3_01_1233.d 9.96E4 1 1 438 456 Deamidation (NQ); Phosphorylation (STY)
total 99 peptides
C1G9X3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.YGQSAGNVGDEGGVAPDIQTPEEALDLITEAIEQAGYTGQVK.I Y 125.25 4290.0449 42 -2.1 1431.0193 3 97.65 3 58275 AEV_3_3_RA3_01_1233.d 1.15E5 4 4 201 242
K.LNQILRIEEELGSNAVYAGDKFR.A Y 120.50 2634.3765 23 2.7 659.6031 4 82.36 3 49857 AEV_3_3_RA3_01_1233.d 2.73E5 3 3 411 433
R.GNPTVEVDVVTETGLHR.A Y 116.49 1821.9221 17 3.5 608.3168 3 71.18 2 33729 AEV_1_3_RA2_01_1232.d 6.92E5 4 4 16 32
R.AIVPSGASTGQHEAC(+57.02)ELR.D Y 115.51 1881.9003 18 5.1 628.3105 3 59.61 2 25644 AEV_1_3_RA2_01_1232.d 8.8E5 5 5 33 50 Carbamidomethylation
K.LGANAILGVSLAIAK.A Y 115.32 1409.8606 15 -0.8 705.9370 2 83.87 3 50929 AEV_3_3_RA3_01_1233.d 4.49E5 3 3 106 120
R.SGETEDVTIADVVVGLR.A Y 113.12 1758.8999 17 -5.9 880.4520 2 83.97 3 51011 AEV_3_3_RA3_01_1233.d 8.15E5 6 6 377 393
K.KPYVLPVPFQNVLNGGSHAGGR.L Y 109.23 2306.2283 22 6.1 577.5679 4 78.84 2 39636 AEV_1_3_RA2_01_1232.d 2.15E5 1 1 142 163
K.IALDIASSEFYKADEK.K Y 107.85 1798.8988 16 3.0 600.6420 3 76.18 2 37533 AEV_1_3_RA2_01_1232.d 3.61E5 2 2 243 258
K.TC(+57.02)DLQVVADDLTVTNPIR.I Y 104.98 2029.0150 18 6.2 677.3498 3 83.06 3 50405 AEV_3_3_RA3_01_1233.d 2.82E5 4 4 314 331 Carbamidomethylation
R.SVYDSRGNPTVEVDVVTETGLHR.A Y 103.49 2529.2458 23 3.4 633.3209 4 72.67 3 42320 AEV_3_3_RA3_01_1233.d 6.82E5 3 3 10 32
R.IEEELGSNAVYAGDKFR.A Y 97.39 1896.9216 17 0.5 633.3148 3 68.15 3 38770 AEV_3_3_RA3_01_1233.d 8.88E5 4 4 417 433
R.LAFQEFMIVPTAAPSFSEALR.Q Y 92.23 2324.1875 21 -0.2 1163.1008 2 91.27 3 55423 AEV_3_3_RA3_01_1233.d 4.35E5 4 4 164 184
K.VNQIGTLTESIQAAK.D Y 92.09 1571.8518 15 1.3 786.9342 2 73.06 2 35161 AEV_1_3_RA2_01_1232.d 2.69E5 3 3 348 362
K.NVNSIIGPAIIK.E Y 84.56 1237.7394 12 -8.7 619.8716 2 75.86 2 37282 AEV_1_3_RA2_01_1232.d 2.66E5 3 3 68 79
K.VDEFLNKLDGTPNK.S Y 80.53 1588.8097 14 6.2 530.6138 3 67.58 2 31065 AEV_1_3_RA2_01_1232.d 5E5 3 3 90 103
K.GVPLYAHVSDLAGTK.K Y 80.30 1526.8092 15 4.2 509.9458 3 70.30 2 33104 AEV_1_3_RA2_01_1232.d 6.37E5 3 3 127 141
K.IALDIASSEFYK.A Y 75.07 1355.6973 12 0.9 678.8565 2 79.29 2 39990 AEV_1_3_RA2_01_1232.d 1.79E5 2 2 243 254
K.WLTYEQLADLYKK.L Y 72.41 1669.8715 13 -6.3 557.6276 3 80.90 3 48768 AEV_3_3_RA3_01_1233.d 4.36E5 3 3 274 286
K.NVNSIIGPAIIKENIDVK.D Y 69.77 1936.0992 18 -0.6 646.3733 3 78.44 2 39325 AEV_1_3_RA2_01_1232.d 4.96E4 1 1 68 85
R.G(+42.01)NPTVEVDVVTETGLHR.A Y 60.48 1863.9326 17 9.2 622.3239 3 70.80 3 40856 AEV_3_3_RA3_01_1233.d 8.92E4 1 1 16 32 Acetylation (Protein N-term)
K.SC(+57.02)NALLLK.V Y 56.61 917.5004 8 1.9 459.7584 2 55.63 3 29302 AEV_3_3_RA3_01_1233.d 1.21E6 3 3 340 347 Carbamidomethylation
K.KPYVLPVPFQNVLN(+.98)GGSHAGGR.L Y 55.32 2307.2124 22 8.8 577.8154 4 79.82 2 40414 AEV_1_3_RA2_01_1232.d 1.21E5 1 1 142 163 Deamidation (NQ)
R.AIVPSGASTGQHEAC(+57.02)ELR(+14.02).D Y 55.12 1895.9159 18 -1.4 632.9783 3 62.04 3 33998 AEV_3_3_RA3_01_1233.d 1.65E5 3 3 33 50 Carbamidomethylation; Methylation(KR)
R.LAFQEFM(+15.99)IVPTAAPSFSEALR.Q Y 49.53 2340.1824 21 6.2 781.0729 3 88.74 2 46588 AEV_1_3_RA2_01_1232.d 1.66E5 2 2 164 184 Oxidation (M)
K.KPYVLPVPFQ(+.98)NVLNGGSHAGGR.L Y 46.59 2307.2124 22 0.3 577.8105 4 78.18 3 46644 AEV_3_3_RA3_01_1233.d 4.55E4 1 1 142 163 Deamidation (NQ)
R.LAFQEFMIVPTAAPSFSEALR(+14.02).Q Y 44.44 2338.2031 21 -5.4 1170.1025 2 92.11 3 55849 AEV_3_3_RA3_01_1233.d 1.41E5 3 3 164 184 Methylation(KR)
K.GVPLY(-2.02)AHVSDLAGTK.K Y 43.76 1524.7936 15 -20.4 509.2614 3 69.51 3 39856 AEV_3_3_RA3_01_1233.d 0 1 1 127 141 2-amino-3-oxo-butanoic_acid
R.SGETED(+14.02)VTIADVVVGLR.A Y 42.70 1772.9155 17 -0.8 591.9786 3 84.97 2 44295 AEV_1_3_RA2_01_1232.d 5.54E4 1 1 377 393 Methylation(others)
R.GN(+.98)PTVEVDVVTETGLHR(+14.02).A Y 39.97 1836.9218 17 7.5 613.3191 3 74.15 3 43461 AEV_3_3_RA3_01_1233.d 0 1 1 16 32 Deamidation (NQ); Methylation(KR)
K.GVLNAVK.N Y 36.99 699.4279 7 -89.0 350.6901 2 59.69 1 26253 AEV 2_3_RA2_01_1224.d 7.01E5 3 3 61 67
R.LAKLNQILR.I Y 36.88 1067.6815 9 0.7 356.9014 3 62.65 3 34465 AEV_3_3_RA3_01_1233.d 4.67E4 1 1 408 416
K.LDGTPNK.S Y 32.97 743.3813 7 -76.5 744.3318 1 88.18 1 48246 AEV 2_3_RA2_01_1224.d 9.75E4 7 7 97 103
R.Q(-17.03)GSEVYHK.L Y 32.84 929.4243 8 -84.7 465.6800 2 31.20 1 9627 AEV 2_3_RA2_01_1224.d 1.82E5 2 2 185 192 Pyro-glu from Q
K.AIELK.S Y 29.57 572.3533 5 -122.2 573.2906 1 40.59 1 14754 AEV 2_3_RA2_01_1224.d 0 1 1 335 339
K.VNQIGTLTESIQAAK(+226.08).D Y 28.27 1797.9294 15 0.9 360.5935 5 30.96 3 13946 AEV_3_3_RA3_01_1233.d 1.01E6 1 1 348 362 Biotinylation
R.AAINM(+15.99) Y 25.83 534.2472 5 -11.1 535.2485 1 17.24 3 6342 AEV_3_3_RA3_01_1233.d 1.65E4 1 1 434 438 Oxidation (M)
K.LNQILR.I Y 25.12 755.4653 6 -11.3 378.7357 2 41.81 3 20542 AEV_3_3_RA3_01_1233.d 1.57E5 3 3 411 416
K.WLGKGVLNAVK.N Y 24.48 1183.7076 11 -10.5 395.5724 3 72.00 2 34344 AEV_1_3_RA2_01_1232.d 3.69E4 1 1 57 67
R.GN(+.98)PTVEVDVVTETGLHR.A Y 24.45 1822.9061 17 -87.7 608.5894 3 77.12 1 39576 AEV 2_3_RA2_01_1224.d 2.49E5 1 1 16 32 Deamidation (NQ)
K.T(+79.97)GAPAR.S Y 24.04 651.2741 6 81.7 652.3346 1 80.03 1 41865 AEV 2_3_RA2_01_1224.d 0 1 1 399 404 Phosphorylation (STY)
R.L(+56.06)AFQEFMIVPTAAPSFSEALR.Q Y 23.89 2380.2500 21 -29.8 794.4003 3 85.21 2 44457 AEV_1_3_RA2_01_1232.d 0 1 1 164 184 Diethylation
K.GVLNAVK(+226.08).N Y 22.24 925.5055 7 -70.1 309.4875 3 76.37 1 38954 AEV 2_3_RA2_01_1224.d 2.62E4 1 1 61 67 Biotinylation
R.AGQIKTGAPAR.S Y 20.64 1068.6040 11 16.9 357.2146 3 29.55 3 13127 AEV_3_3_RA3_01_1233.d 0 1 1 394 404
K.A(+43.01)GAAEK.G Y 20.55 588.2867 6 -88.9 589.2416 1 72.37 1 35801 AEV 2_3_RA2_01_1224.d 4.06E4 1 1 121 126 Carbamylation
R.AAINM Y 19.71 518.2523 5 19.1 519.2694 1 59.00 2 25232 AEV_1_3_RA2_01_1232.d 2.68E4 1 1 434 438
K.YD(+17.03)LDFK.N Y 19.53 816.4017 6 -9.8 409.2041 2 57.86 2 24561 AEV_1_3_RA2_01_1232.d 0 1 1 260 265 Replacement of proton with ammonium ion
K.TGAPAR.S Y 19.19 571.3078 6 114.5 572.3805 1 101.80 1 56307 AEV 2_3_RA2_01_1224.d 3.8E5 4 4 399 404
K.LDGT(+79.97)PNK.S Y 19.13 823.3477 7 45.7 824.3926 1 102.20 1 56446 AEV 2_3_RA2_01_1224.d 0 1 1 97 103 Phosphorylation (STY)
R.AGQIKTGAP(+31.99)AR.S Y 19.02 1100.5938 11 39.8 367.8864 3 52.78 2 21873 AEV_1_3_RA2_01_1232.d 5E4 1 1 394 404 Dihydroxy
K.KYDLDFKNPDSDKSK.W Y 19.00 1798.8737 15 2.3 450.7267 4 50.17 2 20528 AEV_1_3_RA2_01_1232.d 8.38E4 1 1 259 273
K.LDGTPN(+.98)K.S Y 18.78 744.3654 7 -74.6 745.3171 1 95.00 1 53141 AEV 2_3_RA2_01_1224.d 8.68E4 2 2 97 103 Deamidation (NQ)
K.AGAAEK(+43.99).G Y 18.73 589.2708 6 -13.5 590.2701 1 25.73 3 10983 AEV_3_3_RA3_01_1233.d 1.85E6 1 1 121 126 Carboxylation (DKW)
K.L(+43.01)DGTPNK.S Y 18.64 786.3871 7 -42.6 394.1841 2 47.11 1 18548 AEV 2_3_RA2_01_1224.d 0 1 1 97 103 Carbamylation
K.LD(+21.98)GTPNK.S Y 18.47 765.3633 7 -50.7 383.6695 2 50.32 1 20404 AEV 2_3_RA2_01_1224.d 2.74E5 1 1 97 103 Sodium adduct
K.ENIDVKDQSKVDEFLNKLDGTPNK.S Y 18.02 2745.3821 24 16.2 687.3639 4 91.13 3 55323 AEV_3_3_RA3_01_1233.d 3.15E4 1 1 80 103
R.AAIN(+.98)M Y 17.98 519.2363 5 -73.5 520.2054 1 43.12 1 16222 AEV 2_3_RA2_01_1224.d 9.48E4 1 1 434 438 Deamidation (NQ)
R.SGE(+14.02)TEDVTIADVVVGLR.A Y 17.69 1772.9155 17 -81.8 591.9308 3 90.64 1 50088 AEV 2_3_RA2_01_1224.d 5.09E4 1 1 377 393 Methylation(others)
K.T(+14.02)GAPAR.S Y 17.63 585.3234 6 -124.6 586.2578 1 86.61 1 47045 AEV 2_3_RA2_01_1224.d 1.08E5 1 1 399 404 Methylation(others)
K.LDGTPNKSK(+27.99).L Y 17.07 986.5032 9 24.5 329.8497 3 16.73 2 5049 AEV_1_3_RA2_01_1232.d 0 1 1 97 105 Formylation
K.G(+27.99)VLNAVK(+42.01).N Y 17.05 769.4334 7 -26.5 770.4203 1 87.03 3 53009 AEV_3_3_RA3_01_1233.d 2.93E4 1 1 61 67 Formylation; Acetylation (K)
K.EN(+.98)ID(-18.01)VK.D Y 16.70 699.3439 6 19.0 700.3644 1 20.32 3 7979 AEV_3_3_RA3_01_1233.d 1.93E4 1 1 80 85 Deamidation (NQ); Dehydration
M.AITKIHAR.S Y 16.50 908.5555 8 -37.9 455.2678 2 15.06 3 5158 AEV_3_3_RA3_01_1233.d 0 1 1 2 9
K.TGAPAR(+28.03).S Y 16.48 599.3391 6 -17.2 600.3361 1 51.02 3 26384 AEV_3_3_RA3_01_1233.d 3.93E5 1 1 399 404 Dimethylation(KR)
K.VNQIGTLTESIQAAKDSYAAGWGVM(+15.99)VSHR.S Y 16.45 3104.5349 29 5.8 777.1455 4 81.57 3 49269 AEV_3_3_RA3_01_1233.d 1.87E5 1 1 348 376 Oxidation (M)
K.NPDSD(-18.01)K.S Y 16.13 656.2766 6 -3.8 657.2813 1 84.96 1 45752 AEV 2_3_RA2_01_1224.d 1.9E4 1 1 266 271 Dehydration
K.NPDSDKSK.W Y 15.80 889.4141 8 -37.8 445.6975 2 44.86 1 17208 AEV 2_3_RA2_01_1224.d 6.57E4 1 1 266 273
K.K(-1.03)PYVLPVPFQNVLNGGSHAGGR.L Y 15.75 2305.1968 22 8.6 577.3114 4 78.74 2 39554 AEV_1_3_RA2_01_1232.d 0 1 1 142 163 Lysine oxidation to aminoadipic semialdehyde
K.AIELKSC(+57.02)N(+.98)ALLLK.V Y 15.70 1472.8273 13 -26.3 369.2044 4 63.04 2 27908 AEV_1_3_RA2_01_1232.d 3.25E4 1 1 335 347 Carbamidomethylation; Deamidation (NQ)
K.TGAPAR(+79.97).S Y 15.49 651.2741 6 14.5 326.6490 2 25.73 1 6872 AEV 2_3_RA2_01_1224.d 4.66E5 1 1 399 404 Phosphorylation (HCDR)
K.ENIDVKDQSKVDEFLN(+.98)KLDGTPN(+.98)K.S Y 15.48 2747.3501 24 -20.9 687.8304 4 75.11 2 36702 AEV_1_3_RA2_01_1232.d 1.54E5 1 1 80 103 Deamidation (NQ)
K.L(+43.01)DGTPN(+.98)K.S Y 15.33 787.3712 7 9.4 788.3859 1 78.80 2 39605 AEV_1_3_RA2_01_1232.d 4.47E4 1 1 97 103 Carbamylation; Deamidation (NQ)
K.G(+43.01)VLNAVK.N Y 15.32 742.4337 7 -3.5 743.4384 1 101.31 3 59495 AEV_3_3_RA3_01_1233.d 7.01E4 1 1 61 67 Carbamylation
R.AGQ(+.98)IKTGAPAR(+14.02).S Y 15.17 1083.6036 11 0.3 362.2086 3 58.36 2 24852 AEV_1_3_RA2_01_1232.d 0 1 1 394 404 Deamidation (NQ); Methylation(KR)
M(+15.99)AIT(-18.01)K.I Y 15.10 560.2992 5 -30.4 561.2894 1 73.36 3 42869 AEV_3_3_RA3_01_1233.d 0 1 1 1 5 Oxidation (M); Dehydration
K.N(+42.01)VNS(+79.97)IIGPAIIK.E Y 15.02 1359.7163 12 9.7 454.2504 3 64.47 2 28879 AEV_1_3_RA2_01_1232.d 0 1 1 68 79 Acetylation (N-term); Phosphorylation (STY)
K.AIELK(+31.99).S Y 15.00 604.3431 5 -16.0 303.1740 2 30.89 2 11123 AEV_1_3_RA2_01_1232.d 0 1 1 335 339 Dihydroxy
total 76 peptides
C1G9C0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VLNSYWINQDSTYKYYEVILVDPQHK.A Y 148.58 3214.5974 26 11.5 804.6658 4 83.88 2 43556 AEV_1_3_RA2_01_1232.d 1.09E6 4 4 115 140
K.GATYGKPTNHGINQLK.Y Y 134.51 1697.8849 16 5.7 566.9721 3 40.12 2 15543 AEV_1_3_RA2_01_1232.d 1.04E7 16 16 78 93
K.GATYGKPTNHGINQLKYQR.S Y 126.80 2145.1079 19 3.8 537.2863 4 48.39 2 19641 AEV_1_3_RA2_01_1232.d 3.55E6 12 12 78 96
R.VLNSYWINQDSTYK.Y Y 112.38 1729.8312 14 15.2 865.9360 2 74.58 2 36312 AEV_1_3_RA2_01_1232.d 6.09E5 4 4 115 128
K.YYEVILVDPQHK.A Y 97.84 1502.7769 12 -3.7 752.3929 2 70.91 2 33528 AEV_1_3_RA2_01_1232.d 1.52E6 6 6 129 140
R.INWIVNPVHK.H Y 87.58 1218.6873 10 -3.8 407.2348 3 69.59 3 39923 AEV_3_3_RA3_01_1233.d 4.84E6 10 10 148 157
R.C(+57.02)AN(-17.03)LRVLNSYWINQDSTYKYYEVILVDPQHK.A Y 80.94 3811.8667 31 1.3 953.9752 4 88.02 3 53623 AEV_3_3_RA3_01_1233.d 0 1 1 110 140 Carbamidomethylation; Ammonia-loss (N)
K.YVEELQK.K Y 77.86 907.4651 7 3.7 454.7415 2 35.75 2 13421 AEV_1_3_RA2_01_1232.d 3E6 10 10 6 12
R.SLRSTAEER.V Y 75.53 1047.5309 9 4.5 350.1858 3 17.99 3 6743 AEV_3_3_RA3_01_1233.d 1.3E6 9 9 97 105
K.GATYGKPTNHGIN(+.98)QLK.Y Y 71.80 1698.8689 16 0.9 567.2974 3 44.85 2 17856 AEV_1_3_RA2_01_1232.d 1.11E6 4 4 78 93 Deamidation (NQ)
R.LNTQSYWR.Y Y 71.25 1066.5195 8 2.3 534.2682 2 61.14 2 26651 AEV_1_3_RA2_01_1232.d 2.37E6 7 7 194 201
K.YYE(+14.02)VILVDPQHK.A Y 68.83 1516.7925 12 6.8 506.6082 3 74.39 2 36167 AEV_1_3_RA2_01_1232.d 7.11E4 1 1 129 140 Methylation(others)
K.GATYGKPTN(+.98)HGINQLK.Y Y 68.79 1698.8689 16 -2.0 567.2958 3 43.03 3 21309 AEV_3_3_RA3_01_1233.d 6.94E5 3 3 78 93 Deamidation (NQ)
R.QLNVIHR.A Y 68.76 878.5086 7 0.9 440.2620 2 34.55 2 12858 AEV_1_3_RA2_01_1232.d 6.71E5 6 6 32 38
K.G(+41.03)ATYGKPTNHGINQLK.Y Y 68.09 1738.9114 16 17.2 435.7426 4 40.18 2 15556 AEV_1_3_RA2_01_1232.d 0 3 3 78 93 Amidination of lysines or N-terminal amines with methyl acetimidate
K.AKQGYVIYR.I Y 68.01 1096.6029 9 0.4 549.3090 2 38.15 3 18278 AEV_3_3_RA3_01_1233.d 2.38E6 8 8 55 63
K.RLNTQSYWR.Y Y 67.98 1222.6207 9 0.8 408.5479 3 50.61 3 26106 AEV_3_3_RA3_01_1233.d 1.82E6 7 7 193 201
K.GAT(-2.02)YGKPTNHGINQLK.Y Y 66.17 1695.8693 16 20.7 566.3087 3 37.15 3 17682 AEV_3_3_RA3_01_1233.d 0 2 2 78 93 2-amino-3-oxo-butanoic_acid
K.QGYVIYR.I Y 62.41 897.4708 7 3.2 449.7441 2 55.50 2 23291 AEV_1_3_RA2_01_1232.d 2.78E6 6 6 57 63
K.GATYGKPTNHGINQ(+.98)LK.Y Y 59.89 1698.8689 16 1.5 567.2977 3 43.19 2 17054 AEV_1_3_RA2_01_1232.d 4.74E5 4 4 78 93 Deamidation (NQ)
K.GATYGKPTNHGINQLK(+14.02).Y Y 59.42 1711.9005 16 5.0 428.9846 4 49.07 2 19975 AEV_1_3_RA2_01_1232.d 3.66E5 1 1 78 93 Methylation(KR)
R.Q(-17.03)LNVIHR.A Y 58.79 861.4821 7 -92.1 431.7086 2 67.96 1 32405 AEV 2_3_RA2_01_1224.d 3.53E6 3 3 32 38 Pyro-glu from Q
M.GALKYVEELQK.K Y 55.95 1276.7026 11 -10.3 426.5704 3 66.22 3 37257 AEV_3_3_RA3_01_1233.d 1.03E6 2 2 2 12
R.GLTATGKK.S Y 54.94 774.4600 8 4.5 388.2390 2 9.75 2 2397 AEV_1_3_RA2_01_1232.d 9.58E4 2 2 163 170
R.INWIVNPVHKHR.E Y 54.02 1511.8473 12 -0.1 378.9691 4 59.17 3 31801 AEV_3_3_RA3_01_1233.d 2.73E5 2 2 148 159
R.ASRPSRPDK.A Y 52.59 1012.5413 9 5.9 338.5230 3 9.12 2 2207 AEV_1_3_RA2_01_1232.d 2.4E6 8 8 39 47
R.INWIVNPVHK(+14.02).H Y 51.96 1232.7030 10 0.6 411.9085 3 69.49 2 32490 AEV_1_3_RA2_01_1232.d 2.5E5 2 2 148 157 Methylation(KR)
R.LNTQ(+.98)SYWR.Y Y 48.78 1067.5035 8 3.6 534.7610 2 63.02 2 27898 AEV_1_3_RA2_01_1232.d 2.17E5 2 2 194 201 Deamidation (NQ)
R.VLN(+.98)SYWINQDSTYKYYEVILVDPQHK.A Y 48.61 3215.5815 26 8.3 804.9093 4 84.85 2 44210 AEV_1_3_RA2_01_1232.d 0 1 1 115 140 Deamidation (NQ)
R.VRC(+57.02)WELR.Q Y 48.03 1017.5178 7 18.1 340.1860 3 51.39 2 21150 AEV_1_3_RA2_01_1232.d 1.04E6 5 5 25 31 Carbamidomethylation
K.YVEELQ(+.98)K.K Y 47.60 908.4491 7 -86.3 455.1926 2 50.78 1 20687 AEV 2_3_RA2_01_1224.d 3.53E5 2 2 6 12 Deamidation (NQ)
K.GATY(-18.01)GK(+14.02)PTNHGINQLKYQR.S Y 47.34 2141.1130 19 3.6 429.2314 5 48.76 2 19829 AEV_1_3_RA2_01_1232.d 0 1 1 78 96 Dehydration; Methylation(KR)
R.I(+41.03)NWIVNPVHK.H Y 45.58 1259.7139 10 -5.8 420.9095 3 70.63 2 33323 AEV_1_3_RA2_01_1232.d 4.13E4 1 1 148 157 Amidination of lysines or N-terminal amines with methyl acetimidate
R.SLRSTAEER(+14.02).V Y 43.64 1061.5465 9 -9.2 354.8528 3 27.08 3 11744 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 97 105 Methylation(KR)
R.IN(+162.05)WIVNPVHK.H Y 42.94 1380.7401 10 -55.1 461.2286 3 93.15 1 51866 AEV 2_3_RA2_01_1224.d 9.45E4 2 2 148 157 Hexose (NSY)
R.LNTQSYW(+15.99)R.Y Y 42.23 1082.5145 8 5.8 542.2677 2 58.85 2 25140 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 194 201 Oxidation (HW)
K.YVE(+14.02)ELQK.K Y 41.95 921.4807 7 8.3 461.7515 2 49.19 2 20038 AEV_1_3_RA2_01_1232.d 1E6 3 3 6 12 Methylation(others)
K.YVEE(+14.02)LQK.K Y 41.52 921.4807 7 2.8 461.7489 2 45.40 2 18129 AEV_1_3_RA2_01_1232.d 1.17E6 6 6 6 12 Methylation(others)
K.YVEELQK(+14.02).K Y 41.39 921.4807 7 -0.5 461.7474 2 43.86 3 21823 AEV_3_3_RA3_01_1233.d 9.06E5 3 3 6 12 Methylation(KR)
K.Q(+.98)GYVIYR.I Y 40.35 898.4548 7 0.7 450.2350 2 56.58 3 29972 AEV_3_3_RA3_01_1233.d 5.05E5 4 4 57 63 Deamidation (NQ)
R.LNTQSYWR(+14.02).Y Y 40.23 1080.5353 8 6.0 541.2781 2 65.48 2 29637 AEV_1_3_RA2_01_1232.d 2.69E5 2 2 194 201 Methylation(KR)
K.YVEELQKK.K Y 39.90 1035.5601 8 -20.4 518.7767 2 24.09 3 10046 AEV_3_3_RA3_01_1233.d 2.03E5 3 3 6 13
R.C(+57.02)WELR.Q Y 39.20 762.3483 5 -85.6 763.2903 1 65.37 1 30406 AEV 2_3_RA2_01_1224.d 3.45E4 2 2 27 31 Carbamidomethylation
R.VLNSY(+79.97)WINQDSTYK.Y Y 37.09 1809.7975 14 10.0 905.9150 2 83.01 1 44199 AEV 2_3_RA2_01_1224.d 2.47E4 1 1 115 128 Phosphorylation (STY)
R.ASRPSRPDKAR.R Y 36.87 1239.6796 11 -3.0 414.2325 3 9.97 2 2482 AEV_1_3_RA2_01_1232.d 6.72E5 6 6 39 49
R.LN(+.98)TQSYWR.Y Y 36.26 1067.5035 8 15.9 534.7675 2 60.21 3 32570 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 194 201 Deamidation (NQ)
R.GLTATGKK(+14.02).S Y 35.10 788.4756 8 -18.8 395.2376 2 13.53 2 3803 AEV_1_3_RA2_01_1232.d 0 1 1 163 170 Methylation(KR)
R.IN(+45.99)WIVNPVHK.H Y 34.33 1264.6750 10 25.9 422.5765 3 70.57 2 33276 AEV_1_3_RA2_01_1232.d 5.58E4 1 1 148 157 Beta-methylthiolation (ND)
K.GAT(-18.01)YGK(+14.02)PTNHGINQLKYQR.S Y 33.98 2141.1130 19 8.2 429.2334 5 45.33 3 22770 AEV_3_3_RA3_01_1233.d 0 1 1 78 96 Dehydration; Methylation(KR)
K.QGYVIYR(+14.02).I Y 33.86 911.4865 7 -4.3 456.7485 2 60.04 3 32451 AEV_3_3_RA3_01_1233.d 8.69E4 1 1 57 63 Methylation(KR)
K.KKQSDVIR.F Y 33.48 972.5716 8 -21.9 487.2824 2 10.68 2 2726 AEV_1_3_RA2_01_1232.d 0 1 1 13 20
K.QSDVIRFLLR.V Y 33.23 1245.7194 10 3.0 416.2483 3 78.59 2 39435 AEV_1_3_RA2_01_1232.d 2.53E4 1 1 15 24
R.LNTQSYW(+31.99)R.Y Y 33.00 1098.5094 8 5.6 550.2651 2 41.26 2 16074 AEV_1_3_RA2_01_1232.d 3.34E5 2 2 194 201 Dihydroxy
R.Q(-17.03)LNVIHR(+14.02).A Y 32.39 875.4977 7 3.2 438.7575 2 61.82 2 27072 AEV_1_3_RA2_01_1232.d 2.15E5 2 2 32 38 Pyro-glu from Q; Methylation(KR)
K.Y(+43.01)YEVILVDPQHK.A Y 32.31 1545.7827 12 19.7 516.2783 3 71.13 2 33695 AEV_1_3_RA2_01_1232.d 9.91E4 1 1 129 140 Carbamylation
R.C(+58.01)ANLR.V Y 30.59 633.2904 5 -86.5 317.6251 2 22.04 1 5400 AEV 2_3_RA2_01_1224.d 6.55E4 1 1 110 114 Carboxymethyl
R.GLGRGHKYNK.T Y 30.57 1128.6152 10 -11.7 565.3083 2 11.32 3 3165 AEV_3_3_RA3_01_1233.d 0 1 1 173 182
R.VLNSYWINQD(-18.01)STYK(+14.02)YYEVILVDPQHK.A Y 29.48 3210.6025 26 -4.3 803.6544 4 89.52 1 49272 AEV 2_3_RA2_01_1224.d 0 1 1 115 140 Dehydration; Methylation(KR)
K.GATYGKPTNHGINQLKYQ(+.98)R.S Y 29.42 2146.0918 19 4.4 430.2275 5 46.78 3 23672 AEV_3_3_RA3_01_1233.d 9.67E4 1 1 78 96 Deamidation (NQ)
K.Q(-17.03)GYVIYR.I Y 28.30 880.4443 7 -85.7 441.1917 2 74.43 1 37409 AEV 2_3_RA2_01_1224.d 0 1 1 57 63 Pyro-glu from Q
M.G(+41.03)ALKYVEELQK.K Y 28.21 1317.7292 11 -10.1 440.2459 3 67.62 2 31115 AEV_1_3_RA2_01_1232.d 6.54E4 1 1 2 12 Amidination of lysines or N-terminal amines with methyl acetimidate
K.TTAGR(+44.03).R Y 26.67 548.2918 5 -3.4 549.2972 1 32.65 2 11962 AEV_1_3_RA2_01_1232.d 0 1 1 183 187 Ethanolation (KR)
R.ESRGLT(-18.01)AT(+79.97)GK.K Y 25.75 1080.4965 10 18.1 541.2653 2 49.72 2 20306 AEV_1_3_RA2_01_1232.d 1.76E5 1 1 160 169 Dehydration; Phosphorylation (STY)
R.LNTQSY(+31.99)WR.Y Y 25.30 1098.5094 8 3.9 550.2641 2 37.03 3 17615 AEV_3_3_RA3_01_1233.d 9.45E4 2 2 194 201 Dihydroxy
R.C(+57.02)ANLR(+14.02)VLNS(+79.97)YWINQ(+.98)DSTYK.Y Y 25.16 2439.0930 19 -18.1 814.0236 3 80.34 1 42105 AEV 2_3_RA2_01_1224.d 2.52E4 1 1 110 128 Carbamidomethylation; Methylation(KR); Phosphorylation (STY); Deamidation (NQ)
MGALKYVEELQK.K Y 25.09 1407.7432 12 -14.7 352.9379 4 35.04 2 13096 AEV_1_3_RA2_01_1232.d 0 1 1 1 12
R.KRPAPK(+14.02).G Y 24.53 709.4598 6 4.6 355.7388 2 9.37 2 2273 AEV_1_3_RA2_01_1232.d 1.61E4 1 1 72 77 Methylation(KR)
MGALK.Y Y 21.71 518.2886 5 -17.0 519.2871 1 32.15 2 11717 AEV_1_3_RA2_01_1232.d 3E4 1 1 1 5
K.KQSD(+43.99)VIR.F Y 21.67 888.4665 7 -11.8 889.4633 1 93.22 2 48673 AEV_1_3_RA2_01_1232.d 4.26E4 1 1 14 20 Carboxylation (DKW)
R.G(+42.01)LTATGK(+21.98).K Y 21.17 710.3575 7 -2.2 711.3632 1 83.94 3 50978 AEV_3_3_RA3_01_1233.d 1.58E4 1 1 163 169 Acetylation (N-term); Sodium adduct
K.AKQ(+.98)GYVIYR.I Y 21.16 1097.5869 9 -24.7 549.7872 2 44.45 2 17661 AEV_1_3_RA2_01_1232.d 0 1 1 55 63 Deamidation (NQ)
R.VLNSYWINQDSTYKYYE(+14.02)VILVDPQHK.A Y 20.98 3228.6130 26 -21.0 808.1436 4 85.09 2 44377 AEV_1_3_RA2_01_1232.d 0 1 1 115 140 Methylation(others)
M.GALKYVEE(+14.02)LQK.K Y 20.70 1290.7183 11 3.5 431.2482 3 69.86 2 32743 AEV_1_3_RA2_01_1232.d 2.94E5 1 1 2 12 Methylation(others)
R.ESRGLTATGK(+21.98).K Y 20.49 1040.5226 10 14.2 1041.5447 1 92.34 2 48311 AEV_1_3_RA2_01_1232.d 6.8E4 2 2 160 169 Sodium adduct
R.C(+57.02)ANLR.V Y 20.32 632.3064 5 0.3 633.3138 1 90.68 2 47557 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 110 114 Carbamidomethylation
R.GLTAT(-18.01)GK.K Y 20.07 628.3544 7 -19.8 315.1783 2 25.23 2 8599 AEV_1_3_RA2_01_1232.d 5.11E4 1 1 163 169 Dehydration
R.INW(+15.99)IVNPVHK.H Y 19.54 1234.6823 10 -89.4 412.5312 3 75.07 1 37929 AEV 2_3_RA2_01_1224.d 1.58E5 1 1 148 157 Oxidation (HW)
K.Y(+27.99)(+79.97)YEVILVDPQHK.A Y 19.42 1610.7382 12 47.0 806.4142 2 84.17 2 43741 AEV_1_3_RA2_01_1232.d 0 1 1 129 140 Formylation; Phosphorylation (STY)
R.GLTATGK.K Y 19.17 646.3650 7 -46.3 647.3423 1 74.69 2 36391 AEV_1_3_RA2_01_1232.d 0 1 1 163 169
R.G(+42.01)LGRGH(+15.99)K.Y Y 18.78 781.4194 7 -44.0 782.3923 1 89.68 3 54542 AEV_3_3_RA3_01_1233.d 8E3 1 1 173 179 Acetylation (N-term); Oxidation (HW)
R.C(+43.01)ANLR.V Y 18.66 618.2908 5 -61.0 310.1338 2 33.55 1 10944 AEV 2_3_RA2_01_1224.d 0 1 1 110 114 Carbamylation
R.G(+42.01)LTATGK(-.98).K Y 18.63 687.3915 7 6.4 344.7052 2 30.43 3 13635 AEV_3_3_RA3_01_1233.d 0 1 1 163 169 Acetylation (N-term); Amidation
R.G(+27.99)LTATGK.K Y 18.57 674.3599 7 -100.9 675.2991 1 81.92 1 43337 AEV 2_3_RA2_01_1224.d 2.38E4 1 1 163 169 Formylation
R.IN(+.98)WIVNPVHK.H Y 18.56 1219.6713 10 -11.5 407.5597 3 71.71 3 41572 AEV_3_3_RA3_01_1233.d 1.58E5 1 1 148 157 Deamidation (NQ)
R.S(+41.03)LRSTAEER.V Y 18.44 1088.5574 9 -3.4 363.8585 3 20.07 2 6439 AEV_1_3_RA2_01_1232.d 1.17E5 1 1 97 105 Amidination of lysines or N-terminal amines with methyl acetimidate
R.LNTQSYW(+13.98)R.Y Y 18.39 1080.4989 8 -58.0 541.2254 2 73.56 1 36732 AEV 2_3_RA2_01_1224.d 7.76E4 1 1 194 201 Tryptophan oxidation to oxolactone
K.TTAGR(+28.03)R.K Y 18.39 688.3980 6 13.4 345.2109 2 55.87 2 23457 AEV_1_3_RA2_01_1232.d 0 1 1 183 188 Dimethylation(KR)
R.VRC(+57.02)WELR(+14.02).Q Y 18.35 1031.5334 7 -88.3 344.8214 3 74.19 1 37231 AEV 2_3_RA2_01_1224.d 6.58E4 1 1 25 31 Carbamidomethylation; Methylation(KR)
R.LNTQSYWR(+31.99).Y Y 18.15 1098.5094 8 28.9 550.2778 2 38.69 2 14842 AEV_1_3_RA2_01_1232.d 0 1 1 194 201 Dihydroxy
R.AS(+86.00)RPSRPDK.A Y 17.81 1098.5417 9 25.0 367.1970 3 9.14 2 2195 AEV_1_3_RA2_01_1232.d 0 1 1 39 47 Malonylation
R.LNTQSYWR(+28.03)YR Y 17.23 1413.7153 10 4.7 707.8683 2 80.60 2 41040 AEV_1_3_RA2_01_1232.d 0 1 1 194 203 Dimethylation(KR)
R.C(+57.02)AN(-17.03)LR.V Y 17.20 615.2798 5 -86.8 616.2337 1 49.53 1 19985 AEV 2_3_RA2_01_1224.d 3.34E5 2 2 110 114 Carbamidomethylation; Ammonia-loss (N)
M.GALKYVEELQKK.K Y 17.12 1404.7976 12 -37.6 469.2556 3 64.06 2 28599 AEV_1_3_RA2_01_1232.d 0 1 1 2 13
K.RLNTQS(+79.97)YWRYR(-.98) Y 17.11 1620.7675 11 -1.6 541.2622 3 64.93 2 29206 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 193 203 Phosphorylation (STY); Amidation
K.RPAPK.G N 17.06 567.3492 5 -185.2 568.2515 1 95.16 1 53240 AEV 2_3_RA2_01_1224.d 2.15E4 1 1 73 77
K.T(+43.01)TAGR.R Y 17.02 547.2714 5 8.3 548.2833 1 20.97 2 6803 AEV_1_3_RA2_01_1232.d 2.69E4 1 1 183 187 Carbamylation
R.KRPAPK.G Y 16.88 695.4442 6 6.5 348.7316 2 7.44 2 1745 AEV_1_3_RA2_01_1232.d 1.78E3 1 1 72 77
K.S(+79.96)RGLGRGHK.Y Y 16.49 1046.5039 9 7.3 1047.5188 1 71.32 3 41264 AEV_3_3_RA3_01_1233.d 3.89E4 1 1 171 179 Sulfation
K.YQRSLRSTAEER.V Y 16.36 1494.7539 12 -83.9 374.6644 4 118.74 1 60988 AEV 2_3_RA2_01_1224.d 0 1 1 94 105
K.Y(+42.01)(+79.97)QRSLRST(+79.97)AEER.V Y 16.34 1696.6971 12 54.3 425.2046 4 75.10 1 37958 AEV 2_3_RA2_01_1224.d 3.19E4 1 1 94 105 Acetylation (N-term); Phosphorylation (STY)
R.QLN(+45.99)VIHR.A Y 16.05 924.4963 7 47.1 309.1872 3 40.30 3 19570 AEV_3_3_RA3_01_1233.d 0 1 1 32 38 Beta-methylthiolation (ND)
R.ESRGLTAT(+79.97)GK(+31.99).K Y 15.94 1130.4968 10 106.1 377.8795 3 53.00 2 21978 AEV_1_3_RA2_01_1232.d 4.12E4 1 1 160 169 Phosphorylation (STY); Dihydroxy
R.QLNVIHRAS(+79.97)RPSRPDK.A Y 15.82 1953.0057 16 -17.0 489.2504 4 51.49 3 26711 AEV_3_3_RA3_01_1233.d 0 1 1 32 47 Phosphorylation (STY)
K.S(+42.01)RGLGRGHK(+42.01).Y Y 15.79 1050.5682 9 -1.7 351.1961 3 9.93 2 2460 AEV_1_3_RA2_01_1232.d 0 1 1 171 179 Acetylation (N-term); Acetylation (K)
K.YNKTTAGR.R Y 15.72 909.4668 8 -31.2 304.1534 3 49.92 1 20194 AEV 2_3_RA2_01_1224.d 0 1 1 180 187
R.GLTAT(+79.97)GK.K Y 15.70 726.3313 7 23.8 364.1816 2 33.54 1 10937 AEV 2_3_RA2_01_1224.d 0 1 1 163 169 Phosphorylation (STY)
R.LNT(-18.01)QSYWR.Y Y 15.47 1048.5090 8 118.6 1049.6406 1 104.07 1 57031 AEV 2_3_RA2_01_1224.d 0 1 1 194 201 Dehydration
K.QSDVIR(+14.02).F Y 15.40 730.3973 6 -8.5 366.2029 2 44.29 2 17586 AEV_1_3_RA2_01_1232.d 0 1 1 15 20 Methylation(KR)
MGALKY(-18.01)VEELQK.K Y 15.32 1389.7325 12 15.5 464.2586 3 62.54 3 34382 AEV_3_3_RA3_01_1233.d 9.79E4 1 1 1 12 Dehydration
K.GATYGK(+31.99)PTNHGINQLK.Y Y 15.27 1729.8748 16 -27.2 433.4642 4 59.81 1 26337 AEV 2_3_RA2_01_1224.d 1.2E5 1 1 78 93 Dihydroxy
K.HRESRGLTATGK.K Y 15.10 1311.7007 12 -132.1 328.8891 4 61.55 1 27698 AEV 2_3_RA2_01_1224.d 1.72E5 1 1 158 169
total 111 peptides
C1G3T6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.KAWIPGVGIYSLHQSDDANNPTR.G Y 131.09 2538.2615 23 4.8 635.5757 4 74.38 3 43644 AEV_3_3_RA3_01_1233.d 2.15E5 2 2 390 412
R.NGHETTIPSGEVVPGDIVQIK.M Y 125.25 2189.1328 21 1.4 730.7192 3 75.64 2 37109 AEV_1_3_RA2_01_1232.d 1E6 5 5 134 154
K.DIDFSPSGSELDTGVGDR.L Y 103.31 1865.8279 18 1.8 933.9229 2 76.91 3 45627 AEV_3_3_RA3_01_1233.d 1.35E5 2 2 188 205
K.TAAEFDAMTDKELDALPSLPLVIAR.C Y 102.34 2686.3887 25 -1.0 896.4692 3 88.38 3 53812 AEV_3_3_RA3_01_1233.d 1.54E5 1 1 701 725
R.ILEQMNFLAEQGLR.V Y 92.97 1660.8606 14 2.1 831.4393 2 82.76 2 42696 AEV_1_3_RA2_01_1232.d 4.49E5 6 6 606 619
K.M(+15.99)GDTVPADLR.L Y 92.40 1089.5125 10 -1.9 545.7625 2 48.45 3 24742 AEV_3_3_RA3_01_1233.d 5.41E5 4 4 155 164 Oxidation (M)
R.LFDAMNLEC(+57.02)DEK.I Y 89.34 1483.6323 12 8.6 742.8298 2 75.71 2 37168 AEV_1_3_RA2_01_1232.d 3.72E4 2 2 165 176 Carbamidomethylation
K.DIDFSPSGSELDTGVGDRLNMAYSSSTVTK.G Y 87.64 3148.4507 30 1.1 1050.4919 3 81.06 2 41395 AEV_1_3_RA2_01_1232.d 5.86E4 1 1 188 217
R.NPGTLSAEEAK.S Y 86.23 1115.5458 11 1.4 558.7809 2 29.99 3 13380 AEV_3_3_RA3_01_1233.d 1.42E6 9 9 686 696
K.ELAEVLHTNIETGLLDANIPK.L Y 86.20 2289.2217 21 -2.7 573.3112 4 83.26 3 50499 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 23 43
K.AWIPGVGIYSLHQSDDANNPTR.G Y 81.33 2410.1665 22 1.9 804.3976 3 78.60 3 46977 AEV_3_3_RA3_01_1233.d 1.26E5 2 2 391 412
R.GTIVLGQPPASKQEAEQER.E Y 76.74 2037.0491 19 5.0 680.0270 3 58.73 2 25068 AEV_1_3_RA2_01_1232.d 2.92E5 3 3 413 431
K.MGDTVPADLR.L Y 76.65 1073.5176 10 -0.3 537.7659 2 59.01 3 31678 AEV_3_3_RA3_01_1233.d 4.1E5 3 3 155 164
R.IIDLC(+57.02)TSVGTGDHQEAMTPETK.E Y 74.65 2402.1094 22 -2.3 801.7086 3 69.82 3 40089 AEV_3_3_RA3_01_1233.d 5.99E4 1 1 582 603 Carbamidomethylation
K.TGTLTQGQMVTR.K Y 63.72 1291.6554 12 0.7 646.8354 2 47.80 3 24324 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 378 389
R.TGWFSEGEDYEGVTPATGFR.R Y 63.14 2204.9651 20 8.1 1103.4988 2 81.83 3 49471 AEV_3_3_RA3_01_1233.d 6.61E4 3 3 1050 1069
K.SAADIVLTDDNFASIVNAIEEGRR.M Y 61.86 2575.2878 24 4.2 859.4402 3 89.24 2 46859 AEV_1_3_RA2_01_1232.d 2.84E5 2 2 777 800
R.GRTDHSLGSR.R Y 61.18 1084.5374 10 -0.1 543.2759 2 11.03 3 3022 AEV_3_3_RA3_01_1233.d 7.31E4 2 2 1119 1128
K.FLGLTEGTPLQIK.L Y 60.68 1415.8024 13 -6.4 708.9039 2 82.28 2 42334 AEV_1_3_RA2_01_1232.d 1.69E4 1 1 277 289
R.NPGTLSAEEAK(+14.02).S Y 59.86 1129.5615 11 7.0 565.7920 2 43.11 2 17013 AEV_1_3_RA2_01_1232.d 4.96E5 4 4 686 696 Methylation(KR)
R.SLSSPSATVIR.N Y 59.30 1116.6139 11 -2.1 559.3130 2 58.07 3 30998 AEV_3_3_RA3_01_1233.d 9E5 3 3 123 133
R.GTIVLGQPPASK.Q Y 55.87 1166.6659 12 -21.1 584.3279 2 58.32 3 31169 AEV_3_3_RA3_01_1233.d 3.87E5 4 4 413 424
K.Q(-17.03)ISEYPFDSSVKR.M Y 55.49 1537.7412 13 -1.5 769.8767 2 73.62 3 43058 AEV_3_3_RA3_01_1233.d 5.01E5 3 3 546 558 Pyro-glu from Q
R.GTIVLGQPPASKQEAEQERER.K Y 54.83 2322.1926 21 6.4 775.0764 3 53.39 3 27972 AEV_3_3_RA3_01_1233.d 5.14E5 5 5 413 433
K.LQEEYGANR.L Y 54.03 1078.5043 9 3.6 540.2614 2 27.93 3 12208 AEV_3_3_RA3_01_1233.d 8.86E4 1 1 44 52
K.QISEYPFDSSVKR.M Y 53.85 1554.7678 13 4.3 519.2654 3 63.64 2 28317 AEV_1_3_RA2_01_1232.d 0 1 1 546 558
K.TGTLTQGQM(+15.99)VTR.K Y 49.36 1307.6504 12 -1.8 654.8313 2 33.90 3 15676 AEV_3_3_RA3_01_1233.d 1.45E4 1 1 378 389 Oxidation (M)
R.SAAGLKFDIPAEKEER.D Y 48.55 1759.9104 16 9.4 440.9890 4 64.26 2 28738 AEV_1_3_RA2_01_1232.d 8.46E4 1 1 443 458
R.ILEQM(+15.99)NFLAEQGLR.V Y 45.82 1676.8556 14 -4.4 839.4314 2 76.64 3 45410 AEV_3_3_RA3_01_1233.d 7.27E4 1 1 606 619 Oxidation (M)
K.YGNFQPIKGGALR.V Y 44.47 1419.7622 13 -1.2 474.2608 3 62.71 3 34510 AEV_3_3_RA3_01_1233.d 1.72E5 2 2 257 269
R.GTIVLGQPPASKQ(+.98)EAEQER.E Y 39.39 2038.0331 19 4.2 680.3545 3 59.37 3 31941 AEV_3_3_RA3_01_1233.d 2.24E4 1 1 413 431 Deamidation (NQ)
K.EVGILPR.N Y 38.57 782.4650 7 0.8 392.2401 2 59.80 2 25748 AEV_1_3_RA2_01_1232.d 7.87E5 3 3 679 685
R.VLGIAQK.A Y 37.94 727.4592 7 -84.5 728.4050 1 56.64 1 24205 AEV 2_3_RA2_01_1224.d 8.65E5 4 4 620 626
R.N(+.98)PGTLSAEEAK.S Y 35.11 1116.5298 11 18.6 559.2825 2 30.35 3 13586 AEV_3_3_RA3_01_1233.d 8.61E4 1 1 686 696 Deamidation (NQ)
R.NPGTLSAEEAKSLVK.T Y 34.03 1542.8253 15 5.9 515.2854 3 63.89 2 28480 AEV_1_3_RA2_01_1232.d 5.7E4 1 1 686 700
M(-21.99)GPPK.T Y 31.73 506.2853 5 -20.9 507.2820 1 53.65 3 28145 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 1 5 Methionine replacement by homopropargylglycine
K.SYIPESSR.S Y 30.55 937.4505 8 -87.1 469.6917 2 49.78 1 20123 AEV 2_3_RA2_01_1224.d 3.03E5 1 1 1097 1104
K.QISEYPFDSSVK.R Y 29.62 1398.6666 12 23.8 700.3572 2 69.28 2 32309 AEV_1_3_RA2_01_1232.d 0 1 1 546 557
R.VWDGVGK.F Y 28.01 759.3915 7 -86.9 380.6700 2 54.47 1 22834 AEV 2_3_RA2_01_1224.d 2.32E5 2 2 270 276
R.GRTDHSLGSRR.V Y 27.52 1240.6384 11 2.4 414.5544 3 10.95 3 2976 AEV_3_3_RA3_01_1233.d 2.15E4 1 1 1119 1129
K.T(+42.01)AAEF(+31.99)DAMTDK.E Y 26.70 1272.5179 11 -23.8 637.2511 2 81.39 1 42926 AEV 2_3_RA2_01_1224.d 1.45E5 1 1 701 711 Acetylation (N-term); Dihydroxy
K.QEYTK.H Y 26.28 667.3177 5 -68.3 668.2794 1 72.16 1 35631 AEV 2_3_RA2_01_1224.d 9.39E4 1 1 10 14
R.LDGDGGVK.W Y 26.21 759.3762 8 -96.9 760.3099 1 86.50 1 46958 AEV 2_3_RA2_01_1224.d 1.11E5 1 1 53 60
R.LNMAYSSSTVTK.G Y 25.25 1300.6333 12 -18.5 651.3119 2 58.74 2 25107 AEV_1_3_RA2_01_1232.d 0 1 1 206 217
R.S(-2.02)AAGLKFDIPAEKEERDQR.R Y 24.93 2157.0813 19 -1.9 540.2766 4 60.58 3 32857 AEV_3_3_RA3_01_1233.d 0 1 1 443 461 2-amino-3-oxo-butanoic_acid
R.S(+42.01)LSSPSATVIR.N Y 24.35 1158.6244 11 -70.5 387.1882 3 76.29 1 38889 AEV 2_3_RA2_01_1224.d 0 1 1 123 133 Acetylation (N-term)
K.TAAEFDAM(+15.99)TDKELDALPSLPLVIAR.C Y 24.23 2702.3835 25 -2.9 901.7992 3 86.29 3 52570 AEV_3_3_RA3_01_1233.d 7.58E4 1 1 701 725 Oxidation (M)
R.S(+27.99)LSSPSAT(+79.97)VIR.N Y 24.18 1224.5751 11 -16.7 307.1459 4 59.25 1 25941 AEV 2_3_RA2_01_1224.d 0 1 1 123 133 Formylation; Phosphorylation (STY)
K.TGTLTQGQ(+.98)MVTR(+14.02).K Y 24.06 1306.6552 12 -5.8 327.6692 4 38.39 3 18437 AEV_3_3_RA3_01_1233.d 5.96E4 1 1 378 389 Deamidation (NQ); Methylation(KR)
K.M(+15.99)DSLR.S Y 23.94 636.2901 5 -32.3 637.2768 1 92.54 1 51442 AEV 2_3_RA2_01_1224.d 8.07E4 1 1 118 122 Oxidation (M)
R.LNMAYSSS(+79.97)TVT(+79.97)K.G Y 23.91 1460.5659 12 43.6 731.3221 2 91.47 1 50683 AEV 2_3_RA2_01_1224.d 4.41E4 1 1 206 217 Phosphorylation (STY)
MGPPK.T Y 23.89 528.2730 5 -125.3 529.2141 1 48.41 1 19311 AEV 2_3_RA2_01_1224.d 3.97E4 5 5 1 5
K.TGTLTQGQMVTRK(-.98).A Y 23.84 1418.7664 13 14.8 355.7041 4 51.37 2 21137 AEV_1_3_RA2_01_1232.d 6.19E5 1 1 378 390 Amidation
R.QGFFSFAR.T Y 23.45 958.4661 8 -44.5 480.2190 2 24.42 1 6299 AEV 2_3_RA2_01_1224.d 3.79E4 4 4 1081 1088
R.S(+43.01)SISGR.D Y 23.41 648.3191 6 -47.4 649.2957 1 44.41 1 16944 AEV 2_3_RA2_01_1224.d 0 1 1 1105 1110 Carbamylation
R.VHMLTGDHPSTATAIAK.E Y 22.33 1748.8879 17 3.1 438.2306 4 55.64 3 29306 AEV_3_3_RA3_01_1233.d 3.2E5 2 2 662 678
R.SAAGLK(+42.01).F Y 22.32 587.3279 6 -8.2 588.3303 1 18.19 3 6864 AEV_3_3_RA3_01_1233.d 0 1 1 443 448 Acetylation (K)
R.Q(+.98)GFFSFAR.T Y 21.83 959.4501 8 -6.5 480.7292 2 22.83 1 5675 AEV 2_3_RA2_01_1224.d 1.05E5 1 1 1081 1088 Deamidation (NQ)
K.SAADIVLTDDNFASIVNAIEEGR.R Y 21.54 2419.1865 23 11.4 807.4120 3 93.14 3 56380 AEV_3_3_RA3_01_1233.d 2.97E5 2 2 777 799
K.TAAE(+37.03)FDAMTDK.E Y 21.51 1235.5492 11 3.5 412.8585 3 55.35 1 23383 AEV 2_3_RA2_01_1224.d 1.75E5 1 1 701 711 Propargylamine
R.VLETQYGW(+43.99)K.Q Y 21.46 1166.5608 9 31.1 584.3058 2 81.04 3 48873 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 537 545 Carboxylation (DKW)
R.MFDNIQK.F Y 21.41 894.4269 7 -64.4 448.1920 2 60.07 1 26530 AEV 2_3_RA2_01_1224.d 1.73E5 1 1 801 807
R.QGFFS(+79.97)FAR.T Y 20.84 1038.4324 8 -53.7 520.1956 2 86.76 1 47160 AEV 2_3_RA2_01_1224.d 0 1 1 1081 1088 Phosphorylation (STY)
K.ASAASMR.R Y 20.53 692.3275 7 -106.4 693.2611 1 42.93 1 16105 AEV 2_3_RA2_01_1224.d 1.22E4 1 1 865 871
R.C(-18.01)APDTKTRMIAALHR.R Y 20.18 1664.8602 15 -7.4 417.2192 4 22.18 2 7294 AEV_1_3_RA2_01_1232.d 1.61E5 1 1 726 740 Dehydration (C@N-term)
K.DLT(+79.97)LLGLAECTMAGIR.V Y 20.17 1755.8301 16 16.0 439.9718 4 86.20 1 46720 AEV 2_3_RA2_01_1224.d 4.64E4 1 1 646 661 Phosphorylation (STY)
K.A(+27.99)SAASMR.R Y 20.09 720.3224 7 55.7 721.3699 1 74.47 3 43717 AEV_3_3_RA3_01_1233.d 2.47E4 1 1 865 871 Formylation
R.VLETQYGWK.Q Y 19.97 1122.5709 9 -89.4 562.2426 2 71.18 1 34865 AEV 2_3_RA2_01_1224.d 3.51E5 2 2 537 545
R.M(+15.99)IAALHR.R Y 19.86 826.4483 7 -20.7 827.4385 1 103.11 3 60051 AEV_3_3_RA3_01_1233.d 7.8E4 1 1 734 740 Oxidation (M)
R.ETDGETR.V Y 19.47 806.3406 7 -20.2 807.3315 1 103.80 1 56946 AEV 2_3_RA2_01_1224.d 9.15E5 1 1 566 572
R.SM(+15.99)SREK(+42.01)YGNFQPIKGGALR.V Y 19.24 2196.1108 19 -19.3 440.2209 5 60.85 3 33067 AEV_3_3_RA3_01_1233.d 0 1 1 251 269 Oxidation (M); Acetylation (K)
K.SYIPESS(-18.01)R.S Y 19.19 919.4399 8 -27.7 920.4218 1 88.14 2 46268 AEV_1_3_RA2_01_1232.d 0 1 1 1097 1104 Dehydration
K.IAQSM(+15.99)QGK.K Y 18.90 877.4327 8 -49.7 439.7018 2 57.86 1 24995 AEV 2_3_RA2_01_1224.d 1.52E5 1 1 236 243 Oxidation (M)
K.ASAASM(+15.99)R.R Y 18.79 708.3224 7 -23.8 709.3129 1 79.88 1 41750 AEV 2_3_RA2_01_1224.d 6.61E4 1 1 865 871 Oxidation (M)
K.QEAEQER(+28.03).E Y 18.78 916.4250 7 -57.2 459.1935 2 35.11 1 11743 AEV 2_3_RA2_01_1224.d 1.47E5 1 1 425 431 Dimethylation(KR)
R.V(+42.01)LETQ(+.98)YGWK.Q Y 18.77 1165.5656 9 -76.4 389.4995 3 55.88 1 23749 AEV 2_3_RA2_01_1224.d 2.73E5 1 1 537 545 Acetylation (N-term); Deamidation (NQ)
K.LQ(+.98)EEY(+79.97)GANR(+14.02)LDGDGGVK.W Y 18.74 1914.8359 17 -31.2 639.2660 3 65.04 1 30203 AEV 2_3_RA2_01_1224.d 2.12E5 1 1 44 60 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
K.QEAEQER(+14.02).E Y 18.69 902.4094 7 -64.3 452.1829 2 26.88 1 7401 AEV 2_3_RA2_01_1224.d 3.52E5 1 1 425 431 Methylation(KR)
K.QEAEQER(-.98).E Y 18.66 887.4097 7 -19.7 444.7034 2 65.73 1 30709 AEV 2_3_RA2_01_1224.d 3.82E5 1 1 425 431 Amidation
R.RPPHDTKK(+226.08).G Y 18.41 1203.6182 8 4.5 602.8191 2 37.24 2 14143 AEV_1_3_RA2_01_1232.d 1.75E5 1 1 872 879 Biotinylation
R.NP(+31.99)GTLSAEEAK.S Y 18.17 1147.5356 11 33.7 574.7944 2 47.17 3 23917 AEV_3_3_RA3_01_1233.d 5.26E4 1 1 686 696 Dihydroxy
R.IEERNDS(-18.01)SPEK.S Y 18.13 1284.5946 11 2.7 429.2066 3 57.47 1 24727 AEV 2_3_RA2_01_1224.d 0 1 1 463 473 Dehydration
K.TRMIAALHRR.H Y 18.08 1223.7034 10 -28.2 306.9245 4 30.80 3 13852 AEV_3_3_RA3_01_1233.d 2.05E5 1 1 732 741
R.LFDAMN(+.98)LECDEK.I Y 17.86 1427.5948 12 -9.2 476.8679 3 64.37 1 29830 AEV 2_3_RA2_01_1224.d 1.36E5 1 1 165 176 Deamidation (NQ)
R.ILEQMNFLAEQGLR(+14.02).V Y 17.83 1674.8763 14 -6.4 838.4401 2 84.55 2 44003 AEV_1_3_RA2_01_1232.d 0 1 1 606 619 Methylation(KR)
R.LNM(+15.99)AYSSSTVT(+79.97)KGR.G Y 17.70 1609.7172 14 5.1 537.5824 3 83.87 1 44884 AEV 2_3_RA2_01_1224.d 8.56E4 1 1 206 219 Oxidation (M); Phosphorylation (STY)
K.GGALR(+14.02)VWDGVGK(+14.02).F Y 17.52 1241.6880 12 1.8 621.8524 2 79.50 2 40161 AEV_1_3_RA2_01_1232.d 1.45E4 1 1 265 276 Methylation(KR)
R.AEQDR(-.98)(+14.02).L Y 17.43 630.3085 5 -82.5 631.2638 1 60.79 1 27064 AEV 2_3_RA2_01_1224.d 8.12E4 1 1 436 440 Amidation; Methylation(KR)
R.EKASAASMR(+44.03).R Y 17.37 993.4913 9 -67.5 332.1487 3 51.66 1 21147 AEV 2_3_RA2_01_1224.d 0 1 1 863 871 Ethanolation (KR)
R.MIAALHR.R Y 17.08 810.4534 7 28.9 811.4841 1 84.16 2 43725 AEV_1_3_RA2_01_1232.d 1.59E5 1 1 734 740
R.NPGTLSAE(+14.02)EAK.S Y 17.03 1129.5615 11 -86.2 565.7394 2 54.68 1 22966 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 686 696 Methylation(others)
R.M(+43.01)FDNIQ(+.98)K.F Y 17.00 938.4167 7 -26.3 939.3994 1 96.19 1 53891 AEV 2_3_RA2_01_1224.d 9.29E4 1 1 801 807 Carbamylation; Deamidation (NQ)
R.FPSFPFFHDIYENK(-.98).F Y 16.92 1785.8514 14 33.1 596.3108 3 70.55 2 33261 AEV_1_3_RA2_01_1232.d 1.57E5 1 1 977 990 Amidation
K.AS(+79.97)AASMR.R Y 16.91 772.2939 7 39.1 387.1693 2 74.24 1 37270 AEV 2_3_RA2_01_1224.d 2.8E4 1 1 865 871 Phosphorylation (STY)
R.FPS(+79.97)FPFFHDIY(+79.97)EN(+.98)K.F Y 16.60 1947.7521 14 -8.7 650.2523 3 37.02 1 12719 AEV 2_3_RA2_01_1224.d 0 1 1 977 990 Phosphorylation (STY); Deamidation (NQ)
K.LQEE(+21.98)YGANR(+14.02).L Y 16.55 1114.5020 9 -1.2 372.5075 3 44.22 1 16818 AEV 2_3_RA2_01_1224.d 9.8E4 1 1 44 52 Sodium adduct; Methylation(KR)
R.G(+27.99)TIVLGQPPASK.Q Y 16.53 1194.6608 12 1.7 299.6730 4 30.03 3 13408 AEV_3_3_RA3_01_1233.d 0 1 1 413 424 Formylation
R.FGLGK.R Y 16.46 520.3009 5 -28.3 521.2935 1 24.38 2 8224 AEV_1_3_RA2_01_1232.d 1.91E4 1 1 531 535
K.KMDSLR.S Y 16.45 748.3901 6 -4.4 375.2007 2 61.26 1 27412 AEV 2_3_RA2_01_1224.d 7.54E4 1 1 117 122
R.EKASAASM(+15.99)R.R Y 16.43 965.4600 9 34.1 483.7538 2 53.55 2 22265 AEV_1_3_RA2_01_1232.d 0 1 1 863 871 Oxidation (M)
K.IAQS(+14.02)MQGK.K Y 16.41 875.4535 8 -2.7 876.4584 1 99.19 2 50751 AEV_1_3_RA2_01_1232.d 8.34E3 1 1 236 243 Methylation(others)
R.A(+42.01)EQD(-18.01)R.L Y 16.35 641.2769 5 -11.3 642.2769 1 87.34 1 47594 AEV 2_3_RA2_01_1224.d 3.87E4 1 1 436 440 Acetylation (N-term); Dehydration
K.T(+27.99)DAKQEYTK.H Y 16.33 1110.5193 9 17.9 556.2769 2 30.57 2 10962 AEV_1_3_RA2_01_1232.d 0 1 1 6 14 Formylation (Protein N-term)
R.DNTSSRPR.G Y 16.32 931.4471 8 49.4 466.7539 2 18.79 3 7188 AEV_3_3_RA3_01_1233.d 3.53E4 1 1 1111 1118
R.LD(-18.01)GDGGVK.W Y 16.32 741.3657 8 -31.2 371.6785 2 35.33 1 11858 AEV 2_3_RA2_01_1224.d 0 1 1 53 60 Dehydration
K.LQEEYGANR(+28.03).L Y 16.31 1106.5356 9 -3.6 554.2731 2 19.28 3 7455 AEV_3_3_RA3_01_1233.d 3.25E4 1 1 44 52 Dimethylation(KR)
R.N(+.98)SMFNLDPLR.D Y 16.31 1206.5703 10 -49.5 604.2626 2 85.30 1 46022 AEV 2_3_RA2_01_1224.d 0 1 1 961 970 Deamidation (NQ)
M(+42.01)GPPK.T Y 16.31 570.2836 5 18.1 571.3011 1 12.88 2 3545 AEV_1_3_RA2_01_1232.d 5.56E3 1 1 1 5 Acetylation (Protein N-term)
R.N(+.98)PGTLSAEEAK(+42.01).S Y 16.28 1158.5404 11 -38.6 387.1725 3 60.72 1 27016 AEV 2_3_RA2_01_1224.d 3.97E5 1 1 686 696 Deamidation (NQ); Acetylation (K)
R.VWDGVGK(+226.08).F Y 16.28 985.4691 7 -55.6 493.7144 2 59.18 1 25888 AEV 2_3_RA2_01_1224.d 0 1 1 270 276 Biotinylation
K.T(+27.99)AAEFDAMTDK(+42.01).E Y 16.27 1268.5231 11 -9.3 635.2629 2 51.02 1 20784 AEV 2_3_RA2_01_1224.d 6E4 1 1 701 711 Formylation; Acetylation (K)
K.S(+79.97)LVK(+14.02)TAAEFDAMTDK.E Y 16.23 1719.7791 15 -31.3 430.9386 4 73.39 1 36602 AEV 2_3_RA2_01_1224.d 0 1 1 697 711 Phosphorylation (STY); Methylation(KR)
K.IAQ(+.98)SMQGKK(+27.99).K Y 16.09 1018.5117 9 -18.1 340.5050 3 53.02 1 21971 AEV 2_3_RA2_01_1224.d 8.9E4 1 1 236 244 Deamidation (NQ); Formylation
K.TGTLTQGQ(+.98)MVT(+79.97)R.K Y 16.07 1372.6058 12 -38.2 458.5251 3 59.97 1 26457 AEV 2_3_RA2_01_1224.d 0 1 1 378 389 Deamidation (NQ); Phosphorylation (STY)
R.L(+43.01)DGDGGVK.W Y 16.06 802.3821 8 -71.6 803.3319 1 90.02 1 49634 AEV 2_3_RA2_01_1224.d 0 1 1 53 60 Carbamylation
K.Q(+226.08)EAEQER(+14.02).E Y 16.02 1128.4869 7 -44.4 377.1529 3 48.99 1 19637 AEV 2_3_RA2_01_1224.d 3.19E6 1 1 425 431 Biotinylation; Methylation(KR)
R.VLET(-18.01)QYGWK.Q Y 15.77 1104.5604 9 -68.8 553.2495 2 94.61 1 52894 AEV 2_3_RA2_01_1224.d 8.28E4 1 1 537 545 Dehydration
K.MGDTVPADLRLFDAM(+15.99)NLEC(+57.02)DEK.I Y 15.76 2555.1343 22 -9.1 512.0295 5 34.34 1 11349 AEV 2_3_RA2_01_1224.d 0 1 1 155 176 Oxidation (M); Carbamidomethylation
R.D(-18.01)NTSSR(+14.02)PR.G Y 15.66 927.4522 8 42.8 464.7532 2 24.01 3 10008 AEV_3_3_RA3_01_1233.d 0 1 1 1111 1118 Dehydration; Methylation(KR)
K.SLVKTAAEFDAM(+15.99)TDK.E Y 15.66 1641.7920 15 -1.0 548.2708 3 44.84 2 17850 AEV_1_3_RA2_01_1232.d 0 1 1 697 711 Oxidation (M)
R.ILEQMNFLAEQGLR(-.98).V Y 15.60 1659.8766 14 -2.7 830.9434 2 78.21 2 39142 AEV_1_3_RA2_01_1232.d 4.9E4 1 1 606 619 Amidation
R.QGFFSFAR(+123.01).T Y 15.57 1081.4746 8 -95.2 361.4645 3 32.78 1 10566 AEV 2_3_RA2_01_1224.d 3.81E5 1 1 1081 1088 glycosylphosphatidylinositol
K.TAAEFDAM(+15.99)TDK.E Y 15.36 1214.5125 11 -82.6 608.2133 2 46.07 1 17909 AEV 2_3_RA2_01_1224.d 1.83E4 1 1 701 711 Oxidation (M)
K.GGALR.V Y 15.33 472.2758 5 -114.5 473.2289 1 80.35 1 42116 AEV 2_3_RA2_01_1224.d 9.29E3 1 1 265 269
R.EKYGNFQPIKGGALR.V Y 15.31 1676.8998 15 52.7 420.2543 4 21.47 2 6999 AEV_1_3_RA2_01_1232.d 0 1 1 255 269
R.EKASAAS(+79.97)MR(+21.98).R Y 15.31 1051.4133 9 19.2 351.4851 3 63.40 1 29085 AEV 2_3_RA2_01_1224.d 0 1 1 863 871 Phosphorylation (STY); Sodium adduct
R.DNTSSRPR(+79.97).G Y 15.28 1011.4135 8 -88.2 506.6694 2 24.35 1 6270 AEV 2_3_RA2_01_1224.d 0 1 1 1111 1118 Phosphorylation (HCDR)
R.VLE(+43.99)TQYGWK.Q Y 15.26 1166.5608 9 -18.8 389.8536 3 67.88 1 32364 AEV 2_3_RA2_01_1224.d 2.34E5 1 1 537 545 Carboxylation (E)
R.IE(+21.98)ERNDSSPEK.S Y 15.25 1324.5870 11 -80.4 663.2476 2 50.08 1 20285 AEV 2_3_RA2_01_1224.d 5.72E4 1 1 463 473 Sodium adduct
K.A(+42.01)S(+79.97)AASMR(+14.02).R Y 15.22 828.3201 7 -69.9 829.2694 1 2.82 3 659 AEV_3_3_RA3_01_1233.d 0 1 1 865 871 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
K.T(+42.01)AAEFD(-18.01)AMTDK.E Y 15.22 1222.5176 11 -8.8 612.2607 2 54.65 1 22949 AEV 2_3_RA2_01_1224.d 3.52E4 1 1 701 711 Acetylation (N-term); Dehydration
R.SSISGR.D Y 15.20 605.3133 6 -42.8 606.2947 1 50.88 2 20890 AEV_1_3_RA2_01_1232.d 3.82E4 1 1 1105 1110
K.TGTLTQGQMVTRK.A Y 15.07 1419.7504 13 15.2 474.2646 3 74.97 2 36597 AEV_1_3_RA2_01_1232.d 5.61E4 1 1 378 390
total 133 peptides
A0A0A0HV62
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.KIWLDPNEVNEISTANSR.Q Y 126.93 2085.0491 18 3.3 696.0259 3 76.25 2 37685 AEV_1_3_RA2_01_1232.d 3.25E6 8 8 2703 2720
K.IWLDPNEVNEISTANSR.Q Y 122.33 1956.9541 17 1.7 979.4860 2 79.86 2 40448 AEV_1_3_RA2_01_1232.d 1.48E6 8 8 2704 2720
K.LLSDGLIIHKPVTMHSR.S Y 114.19 1916.0665 17 1.6 480.0247 4 67.41 2 30936 AEV_1_3_RA2_01_1232.d 1.88E6 4 4 2726 2742
K.RLAASVVGC(+57.02)GQR.K Y 97.81 1272.6721 12 1.8 425.2321 3 38.70 3 18629 AEV_3_3_RA3_01_1233.d 1.24E6 7 7 2691 2702 Carbamidomethylation
R.KLLSDGLIIHKPVTMHSR.S Y 95.05 2044.1615 18 7.4 409.8426 5 63.80 3 35348 AEV_3_3_RA3_01_1233.d 8.84E5 4 4 2725 2742
K.RNAHLAEVEEE Y 91.83 1295.6106 11 -1.2 648.8118 2 33.37 3 15379 AEV_3_3_RA3_01_1233.d 1.33E6 7 7 2863 2873
R.MPSQVLWMR.R Y 88.69 1146.5679 9 1.7 574.2922 2 76.26 2 37594 AEV_1_3_RA2_01_1232.d 3.41E5 2 2 2771 2779
R.KIWLDPNEVNEISTANSR(+14.02).Q Y 86.63 2099.0647 18 0.8 700.6960 3 76.85 2 38058 AEV_1_3_RA2_01_1232.d 3.07E5 2 2 2703 2720 Methylation(KR)
R.KIWLDPNE(+14.02)VNEISTANSR.Q Y 85.34 2099.0647 18 2.4 700.6972 3 78.33 2 39235 AEV_1_3_RA2_01_1232.d 2.59E5 2 2 2703 2720 Methylation(others)
R.LAASVVGC(+57.02)GQR.K Y 83.34 1116.5709 11 0.0 559.2927 2 42.39 3 20960 AEV_3_3_RA3_01_1233.d 7.78E6 20 20 2692 2702 Carbamidomethylation
R.KIWLDPNEVNE(+14.02)ISTANSR.Q Y 83.08 2099.0647 18 0.2 700.6956 3 77.43 2 38516 AEV_1_3_RA2_01_1232.d 5.24E5 2 2 2703 2720 Methylation(others)
R.TIKEEMDAKR.A Y 82.75 1219.6230 10 4.8 407.5502 3 23.69 2 7941 AEV_1_3_RA2_01_1232.d 3.2E6 16 16 2836 2845
R.KIW(+15.99)LDPNEVNEISTANSR.Q Y 78.98 2101.0439 18 -2.1 701.3538 3 73.82 2 35747 AEV_1_3_RA2_01_1232.d 2.4E5 2 2 2703 2720 Oxidation (HW)
R.LAASVVGC(+57.02)GQRK.I Y 78.85 1244.6659 12 4.3 415.8977 3 32.66 2 11994 AEV_1_3_RA2_01_1232.d 2.21E6 9 9 2692 2703 Carbamidomethylation
K.RLAASVVGC(+57.02)GQRK.I Y 77.89 1400.7670 13 -10.9 467.9245 3 30.19 3 13508 AEV_3_3_RA3_01_1233.d 5.53E5 5 5 2691 2703 Carbamidomethylation
R.KIW(+31.99)LDPNEVNEISTANSR.Q Y 77.50 2117.0388 18 2.0 706.6883 3 72.08 2 34402 AEV_1_3_RA2_01_1232.d 1.4E5 1 1 2703 2720 Dihydroxy
R.ALVEHIHKAK.A Y 77.01 1144.6716 10 -3.3 573.3412 2 18.28 3 6913 AEV_3_3_RA3_01_1233.d 2.03E5 3 3 2819 2828
R.KIWLDPNEVN(+.98)EISTANSR.Q Y 75.26 2086.0330 18 -2.1 696.3502 3 77.18 2 38320 AEV_1_3_RA2_01_1232.d 2.39E5 2 2 2703 2720 Deamidation (NQ)
R.ALVEHIHK.A Y 74.97 945.5396 8 2.0 473.7780 2 25.87 2 8906 AEV_1_3_RA2_01_1232.d 5.84E6 12 12 2819 2826
K.IWLDPNEVNEISTANSR(+14.02).Q Y 74.61 1970.9697 17 0.2 986.4923 2 80.04 3 48104 AEV_3_3_RA3_01_1233.d 1.01E5 3 3 2704 2720 Methylation(KR)
R.TIKEEMDAK.R Y 72.13 1063.5220 9 1.5 532.7690 2 22.78 3 9329 AEV_3_3_RA3_01_1233.d 1.23E6 6 6 2836 2844
K.LLSDGLIIHKPVTM(+15.99)HSR.S Y 72.11 1932.0615 17 -1.9 484.0217 4 61.83 3 33840 AEV_3_3_RA3_01_1233.d 7.06E5 2 2 2726 2742 Oxidation (M)
K.IWLDPNEVNE(+14.02)ISTANSR.Q Y 68.64 1970.9697 17 -1.6 986.4905 2 80.88 3 48747 AEV_3_3_RA3_01_1233.d 3.37E5 3 3 2704 2720 Methylation(others)
R.NAHLAEVEEE Y 68.43 1139.5094 10 0.6 570.7623 2 42.66 3 21065 AEV_3_3_RA3_01_1233.d 7.34E6 17 17 2864 2873
R.K(+31.99)IWLDPNEVNEISTANSR.Q Y 67.34 2117.0388 18 -0.8 706.6863 3 71.66 3 41532 AEV_3_3_RA3_01_1233.d 1.82E5 1 1 2703 2720 Dihydroxy
K.IW(+31.99)LDPNEVNEISTANSR.Q Y 65.55 1988.9440 17 4.8 995.4840 2 76.08 2 37461 AEV_1_3_RA2_01_1232.d 3.36E4 1 1 2704 2720 Dihydroxy
R.LAASVVGC(+57.02)GQ(+.98)R.K Y 65.07 1117.5549 11 -1.4 559.7839 2 45.77 3 23041 AEV_3_3_RA3_01_1233.d 1.75E6 10 10 2692 2702 Carbamidomethylation; Deamidation (NQ)
R.NAHLAEVEE(+14.02)E Y 64.22 1153.5251 10 -0.6 577.7695 2 53.27 3 27932 AEV_3_3_RA3_01_1233.d 2.56E6 6 6 2864 2873 Methylation(others)
R.LAASVVGC(+57.02)GQR(+14.02).K Y 63.13 1130.5865 11 -1.3 566.2998 2 49.38 3 25335 AEV_3_3_RA3_01_1233.d 8.23E5 5 5 2692 2702 Carbamidomethylation; Methylation(KR)
R.NAHLAEVEEE(+14.02) Y 62.46 1153.5251 10 -1.2 577.7692 2 55.35 3 29151 AEV_3_3_RA3_01_1233.d 2.25E6 7 7 2864 2873 Methylation(others)
R.KIWLDPN(+15.00)EVNEISTANSR.Q Y 60.83 2100.0488 18 9.0 701.0298 3 78.01 3 46511 AEV_3_3_RA3_01_1233.d 6.74E4 1 1 2703 2720 Deamidation followed by a methylation
R.NAHLAEVE(+14.02)EE Y 59.22 1153.5251 10 0.4 577.7701 2 54.13 3 28436 AEV_3_3_RA3_01_1233.d 2.67E6 4 4 2864 2873 Methylation(others)
R.N(+.98)AHLAEVEEE Y 53.13 1140.4934 10 7.4 571.2582 2 52.22 3 27192 AEV_3_3_RA3_01_1233.d 1.37E6 4 4 2864 2873 Deamidation (NQ)
R.MPSQVLWM(+15.99)R.R Y 52.50 1162.5627 9 2.2 582.2899 2 69.09 3 39529 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 2771 2779 Oxidation (M)
R.NAHLAE(+14.02)VEEE Y 51.21 1153.5251 10 0.3 577.7700 2 51.50 3 26714 AEV_3_3_RA3_01_1233.d 1.27E6 6 6 2864 2873 Methylation(others)
K.IWLDPNEVN(+.98)EISTANSR.Q Y 50.91 1957.9381 17 4.0 979.9803 2 80.48 3 48506 AEV_3_3_RA3_01_1233.d 1.49E5 1 1 2704 2720 Deamidation (NQ)
R.LAASVVGC(+57.02)GQRK(+14.02).I Y 49.68 1258.6815 12 -11.7 630.3407 2 39.35 2 15157 AEV_1_3_RA2_01_1232.d 2.06E4 1 1 2692 2703 Carbamidomethylation; Methylation(KR)
K.LLSDGLIIHKPVTMHSR(+14.02).S Y 47.58 1930.0822 17 24.7 387.0332 5 66.04 3 37100 AEV_3_3_RA3_01_1233.d 0 2 2 2726 2742 Methylation(KR)
R.NAHLAEVEE(+28.03)E Y 47.12 1167.5408 10 -1.6 584.7767 2 61.74 3 33772 AEV_3_3_RA3_01_1233.d 1.19E6 6 6 2864 2873 Ethylation
R.KIWLDPNEVN(+15.00)EISTANSR.Q Y 46.44 2100.0488 18 -10.2 701.0164 3 78.21 2 39194 AEV_1_3_RA2_01_1232.d 0 1 1 2703 2720 Deamidation followed by a methylation
R.TIKEEM(+15.99)DAKR.A Y 46.19 1235.6179 10 1.2 412.8804 3 10.97 3 2989 AEV_3_3_RA3_01_1233.d 1.28E6 5 5 2836 2845 Oxidation (M)
R.HRGFGKR.K Y 45.85 856.4780 7 3.3 429.2477 2 10.44 3 2753 AEV_3_3_RA3_01_1233.d 7.81E4 1 1 2757 2763
K.RALVEHIHK.A Y 44.46 1101.6406 9 -6.7 551.8239 2 20.38 3 8022 AEV_3_3_RA3_01_1233.d 2.26E4 1 1 2818 2826
K.RNAHLAEVE(+14.02)EE Y 44.35 1309.6262 11 -1.8 655.8192 2 44.47 3 22216 AEV_3_3_RA3_01_1233.d 5.76E4 1 1 2863 2873 Methylation(others)
K.IWLDPNEVNEISTAN(+.98)SR.Q Y 44.29 1957.9381 17 8.3 979.9844 2 80.38 2 40862 AEV_1_3_RA2_01_1232.d 3.41E4 1 1 2704 2720 Deamidation (NQ)
R.NAHLAEVEEE(+28.03) Y 43.93 1167.5408 10 -6.7 584.7737 2 63.03 3 34761 AEV_3_3_RA3_01_1233.d 8.5E5 4 4 2864 2873 Ethylation
R.K(+72.02)IWLDPNEVNEISTANSR.Q Y 42.33 2157.0701 18 13.0 720.0400 3 75.19 2 36780 AEV_1_3_RA2_01_1232.d 3.66E5 2 2 2703 2720 Carboxyethyl
R.NAHLAEVEEE(-.98) Y 42.27 1138.5254 10 4.7 570.2726 2 45.61 2 18239 AEV_1_3_RA2_01_1232.d 1.65E4 2 2 2864 2873 Amidation
K.RNAHLAEVEEE(+14.02) Y 42.24 1309.6262 11 4.1 655.8231 2 48.84 2 19866 AEV_1_3_RA2_01_1232.d 2.21E5 3 3 2863 2873 Methylation(others)
R.L(+42.01)AASVVGC(+57.02)GQR.K Y 42.13 1158.5815 11 50.1 387.2205 3 42.58 3 21017 AEV_3_3_RA3_01_1233.d 0 1 1 2692 2702 Acetylation (N-term); Carbamidomethylation
K.LLS(+79.97)D(+43.99)GLIIHKPVTMHSR.S Y 41.86 2040.0227 17 21.0 409.0204 5 63.97 3 35478 AEV_3_3_RA3_01_1233.d 0 1 1 2726 2742 Phosphorylation (STY); Carboxylation (DKW)
R.GAAYGLGGIVSGK(+14.02).G Y 41.49 1162.6345 13 -52.2 582.2942 2 65.10 3 36357 AEV_3_3_RA3_01_1233.d 4.76E4 1 1 1379 1391 Methylation(KR)
R.ERTIKEEMDAKR.A Y 40.06 1504.7667 12 4.7 377.2007 4 24.80 3 10462 AEV_3_3_RA3_01_1233.d 5.07E5 2 2 2834 2845
R.ARELAEAR.K Y 39.84 914.4933 8 -88.7 458.2134 2 31.41 1 9746 AEV 2_3_RA2_01_1224.d 1.16E6 4 4 2745 2752
K.GNTFKHKR.A Y 38.36 986.5410 8 -7.0 494.2743 2 9.16 3 2221 AEV_3_3_RA3_01_1233.d 5.84E3 1 1 2811 2818
R.ARELAEARK.I Y 37.06 1042.5883 9 1.8 348.5373 3 11.80 3 3407 AEV_3_3_RA3_01_1233.d 1.95E5 3 3 2745 2753
K.T(+79.97)QKIT(+79.97)NAEQR.G Y 36.97 1347.5585 10 -20.1 337.8901 4 25.64 1 6830 AEV 2_3_RA2_01_1224.d 1.49E5 1 1 359 368 Phosphorylation (STY)
R.L(+41.03)AASVVGC(+57.02)GQR.K Y 36.49 1157.5975 11 29.5 386.8845 3 44.59 2 17737 AEV_1_3_RA2_01_1232.d 3.45E4 1 1 2692 2702 Amidination of lysines or N-terminal amines with methyl acetimidate; Carbamidomethylation
K.L(+119.04)LSDGLIIHKPVTMHSR.S Y 36.30 2035.1036 17 -23.2 408.0186 5 63.82 3 35369 AEV_3_3_RA3_01_1233.d 3.06E4 1 1 2726 2742 Pyridylacetyl
R.TIKEEMDAK(+14.02).R Y 34.01 1077.5376 9 5.1 539.7788 2 33.84 3 15639 AEV_3_3_RA3_01_1233.d 0 2 2 2836 2844 Methylation(KR)
K.RNAHLAEVEEE(-.98) Y 33.95 1294.6266 11 -17.2 648.3094 2 36.66 2 13854 AEV_1_3_RA2_01_1232.d 0 2 2 2863 2873 Amidation
K.TGIDPGELVSEKYEEC(+57.02)MAQ(+.98)ILRAVDDLTR(+21.98).S Y 33.73 3330.5723 29 3.6 833.6533 4 80.20 2 40721 AEV_1_3_RA2_01_1232.d 6.63E5 1 1 711 739 Carbamidomethylation; Deamidation (NQ); Sodium adduct
K.LSGSQIAQDIC(+57.02)RPVAQLLFR.T Y 33.48 2271.2158 20 -16.0 758.0671 3 86.14 3 52475 AEV_3_3_RA3_01_1233.d 2.19E4 1 1 40 59 Carbamidomethylation
R.ELAEAR(+14.02).K Y 32.85 701.3708 6 -1.3 351.6922 2 22.08 3 8931 AEV_3_3_RA3_01_1233.d 2.85E5 1 1 2747 2752 Methylation(KR)
R.TIKEE(+14.02)MDAKR.A Y 32.26 1233.6387 10 -0.1 309.4169 4 31.14 3 14054 AEV_3_3_RA3_01_1233.d 6.73E5 2 2 2836 2845 Methylation(others)
R.KIWLDPNEVNEIST(-2.02)ANSR.Q Y 31.73 2083.0334 18 33.5 695.3750 3 76.28 3 45128 AEV_3_3_RA3_01_1233.d 3.23E4 1 1 2703 2720 2-amino-3-oxo-butanoic_acid
K.NFATK.S Y 30.61 579.3016 5 5.6 580.3121 1 21.67 3 8735 AEV_3_3_RA3_01_1233.d 9.64E4 3 3 1787 1791
R.KIWLDPN(+.98)EVN(+.98)EISTANSR.Q Y 30.58 2087.0171 18 3.1 696.6818 3 77.12 2 38276 AEV_1_3_RA2_01_1232.d 8.39E4 1 1 2703 2720 Deamidation (NQ)
K.APEKDAYGM(+15.99)PK.K Y 30.16 1221.5699 11 -32.1 306.3900 4 62.95 1 28744 AEV 2_3_RA2_01_1224.d 1.4E5 2 2 1194 1204 Oxidation (M)
R.ELAEAR.K Y 30.04 687.3551 6 -83.3 344.6562 2 23.74 1 6019 AEV 2_3_RA2_01_1224.d 1.7E5 3 3 2747 2752
R.TIKEEM(+15.99)DAK.R Y 29.66 1079.5168 9 7.3 540.7697 2 11.02 2 2851 AEV_1_3_RA2_01_1232.d 7.53E4 3 3 2836 2844 Oxidation (M)
R.TIK(+14.02)EEMDAKR.A Y 29.63 1233.6387 10 -7.8 412.2169 3 11.25 2 2936 AEV_1_3_RA2_01_1232.d 3.74E4 1 1 2836 2845 Methylation(KR)
R.K(+27.99)IWLDPNEVNEISTANSR.Q Y 28.33 2113.0439 18 0.6 705.3557 3 75.58 2 37058 AEV_1_3_RA2_01_1232.d 2.1E5 1 1 2703 2720 Formylation
R.ELAEARK.I Y 28.25 815.4501 7 5.2 408.7344 2 10.48 2 2652 AEV_1_3_RA2_01_1232.d 1.15E4 1 1 2747 2753
K.NDPNQR.Q Y 28.22 742.3358 6 7.7 372.1780 2 26.52 1 7233 AEV 2_3_RA2_01_1224.d 0 1 1 1413 1418
R.HRGFGK.R Y 28.01 700.3768 6 5.9 351.1978 2 10.00 2 2480 AEV_1_3_RA2_01_1232.d 9E4 2 2 2757 2762
R.IMAHLTDALENK.N Y 27.97 1354.6914 12 0.1 339.6801 4 18.46 2 5760 AEV_1_3_RA2_01_1232.d 7.86E4 1 1 1401 1412
K.RN(-17.03)AHLAEVEEE Y 27.40 1278.5840 11 2.9 640.3011 2 53.33 3 27937 AEV_3_3_RA3_01_1233.d 1.56E5 1 1 2863 2873 Ammonia-loss (N)
R.TYPIYVDR.A Y 27.30 1025.5182 8 -87.5 513.7215 2 68.67 1 32962 AEV 2_3_RA2_01_1224.d 1.41E5 1 1 60 67
R.ARELAE(+14.02)AR.K Y 27.08 928.5090 8 -1.5 465.2611 2 20.51 3 8090 AEV_3_3_RA3_01_1233.d 2.37E5 2 2 2745 2752 Methylation(others)
R.R(+14.02)TISMLTSDGAS(+79.97)GSR.N Y 26.93 1631.7338 15 36.3 408.9555 4 48.86 2 19876 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 186 200 Methylation(KR); Phosphorylation (STY)
K.VIAGN(+.98)ALGELIK(+43.99).K Y 26.73 1241.6866 12 2.5 311.4297 4 24.21 3 10125 AEV_3_3_RA3_01_1233.d 4.54E5 1 1 1917 1928 Deamidation (NQ); Carboxylation (DKW)
K.D(+43.01)GIQESK(+42.01)DSK.G Y 26.65 1190.5415 10 28.0 596.2947 2 50.10 3 25801 AEV_3_3_RA3_01_1233.d 4.77E4 1 1 999 1008 Carbamylation; Acetylation (K)
K.HLYHELYHLTK(+31.99).G Y 26.63 1484.7412 11 -1.9 743.3765 2 78.14 2 39087 AEV_1_3_RA2_01_1232.d 1.52E5 1 1 2800 2810 Dihydroxy
K.DSASVNAGT(+79.97)GNER(+14.02).L Y 26.24 1370.5464 13 25.4 457.8677 3 34.81 1 11599 AEV 2_3_RA2_01_1224.d 2.03E5 1 1 645 657 Phosphorylation (STY); Methylation(KR)
K.C(+57.02)LTDLAR.A Y 26.22 847.4222 7 -75.6 424.6863 2 36.82 1 12616 AEV 2_3_RA2_01_1224.d 2.31E4 1 1 899 905 Carbamidomethylation
R.AHN(+.98)HIISSEILK(+42.01).A Y 25.87 1403.7408 12 -85.8 351.9124 4 81.41 1 42942 AEV 2_3_RA2_01_1224.d 5.93E4 1 1 673 684 Deamidation (NQ); Acetylation (K)
K.VEQLM(+15.99)QLF(+31.99)ENTLETSDK.A Y 24.99 2071.9619 17 35.9 691.6860 3 76.91 2 38106 AEV_1_3_RA2_01_1232.d 7.39E4 1 1 1274 1290 Oxidation (M); Dihydroxy
R.ELAEAR(+28.03).K Y 24.83 715.3864 6 -125.9 716.3036 1 69.43 1 33514 AEV 2_3_RA2_01_1224.d 2.19E4 1 1 2747 2752 Dimethylation(KR)
R.AVDDLTR(+14.02).S Y 24.65 802.4185 7 -109.8 803.3376 1 112.30 1 59419 AEV 2_3_RA2_01_1224.d 5.24E4 1 1 733 739 Methylation(KR)
K.HLYHELYHLTK.G Y 24.52 1452.7513 11 -86.2 364.1638 4 76.80 1 39294 AEV 2_3_RA2_01_1224.d 4.13E5 2 2 2800 2810
R.AVDDLTR.S Y 24.41 788.4028 7 -101.4 395.1687 2 42.69 1 15971 AEV 2_3_RA2_01_1224.d 3.64E5 4 4 733 739
R.LAASVVGC(+57.02)GQ(+.98)RK.I Y 24.23 1245.6499 12 7.9 416.2272 3 33.34 3 15335 AEV_3_3_RA3_01_1233.d 0 2 2 2692 2703 Carbamidomethylation; Deamidation (NQ)
K.YLESTDSQLR.G Y 24.18 1210.5830 10 -0.6 606.2984 2 51.90 2 21415 AEV_1_3_RA2_01_1232.d 0 1 1 1148 1157
K.TQKITNAEQ(+.98)R.G Y 24.05 1188.6099 10 -6.2 595.3085 2 69.44 2 32430 AEV_1_3_RA2_01_1232.d 5.01E3 1 1 359 368 Deamidation (NQ)
R.T(-18.01)ELDISR.Y Y 24.04 814.4185 7 1.2 408.2170 2 22.15 3 8975 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 2162 2168 Dehydration
R.K(+218.17)IWLDPNEVNEISTANSR.Q Y 24.01 2303.2161 18 -2.9 768.7438 3 90.39 2 47417 AEV_1_3_RA2_01_1232.d 4.56E4 1 1 2703 2720 Michael addition of BHT quinone methide
R.GAAS(-18.01)R.A N 23.78 442.2288 5 4.0 443.2379 1 43.53 3 21619 AEV_3_3_RA3_01_1233.d 9.77E4 2 2 1158 1162 Dehydration
R.TIKEEM(-48.00)DAKR.A Y 23.76 1171.6196 10 6.1 391.5495 3 8.69 2 2061 AEV_1_3_RA2_01_1232.d 1.48E5 2 2 2836 2845 Dethiomethyl
K.H(+42.01)SAIIVT(+79.97)R.R Y 23.74 1017.5009 8 -40.7 340.1604 3 59.07 1 25819 AEV 2_3_RA2_01_1224.d 1.55E5 1 1 160 167 Acetylation (N-term); Phosphorylation (STY)
R.LAAS(+44.01)VVGC(+57.02)GQR.K Y 23.68 1160.5795 11 21.2 387.8753 3 44.51 2 17698 AEV_1_3_RA2_01_1232.d 7.56E4 1 1 2692 2702 S-Ethylcystine from Serine; Carbamidomethylation
R.AR(+14.02)ELAEAR.K Y 23.61 928.5090 8 19.4 310.5163 3 21.58 2 7039 AEV_1_3_RA2_01_1232.d 2.14E5 2 2 2745 2752 Methylation(KR)
K.AISISPPER(+28.03).A Y 23.60 996.5604 9 24.8 499.2998 2 40.74 3 19835 AEV_3_3_RA3_01_1233.d 0 1 1 664 672 Dimethylation(KR)
R.ALST(-18.01)VSR.S Y 23.49 714.4024 7 77.9 715.4653 1 105.73 1 57526 AEV 2_3_RA2_01_1224.d 0 1 1 567 573 Dehydration
R.GLADTSSDVLRK.R Y 23.48 1260.6674 12 -15.5 631.3312 2 41.18 3 20116 AEV_3_3_RA3_01_1233.d 0 1 1 2331 2342
R.ATASK.A Y 23.48 476.2595 5 -24.8 477.2549 1 25.36 2 8669 AEV_1_3_RA2_01_1232.d 3.58E4 2 2 1657 1661
R.E(-18.01)LAEARK.I Y 23.35 797.4395 7 0.7 399.7273 2 10.47 2 2650 AEV_1_3_RA2_01_1232.d 1.65E4 1 1 2747 2753 Pyro-glu from E
R.E(-18.01)NGAIR.L Y 23.30 640.3292 6 -127.0 321.1312 2 25.74 1 6879 AEV 2_3_RA2_01_1224.d 3.89E4 1 1 2149 2154 Pyro-glu from E
R.K(+14.02)IWLDPNEVN(+.98)EISTANSR.Q Y 23.19 2100.0488 18 -6.0 701.0193 3 75.41 3 44449 AEV_3_3_RA3_01_1233.d 8.46E4 1 1 2703 2720 Methylation(KR); Deamidation (NQ)
K.NFATK(+43.01).S Y 23.04 622.3074 5 -51.6 623.2826 1 93.23 1 51922 AEV 2_3_RA2_01_1224.d 0 1 1 1787 1791 Carbamylation
K.V(+226.08)IAGNALGELIK.K Y 23.03 1422.7904 12 2.5 356.7057 4 52.16 2 21556 AEV_1_3_RA2_01_1232.d 0 1 1 1917 1928 Biotinylation
K.L(+127.06)LSDGLIIHKPVTMHSR.S Y 22.62 2043.1299 17 2.1 511.7908 4 63.82 3 35367 AEV_3_3_RA3_01_1233.d 0 1 1 2726 2742 N-Succinimidyl-2-morpholine acetate
R.D(+42.01)AGVVK(+42.01).A Y 22.60 671.3490 6 -17.3 336.6760 2 64.37 1 29823 AEV 2_3_RA2_01_1224.d 8.1E5 1 1 2185 2190 Acetylation (N-term); Acetylation (K)
K.TRALSTVS(+79.97)R.S Y 22.51 1069.5281 9 23.4 535.7838 2 25.90 3 11088 AEV_3_3_RA3_01_1233.d 3.45E4 1 1 565 573 Phosphorylation (STY)
K.EIIGSR(+21.98).T Y 22.48 695.3578 6 13.4 696.3744 1 97.20 2 50064 AEV_1_3_RA2_01_1232.d 0 1 1 236 241 Sodium adduct
K.Y(+42.01)INGPGAELPSATK(+42.01).R Y 22.40 1500.7460 14 6.5 751.3851 2 84.12 2 43700 AEV_1_3_RA2_01_1232.d 9.41E4 1 1 2601 2614 Acetylation (N-term); Acetylation (K)
K.AFESLVLR.C Y 22.37 933.5283 8 8.1 467.7752 2 72.15 3 41911 AEV_3_3_RA3_01_1233.d 0 1 1 332 339
R.ATASK(-.98).A Y 22.28 475.2754 5 -31.4 476.2678 1 60.67 3 32921 AEV_3_3_RA3_01_1233.d 5.32E4 2 2 1657 1661 Amidation
R.VQSALAIADIIDR(+28.03).T Y 22.25 1411.8035 13 -4.9 353.9564 4 61.55 3 33619 AEV_3_3_RA3_01_1233.d 5.88E4 1 1 2258 2270 Dimethylation(KR)
K.TC(+57.02)FSSLSSY(+31.99)GVK(+42.01).Q Y 22.15 1408.6180 12 78.0 353.1893 4 75.53 1 38297 AEV 2_3_RA2_01_1224.d 0 1 1 1468 1479 Carbamidomethylation; Dihydroxy; Acetylation (K)
R.LLVKNFAT(+79.97)K(+27.99)SIDLLLPELERGLADDNYR.I Y 22.15 3323.7166 28 0.3 831.9366 4 85.01 3 51705 AEV_3_3_RA3_01_1233.d 4.85E5 1 1 1783 1810 Phosphorylation (STY); Formylation
R.G(+42.01)AAYGLGGIVSGK(+27.99).G Y 22.01 1218.6244 13 18.8 407.2230 3 46.62 2 18743 AEV_1_3_RA2_01_1232.d 0 1 1 1379 1391 Acetylation (N-term); Formylation
K.GNTFK.H Y 21.91 565.2860 5 -16.3 566.2841 1 99.37 1 55461 AEV 2_3_RA2_01_1224.d 9.6E3 2 2 2811 2815
K.AAWDALTQLTTHM(+15.99)R.K Y 21.79 1629.7933 14 13.4 544.2790 3 75.54 3 44554 AEV_3_3_RA3_01_1233.d 0 1 1 2191 2204 Oxidation (M)
K.TLPDTAAPLIK(+27.99).N Y 21.77 1166.6547 11 7.7 584.3391 2 51.11 3 26452 AEV_3_3_RA3_01_1233.d 0 1 1 2432 2442 Formylation
R.A(+42.01)VDDLTR(+14.02).S Y 21.76 844.4290 7 -12.2 845.4260 1 91.10 3 55303 AEV_3_3_RA3_01_1233.d 7.63E4 1 1 733 739 Acetylation (N-term); Methylation(KR)
R.G(+42.01)LADTSSD(+21.98)VLR.K Y 21.35 1196.5649 11 -46.8 300.1345 4 46.85 1 18383 AEV 2_3_RA2_01_1224.d 0 1 1 2331 2341 Acetylation (N-term); Sodium adduct
R.LAS(+60.00)PNMEQK.V Y 21.23 1076.4994 9 -21.8 539.2452 2 67.38 1 31966 AEV 2_3_RA2_01_1224.d 1.05E5 1 1 1908 1916 2-OH-ethyl thio-Ser
K.ITN(+.98)AEQR(+14.02).G Y 21.21 845.4243 7 -60.1 423.6940 2 54.13 1 22643 AEV 2_3_RA2_01_1224.d 3.9E5 1 1 362 368 Deamidation (NQ); Methylation(KR)
R.LASPNM(+15.99)EQK(+42.01).V Y 21.21 1074.5016 9 -46.8 538.2329 2 74.44 1 37434 AEV 2_3_RA2_01_1224.d 4.48E5 1 1 1908 1916 Oxidation (M); Acetylation (K)
R.M(+15.99)PSQVLWM(+15.99)R.R Y 21.21 1178.5576 9 -12.6 590.2787 2 24.87 3 10499 AEV_3_3_RA3_01_1233.d 3.08E5 1 1 2771 2779 Oxidation (M)
K.NDPNQR(+14.02).Q Y 21.15 756.3514 6 21.6 379.1912 2 56.97 2 24099 AEV_1_3_RA2_01_1232.d 0 1 1 1413 1418 Methylation(KR)
K.Y(+42.01)INGPGAELPSATK.R Y 21.03 1458.7354 14 4.4 487.2545 3 74.57 2 36307 AEV_1_3_RA2_01_1232.d 9.84E4 1 1 2601 2614 Acetylation (N-term)
R.LANQ(+.98)AR.E Y 20.98 672.3555 6 -15.8 673.3521 1 83.31 2 43103 AEV_1_3_RA2_01_1232.d 0 1 1 2628 2633 Deamidation (NQ)
R.AVLSSEATGEEILR.R Y 20.77 1473.7675 14 10.6 492.2683 3 69.62 2 32565 AEV_1_3_RA2_01_1232.d 0 1 1 172 185
R.NAHLAEVE(+28.03)EE Y 20.74 1167.5408 10 -87.6 584.7265 2 71.65 1 35224 AEV 2_3_RA2_01_1224.d 5.89E5 2 2 2864 2873 Ethylation
K.ITNAEQR.G Y 20.66 830.4246 7 -51.6 416.1982 2 50.71 1 20600 AEV 2_3_RA2_01_1224.d 0 1 1 362 368
R.VDT(+79.96)VIRK.L Y 20.58 909.4589 7 71.8 304.1820 3 34.36 3 15945 AEV_3_3_RA3_01_1233.d 0 1 1 1320 1326 Sulfation
R.ETSLR.A N 20.47 604.3180 5 34.8 303.1768 2 15.66 2 4606 AEV_1_3_RA2_01_1232.d 1.1E4 2 2 1775 1779
R.KIWLDPNEVNEISTANSR(-.98)(+14.02).Q Y 20.34 2098.0806 18 -9.4 700.3609 3 76.80 2 38022 AEV_1_3_RA2_01_1232.d 0 1 1 2703 2720 Amidation; Methylation(KR)
R.LAASVVGC(+57.02)GQR(-.98).K Y 20.33 1115.5869 11 -10.8 1116.5822 1 89.66 3 54533 AEV_3_3_RA3_01_1233.d 7.72E0 1 1 2692 2702 Carbamidomethylation; Amidation
R.LGSAQALSEVLAGLGT(+122.01)SR.L Y 20.33 1850.9502 18 3.1 926.4852 2 83.96 3 50988 AEV_3_3_RA3_01_1233.d 7.1E4 1 1 1696 1713 O-Isopropylphosphorylation
R.EAAAEAFDSLQ(+.98)QVLDK(+14.02).R Y 20.27 1748.8468 16 74.0 438.2513 4 38.58 2 14796 AEV_1_3_RA2_01_1232.d 0 1 1 1998 2013 Deamidation (NQ); Methylation(KR)
K.NGATLLAYDK.V Y 20.27 1064.5502 10 -21.6 1065.5344 1 102.79 1 56636 AEV 2_3_RA2_01_1224.d 7.45E4 1 1 522 531
K.Y(+226.08)LESTDSQLR.G Y 20.15 1436.6605 10 -1.0 360.1721 4 68.64 1 32919 AEV 2_3_RA2_01_1224.d 6.31E4 1 1 1148 1157 Biotinylation
R.LGSAQALSEVLAGLGTS(+79.97)R(+28.03).L Y 20.06 1836.9346 18 25.8 460.2528 4 72.23 2 34524 AEV_1_3_RA2_01_1232.d 0 1 1 1696 1713 Phosphorylation (STY); Dimethylation(KR)
K.EVRNSANRSLQR(+14.02).F Y 20.05 1442.7701 12 -17.0 481.9225 3 70.24 2 33027 AEV_1_3_RA2_01_1232.d 8.87E4 1 1 1536 1547 Methylation(KR)
K.DSASVN(+.98)AGTGNER(+14.02).L Y 20.05 1291.5640 13 -18.4 646.7773 2 73.96 1 37057 AEV 2_3_RA2_01_1224.d 5.7E4 1 1 645 657 Deamidation (NQ); Methylation(KR)
R.LASPNMEQK(+14.02).V Y 19.93 1030.5117 9 0.8 516.2635 2 16.57 3 5982 AEV_3_3_RA3_01_1233.d 8.97E4 1 1 1908 1916 Methylation(KR)
R.NAMLQALYEVVSK.A Y 19.92 1464.7646 13 -4.3 733.3865 2 87.50 2 45914 AEV_1_3_RA2_01_1232.d 7.03E4 1 1 2378 2390
R.ERTIKEEM(-48.00)DAKR.A Y 19.91 1456.7633 12 3.0 365.1992 4 10.11 3 2594 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 2834 2845 Dethiomethyl
K.W(+42.01)EPR(+14.02)SGIALAFGAMAK.G Y 19.63 1759.9080 16 15.4 440.9910 4 49.15 2 20021 AEV_1_3_RA2_01_1232.d 6.97E4 1 1 1212 1227 Acetylation (N-term); Methylation(KR)
R.ALVEHIHK(+14.02).A Y 19.57 959.5552 8 3.4 320.8601 3 29.23 3 12940 AEV_3_3_RA3_01_1233.d 4.29E5 2 2 2819 2826 Methylation(KR)
K.TRALSTVSRSAVFQTGDLLAQ(+.98)K(+14.02).Y Y 19.38 2363.2808 22 -18.9 591.8163 4 80.66 3 48580 AEV_3_3_RA3_01_1233.d 7.6E4 1 1 565 586 Deamidation (NQ); Methylation(KR)
R.N(+42.01)SPFLGIVAGVSAR(+31.99)IPNR.K Y 19.29 1941.0431 18 -8.3 486.2640 4 56.22 2 23674 AEV_1_3_RA2_01_1232.d 0 1 1 201 218 Acetylation (N-term); Dihydroxy
K.D(+43.99)GIQESK.D Y 19.06 819.3610 7 14.5 410.6937 2 38.24 1 13416 AEV 2_3_RA2_01_1224.d 0 1 1 999 1005 Carboxylation (DKW)
K.VNAQLAK.E Y 19.05 742.4337 7 -82.0 372.1937 2 60.73 1 27019 AEV 2_3_RA2_01_1224.d 0 1 1 850 856
K.LNS(-18.01)TEDFLWK.T Y 19.05 1233.6029 10 -5.0 412.2062 3 67.41 1 31956 AEV 2_3_RA2_01_1224.d 0 1 1 555 564 Dehydration
R.TISM(+15.99)LTSDGASGSR.N Y 18.98 1397.6456 14 17.0 466.8971 3 44.25 2 17568 AEV_1_3_RA2_01_1232.d 6.38E5 1 1 187 200 Oxidation (M)
R.LAN(+.98)Q(+.98)AR.E Y 18.91 673.3395 6 -7.5 674.3417 1 66.33 3 37334 AEV_3_3_RA3_01_1233.d 3.52E4 1 1 2628 2633 Deamidation (NQ)
K.EILD(-18.01)AATKGC(+57.02)SEKR.V Y 18.91 1558.7773 14 -1.1 780.3951 2 85.43 3 51994 AEV_3_3_RA3_01_1233.d 0 1 1 429 442 Dehydration; Carbamidomethylation
R.IP(+31.99)AANQDR(+14.02).Q Y 18.89 929.4566 8 29.2 930.4910 1 96.65 2 49895 AEV_1_3_RA2_01_1232.d 0 1 1 83 90 Dihydroxy; Methylation(KR)
K.Q(+.98)YAAR.R Y 18.88 608.2918 5 44.2 609.3260 1 38.80 2 14900 AEV_1_3_RA2_01_1232.d 1.32E5 3 3 1373 1377 Deamidation (NQ)
K.N(+27.99)GATLLAYDK.V Y 18.88 1092.5452 10 -2.7 547.2784 2 25.61 3 10915 AEV_3_3_RA3_01_1233.d 0 1 1 522 531 Formylation
R.ETAEAIWEQ(+.98)NALGINEK.S Y 18.88 1915.9163 17 -33.8 384.1776 5 73.15 1 36410 AEV 2_3_RA2_01_1224.d 4.12E4 1 1 1124 1140 Deamidation (NQ)
K.SD(+14.02)AGAGDR.L Y 18.85 761.3304 8 -18.1 762.3239 1 85.26 1 45994 AEV 2_3_RA2_01_1224.d 4.21E4 1 1 1688 1695 Methylation(others)
R.EEVM(+15.99)PK.A Y 18.83 747.3473 6 -59.3 748.3102 1 95.98 1 53759 AEV 2_3_RA2_01_1224.d 0 1 1 1188 1193 Oxidation (M)
R.S(+79.97)AAIAVWK.A Y 18.78 924.4470 8 -0.4 463.2306 2 52.74 3 27539 AEV_3_3_RA3_01_1233.d 0 1 1 1877 1884 Phosphorylation (STY)
K.LLSDGLIIHKPVTM(-48.00)HSR.S Y 18.78 1868.0632 17 -7.8 374.6170 5 61.24 2 26689 AEV_1_3_RA2_01_1232.d 2.08E5 1 1 2726 2742 Dethiomethyl
K.DGIQES(+79.97)KDSK(+42.01).G Y 18.74 1227.5020 10 -20.7 410.1661 3 41.92 1 15531 AEV 2_3_RA2_01_1224.d 0 1 1 999 1008 Phosphorylation (STY); Acetylation (K)
R.GAAYGLGGIVSGK(+26.02).G Y 18.70 1174.6345 13 -3.7 392.5507 3 34.62 2 12899 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 1379 1391 Acetaldehyde +26
K.Y(+42.01)RASGK.I Y 18.53 722.3711 6 4.0 723.3812 1 80.49 3 48445 AEV_3_3_RA3_01_1233.d 0 2 2 2791 2796 Acetylation (N-term)
R.R(+42.01)LAS(+79.97)PNMEQK.V Y 18.46 1294.5741 10 -11.2 324.6472 4 35.21 1 11799 AEV 2_3_RA2_01_1224.d 0 1 1 1907 1916 Acetylation (N-term); Phosphorylation (STY)
K.NFATK(+14.02)S(+79.97)IDLLLPELER(+14.02).G Y 18.34 1966.0176 16 7.0 656.3511 3 90.51 3 54990 AEV_3_3_RA3_01_1233.d 5.56E4 1 1 1787 1802 Methylation(KR); Phosphorylation (STY)
K.G(+27.99)VSAFR.E Y 18.34 663.3340 6 8.2 664.3467 1 66.61 3 37547 AEV_3_3_RA3_01_1233.d 0 1 1 1392 1397 Formylation
K.LLLT(+114.04)NIK.S Y 18.21 927.5753 7 26.6 310.2073 3 65.74 3 36868 AEV_3_3_RA3_01_1233.d 2.73E4 1 1 313 319 Ubiquitin
R.LASPNMEQK.V Y 18.20 1016.4961 9 -61.6 509.2240 2 67.79 1 32270 AEV 2_3_RA2_01_1224.d 9.42E4 2 2 1908 1916
R.TELDISR.Y Y 18.17 832.4290 7 -46.1 833.3979 1 89.55 1 49297 AEV 2_3_RA2_01_1224.d 0 1 1 2162 2168
K.VYT(+79.97)K(+226.08)LNSTEDFLWK.T Y 18.16 2048.9319 14 -44.6 513.2174 4 75.29 1 38166 AEV 2_3_RA2_01_1224.d 2.52E5 1 1 551 564 Phosphorylation (STY); Biotinylation
R.L(+42.01)ANQAR.E Y 18.12 713.3820 6 -145.6 714.2855 1 91.20 1 50489 AEV 2_3_RA2_01_1224.d 0 1 1 2628 2633 Acetylation (N-term)
R.LASPNM(+15.99)EQK.V Y 18.11 1032.4910 9 -43.6 345.1559 3 55.48 1 23474 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 1908 1916 Oxidation (M)
K.A(+43.01)FESLVLR.C Y 18.07 976.5341 8 10.1 326.5219 3 52.81 3 27589 AEV_3_3_RA3_01_1233.d 4.82E5 1 1 332 339 Carbamylation
R.T(+79.96)IKEEMDAKR.A Y 18.06 1299.5798 10 64.4 325.9232 4 8.97 3 2157 AEV_3_3_RA3_01_1233.d 1.07E4 1 1 2836 2845 Sulfation
R.TELDIS(-18.01)R.Y Y 17.96 814.4185 7 11.2 815.4349 1 90.52 2 47476 AEV_1_3_RA2_01_1232.d 0 1 1 2162 2168 Dehydration
R.G(+42.01)LGS(-18.01)R.S Y 17.93 512.2707 5 -95.7 513.2289 1 73.39 1 36594 AEV 2_3_RA2_01_1224.d 8.48E4 1 1 1606 1610 Acetylation (N-term); Dehydration
R.RLASPNMEQK.V Y 17.90 1172.5972 10 -143.9 391.8167 3 63.12 1 28871 AEV 2_3_RA2_01_1224.d 4.1E4 1 1 1907 1916
K.NGATLLAYD(+43.99)K.V Y 17.88 1108.5400 10 10.7 555.2832 2 59.83 3 32298 AEV_3_3_RA3_01_1233.d 0 1 1 522 531 Carboxylation (DKW)
R.A(+27.99)TASK.A Y 17.80 504.2544 5 -16.5 505.2533 1 16.91 2 5118 AEV_1_3_RA2_01_1232.d 8.06E3 1 1 1657 1661 Formylation
R.KIW(+15.99)LDPNEVNEISTANSR(+14.02).Q Y 17.77 2115.0596 18 -5.4 706.0233 3 75.86 3 44808 AEV_3_3_RA3_01_1233.d 0 1 1 2703 2720 Oxidation (HW); Methylation(KR)
K.NDLVR.R N 17.77 615.3340 5 -18.3 616.3300 1 28.87 3 12726 AEV_3_3_RA3_01_1233.d 0 1 1 1251 1255
R.NGAVK(+42.01).A Y 17.75 529.2860 5 -99.5 530.2406 1 35.04 1 11708 AEV 2_3_RA2_01_1224.d 0 1 1 327 331 Acetylation (K)
R.LASPNM(+15.99)EQK(+14.02).V Y 17.73 1046.5066 9 -6.1 524.2574 2 14.41 2 4116 AEV_1_3_RA2_01_1232.d 0 1 1 1908 1916 Oxidation (M); Methylation(KR)
K.EIIGS(+79.96)R.T Y 17.64 753.3327 6 43.5 754.3727 1 78.03 3 46598 AEV_3_3_RA3_01_1233.d 7.69E4 1 1 236 241 Sulfation
K.EALIRQN(+.98)VQSEEEIIK(+42.01).R Y 17.60 1941.0054 16 -3.5 486.2569 4 51.37 3 26622 AEV_3_3_RA3_01_1233.d 2.54E5 1 1 857 872 Deamidation (NQ); Acetylation (K)
R.KIWLDPNEVNEISTANSR(+28.03).Q Y 17.55 2113.0803 18 6.0 705.3716 3 78.05 2 39014 AEV_1_3_RA2_01_1232.d 1.18E5 1 1 2703 2720 Dimethylation(KR)
K.AISISPPER.A Y 17.48 968.5291 9 -54.6 323.8327 3 58.33 1 25320 AEV 2_3_RA2_01_1224.d 0 1 1 664 672
R.I(+42.01)MAHLTDALEN(+.98)K.N Y 17.46 1397.6860 12 -23.4 466.8917 3 77.04 3 45735 AEV_3_3_RA3_01_1233.d 0 1 1 1401 1412 Acetylation (N-term); Deamidation (NQ)
R.DALFNLC(+57.02)RC(+57.02)IAHNFEK(+226.08).D Y 17.41 2233.0229 16 -22.6 447.6018 5 81.41 1 42972 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 1056 1071 Carbamidomethylation; Biotinylation
R.ASRQAAQKCLS(+79.97)ALFR.I Y 17.34 1728.8494 15 14.0 346.7820 5 48.05 3 24479 AEV_3_3_RA3_01_1233.d 1.02E6 1 1 68 82 Phosphorylation (STY)
R.LLVK(+27.99)NFAT(+79.97)KSIDLLLPELERGLADDNYR.I Y 17.34 3323.7166 28 0.4 831.9367 4 84.44 3 51335 AEV_3_3_RA3_01_1233.d 2.19E5 1 1 1783 1810 Formylation; Phosphorylation (STY)
R.G(+42.01)AAS(-18.01)R.A N 17.30 484.2394 5 5.0 485.2491 1 29.95 2 10684 AEV_1_3_RA2_01_1232.d 0 1 1 1158 1162 Acetylation (N-term); Dehydration
K.C(+57.02)AVFLALN(-17.03)R.L Y 17.27 1045.5378 9 4.6 523.7786 2 48.72 2 19807 AEV_1_3_RA2_01_1232.d 3.57E5 1 1 2300 2308 Carbamidomethylation; Ammonia-loss (N)
K.ALASLAQ(+.98)VASSSM(+15.99)TRR.L Y 17.27 1664.8516 16 -69.7 417.1912 4 77.00 1 39455 AEV 2_3_RA2_01_1224.d 5.36E4 1 1 2073 2088 Deamidation (NQ); Oxidation (M)
R.ARELAEAR(+14.02).K Y 17.25 928.5090 8 -84.2 310.4842 3 45.04 1 17310 AEV 2_3_RA2_01_1224.d 1.59E5 1 1 2745 2752 Methylation(KR)
K.DKNGATLLAYDK(+6.01).V Y 17.23 1313.6803 12 5.6 438.9032 3 63.17 3 34869 AEV_3_3_RA3_01_1233.d 0 1 1 520 531 Replacement of proton by lithium
K.RENGAIRLGR.F Y 17.20 1140.6476 10 41.1 381.2388 3 65.51 2 29607 AEV_1_3_RA2_01_1232.d 0 1 1 2148 2157
K.A(+42.01)LVATPR.T Y 17.14 768.4493 7 52.9 385.2523 2 56.86 2 24032 AEV_1_3_RA2_01_1232.d 0 1 1 1885 1891 Acetylation (N-term)
R.G(+43.01)AASR.A N 17.10 503.2452 5 17.0 504.2610 1 24.01 3 10009 AEV_3_3_RA3_01_1233.d 0 1 1 1158 1162 Carbamylation
K.R(+42.01)ENGAIR.L Y 17.09 856.4515 7 -99.0 429.1906 2 64.53 1 29917 AEV 2_3_RA2_01_1224.d 7.54E4 1 1 2148 2154 Acetylation (N-term)
K.G(+42.01)NTFK.H Y 17.02 607.2966 5 32.0 608.3233 1 99.24 3 58821 AEV_3_3_RA3_01_1233.d 0 1 1 2811 2815 Acetylation (N-term)
R.IMAHLTDALEN(+.98)K.N Y 17.02 1355.6755 12 -18.5 452.8907 3 22.22 2 7314 AEV_1_3_RA2_01_1232.d 0 1 1 1401 1412 Deamidation (NQ)
R.ILAKR.N N 17.02 599.4119 5 8.1 300.7156 2 11.16 2 2900 AEV_1_3_RA2_01_1232.d 7.61E4 1 1 2859 2863
K.EILD(+43.99)AAT(+79.97)K.G Y 17.01 983.4212 8 32.7 328.8251 3 26.58 1 7259 AEV 2_3_RA2_01_1224.d 0 1 1 429 436 Carboxylation (DKW); Phosphorylation (STY)
R.D(+42.01)AGVVK.A Y 16.92 629.3384 6 -13.9 315.6721 2 46.23 1 18005 AEV 2_3_RA2_01_1224.d 4.9E4 1 1 2185 2190 Acetylation (N-term)
K.DAYGM(+31.99)PK.K Y 16.91 812.3374 7 54.9 407.1983 2 29.16 1 8533 AEV 2_3_RA2_01_1224.d 1.78E5 1 1 1198 1204 Sulphone
R.GLGSR(+21.98).S Y 16.90 510.2526 5 -29.1 511.2451 1 24.40 2 8230 AEV_1_3_RA2_01_1232.d 0 1 1 1606 1610 Sodium adduct
R.AVDDLTRSQISK.G Y 16.89 1331.7045 12 12.9 333.9377 4 10.48 2 2655 AEV_1_3_RA2_01_1232.d 0 1 1 733 744
R.E(+43.01)LAEAR.K Y 16.89 730.3610 6 9.8 731.3754 1 80.37 3 48363 AEV_3_3_RA3_01_1233.d 6.06E4 1 1 2747 2752 Carbamylation
R.AQ(+.98)VAQ(+.98)K.R Y 16.80 645.3333 6 -24.2 646.3250 1 47.59 2 19232 AEV_1_3_RA2_01_1232.d 1.74E5 1 1 829 834 Deamidation (NQ)
R.GAASR.A N 16.79 460.2394 5 -14.3 461.2401 1 15.17 3 5205 AEV_3_3_RA3_01_1233.d 3.73E4 1 1 1158 1162
R.VVSERS(-18.01)VDIK.C Y 16.66 1112.6189 10 -34.1 371.8676 3 46.08 3 23232 AEV_3_3_RA3_01_1233.d 4.76E5 1 1 2290 2299 Dehydration
R.DAGVVK(+21.98).A Y 16.60 609.3098 6 -75.2 610.2712 1 85.67 1 46316 AEV 2_3_RA2_01_1224.d 0 1 1 2185 2190 Sodium adduct
R.G(+42.01)LGS(+79.97)R.S Y 16.60 610.2476 5 13.2 611.2629 1 86.49 1 46952 AEV 2_3_RA2_01_1224.d 0 1 1 1606 1610 Acetylation (N-term); Phosphorylation (STY)
R.ENGAIR.L Y 16.44 658.3398 6 -60.2 330.1574 2 36.78 1 12591 AEV 2_3_RA2_01_1224.d 0 1 1 2149 2154
R.KIWLDPNE(+37.03)VNEISTANSR.Q Y 16.42 2122.0806 18 -42.7 708.3373 3 71.31 3 41254 AEV_3_3_RA3_01_1233.d 5.53E4 1 1 2703 2720 Propargylamine
K.VEQLMQLFEN(+.98)TLETSDK.A Y 16.37 2024.9612 17 -29.5 675.9744 3 87.00 1 47341 AEV 2_3_RA2_01_1224.d 1.63E4 1 1 1274 1290 Deamidation (NQ)
R.Q(+43.01)NVQ(+.98)SEEEIIK.R Y 16.37 1359.6517 11 -1.6 680.8320 2 26.28 3 11297 AEV_3_3_RA3_01_1233.d 4.69E4 1 1 862 872 Carbamylation; Deamidation (NQ)
R.GLGS(+79.97)R(+31.99).S Y 16.36 600.2268 5 -140.0 601.1500 1 18.65 1 4427 AEV 2_3_RA2_01_1224.d 5.17E3 1 1 1606 1610 Phosphorylation (STY); Dihydroxy
K.DSASVNAGTGNER.L Y 16.33 1276.5643 13 -40.6 426.5114 3 54.91 1 23112 AEV 2_3_RA2_01_1224.d 7.19E4 1 1 645 657
R.LSSADAATYIK(+21.98).E Y 16.26 1160.5690 11 -100.6 581.2334 2 41.55 1 15319 AEV 2_3_RA2_01_1224.d 0 1 1 1352 1362 Sodium adduct
R.LAASVVGC(+57.02)GQR(+31.99).K Y 16.23 1148.5608 11 -6.0 575.2842 2 49.44 3 25385 AEV_3_3_RA3_01_1233.d 4.54E4 1 1 2692 2702 Carbamidomethylation; Dihydroxy
K.GNT(-18.01)FK.H Y 16.21 547.2755 5 -68.3 548.2454 1 98.84 1 55282 AEV 2_3_RA2_01_1224.d 3.8E4 1 1 2811 2815 Dehydration
R.AQVAQK(+170.04).R Y 16.18 813.4021 6 6.1 814.4143 1 53.23 3 27867 AEV_3_3_RA3_01_1233.d 0 1 1 829 834 Menadione quinone derivative
R.E(+42.01)NGAIRLGR.F Y 16.14 1026.5570 9 6.0 343.1950 3 35.95 2 13519 AEV_1_3_RA2_01_1232.d 0 1 1 2149 2157 Acetylation (N-term)
R.LASP(+31.99)NMEQK(+42.01).V Y 16.13 1090.4965 9 -67.3 546.2188 2 51.44 1 21010 AEV 2_3_RA2_01_1224.d 0 1 1 1908 1916 Dihydroxy; Acetylation (K)
R.GQPQK.K N 16.12 556.2969 5 55.1 557.3348 1 99.67 1 55570 AEV 2_3_RA2_01_1224.d 1.28E4 1 1 836 840
K.S(+13.03)DAGAGDR.L Y 16.12 760.3464 8 -64.5 761.3046 1 91.39 1 50617 AEV 2_3_RA2_01_1224.d 5.26E4 1 1 1688 1695 Michael addition with methylamine
R.YT(-18.01)QHHK.I Y 16.11 794.3824 6 -8.9 398.1949 2 37.88 1 13218 AEV 2_3_RA2_01_1224.d 0 1 1 1047 1052 Dehydration
R.AT(+79.96)ASK(+14.02).A Y 16.10 570.2319 5 19.1 571.2501 1 28.40 2 9991 AEV_1_3_RA2_01_1232.d 0 1 1 1657 1661 Sulfation; Methylation(KR)
R.L(+27.99)AASVVGC(+57.02)GQR(+14.02).K Y 16.07 1158.5815 11 -44.8 387.1838 3 75.04 1 37905 AEV 2_3_RA2_01_1224.d 0 1 1 2692 2702 Formylation; Carbamidomethylation; Methylation(KR)
R.REAEGGQGGLGLSSDELEDEK.E Y 15.99 2174.9927 21 -14.7 544.7474 4 94.40 1 52742 AEV 2_3_RA2_01_1224.d 6.19E4 1 1 2636 2656
R.QY(+79.96)FIQELSK.E Y 15.93 1234.5540 9 30.7 412.5379 3 12.80 2 3521 AEV_1_3_RA2_01_1232.d 2.68E4 1 1 91 99 Sulfation
K.C(+27.99)LTDLAR.A Y 15.91 818.3956 7 -84.5 410.1705 2 29.52 1 8733 AEV 2_3_RA2_01_1224.d 6.44E4 1 1 899 905 Formylation
K.K(+42.01)(+42.01)VDNKDK.W Y 15.91 929.4818 7 -0.5 930.4886 1 88.97 2 46707 AEV_1_3_RA2_01_1232.d 4.33E2 1 1 1205 1211 Acetylation (N-term); Acetylation (K)
K.EIIGS(+162.05)R.T Y 15.84 835.4286 6 3.2 836.4386 1 105.45 1 57443 AEV 2_3_RA2_01_1224.d 7E5 1 1 236 241 Hexose (NSY)
R.QYFIQE(+43.99)LS(+79.97)K.E Y 15.79 1278.5533 9 -9.0 427.1879 3 54.43 1 22812 AEV 2_3_RA2_01_1224.d 1.36E5 1 1 91 99 Carboxylation (E); Phosphorylation (STY)
R.A(+43.01)SGK(+14.02)IDK.H Y 15.79 774.4235 7 26.1 388.2291 2 51.49 2 21207 AEV_1_3_RA2_01_1232.d 0 1 1 2793 2799 Carbamylation; Methylation(KR)
R.VIKAIS(+79.97)IS(+79.97)PPER.A Y 15.70 1468.7091 12 46.3 368.2015 4 50.44 2 20659 AEV_1_3_RA2_01_1232.d 5.5E4 1 1 661 672 Phosphorylation (STY)
K.YLE(+21.98)STDSQ(+.98)LR.G Y 15.68 1233.5490 10 -82.0 617.7312 2 28.89 1 8400 AEV 2_3_RA2_01_1224.d 8.08E4 1 1 1148 1157 Sodium adduct; Deamidation (NQ)
R.VLK(+31.99)FEPTDIAIAR.T Y 15.67 1503.8296 13 5.3 376.9667 4 60.35 2 26110 AEV_1_3_RA2_01_1232.d 1.61E5 1 1 781 793 Dihydroxy
R.SLQ(+.98)R(+14.02)FGEVISNPEVK.S Y 15.67 1716.9045 15 -5.4 430.2311 4 44.28 3 22104 AEV_3_3_RA3_01_1233.d 0 1 1 1544 1558 Deamidation (NQ); Methylation(KR)
R.R(+43.01)QMAESGSTVISLK.G Y 15.65 1548.7930 14 3.6 775.4066 2 79.05 2 39804 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 1256 1269 Carbamylation
R.N(+42.01)GAVK.A Y 15.62 529.2860 5 7.0 530.2970 1 30.99 3 13961 AEV_3_3_RA3_01_1233.d 0 1 1 327 331 Acetylation (N-term)
K.E(+149.03)ILDAATK.G Y 15.61 1008.4950 8 -58.9 505.2251 2 32.70 1 10473 AEV 2_3_RA2_01_1224.d 1.73E4 1 1 429 436 Benzyl isothiocyanate
K.DSASVN(+.98)AGTGN(+.98)ER.L Y 15.57 1278.5323 13 35.7 640.2963 2 81.35 1 42893 AEV 2_3_RA2_01_1224.d 2.76E4 1 1 645 657 Deamidation (NQ)
K.GVSAFREYR.I Y 15.56 1083.5461 9 12.7 542.7872 2 16.50 3 5941 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 1392 1400
K.SASLLIK(+31.99)YLES(+79.97)TDSQLR.G Y 15.56 2034.9874 17 -1.3 679.3355 3 75.62 3 44618 AEV_3_3_RA3_01_1233.d 7.33E4 1 1 1141 1157 Dihydroxy; Phosphorylation (STY)
K.E(+42.01)QK(+14.02)DKNGAT(+79.97)LLAYDK.V Y 15.55 1828.8607 15 63.0 458.2513 4 77.93 2 38918 AEV_1_3_RA2_01_1232.d 0 1 1 517 531 Acetylation (N-term); Methylation(KR); Phosphorylation (STY)
K.L(+43.01)LLT(+79.97)NIK.S Y 15.50 936.5045 7 -32.4 469.2444 2 63.22 2 28025 AEV_1_3_RA2_01_1232.d 6.91E4 1 1 313 319 Carbamylation; Phosphorylation (STY)
K.DSAS(+79.97)VN(+.98)AGTGNER(+14.02).L Y 15.49 1371.5304 13 67.8 343.9131 4 62.73 1 28572 AEV 2_3_RA2_01_1224.d 2.32E5 1 1 645 657 Phosphorylation (STY); Deamidation (NQ); Methylation(KR)
K.A(+43.01)AWDALTQLTTHMR.K Y 15.41 1656.8042 14 17.0 553.2847 3 74.11 2 35956 AEV_1_3_RA2_01_1232.d 7.18E4 1 1 2191 2204 Carbamylation
K.I(+43.01)TN(+.98)AEQR.G Y 15.37 874.4144 7 22.4 875.4413 1 95.04 2 49350 AEV_1_3_RA2_01_1232.d 4.58E3 1 1 362 368 Carbamylation; Deamidation (NQ)
R.S(+43.01)QISK(+42.01).G Y 15.34 646.3286 5 -15.3 324.1666 2 59.06 1 25814 AEV 2_3_RA2_01_1224.d 0 1 1 740 744 Carbamylation; Acetylation (K)
K.YRASGK(+21.98).I Y 15.32 702.3425 6 -11.5 703.3417 1 98.65 3 58613 AEV_3_3_RA3_01_1233.d 0 1 1 2791 2796 Sodium adduct
R.AT(-18.01)ASK.A Y 15.29 458.2489 5 -108.8 459.2063 1 47.79 1 18969 AEV 2_3_RA2_01_1224.d 0 1 1 1657 1661 Dehydration
K.A(+27.99)ISISPPER.A Y 15.26 996.5240 9 -3.6 499.2675 2 42.45 3 20934 AEV_3_3_RA3_01_1233.d 0 1 1 664 672 Formylation
K.V(+42.01)RE(+43.99)HAVNALK.Q Y 15.26 1221.6466 10 26.8 408.2337 3 59.44 3 31988 AEV_3_3_RA3_01_1233.d 2.32E5 1 1 605 614 Acetylation (N-term); Carboxylation (E)
R.GQPQK(+43.01).K N 15.18 599.3027 5 162.9 600.4077 1 103.18 1 56754 AEV 2_3_RA2_01_1224.d 1.29E5 1 1 836 840 Carbamylation
K.EIIGSR(+39.99).T Y 15.17 713.3708 6 -24.4 714.3607 1 77.30 3 45938 AEV_3_3_RA3_01_1233.d 4.32E4 1 1 236 241 Glyoxal-derived hydroimiadazolone
K.GEEDEEDTTAQAGQ(+.98)SLLEVLGEEK(+226.08)R.N Y 15.14 2959.3240 25 -27.2 987.4218 3 93.05 1 51791 AEV 2_3_RA2_01_1224.d 0 1 1 1833 1857 Deamidation (NQ); Biotinylation
R.E(+21.98)LAEARK(+42.01).I Y 15.12 879.4426 7 5.2 440.7308 2 30.69 2 11018 AEV_1_3_RA2_01_1232.d 4.34E4 1 1 2747 2753 Sodium adduct; Acetylation (K)
R.Q(+.98)VGVPGS(+79.97)NLPGFSLPK.G Y 15.09 1676.8174 16 44.6 420.2303 4 51.68 2 21300 AEV_1_3_RA2_01_1232.d 1.6E5 1 1 2221 2236 Deamidation (NQ); Phosphorylation (STY)
R.E(+14.02)LAEAR.K Y 15.09 701.3708 6 -18.4 702.3652 1 80.29 2 40798 AEV_1_3_RA2_01_1232.d 0 1 1 2747 2752 Methylation(others)
R.T(+79.97)ISMLTSDGASGSR.N Y 15.09 1461.6171 14 2.5 488.2142 3 81.79 1 43234 AEV 2_3_RA2_01_1224.d 3.14E4 1 1 187 200 Phosphorylation (STY)
R.S(+42.01)AAIAVWK(+27.99).A Y 15.08 914.4861 8 11.6 458.2556 2 28.44 2 10007 AEV_1_3_RA2_01_1232.d 0 1 1 1877 1884 Acetylation (N-term); Formylation
R.TQK(+42.01)RLAASVVGC(+57.02)GQ(+.98)R.K Y 15.08 1672.8679 15 -40.8 558.6072 3 45.27 3 22732 AEV_3_3_RA3_01_1233.d 4E5 1 1 2688 2702 Acetylation (K); Carbamidomethylation; Deamidation (NQ)
R.K(+14.02)PVLDDVKAGILQFYAK(+42.01).E Y 15.07 1960.1033 17 10.5 491.0382 4 81.23 2 41534 AEV_1_3_RA2_01_1232.d 0 1 1 219 235 Methylation(KR); Acetylation (K)
R.V(+42.01)TALQ(+.98)TLIS(+79.97)SMQR.Y Y 15.04 1569.7473 13 12.1 393.4489 4 27.27 3 11830 AEV_3_3_RA3_01_1233.d 3.79E5 1 1 1034 1046 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
R.F(+42.01)GEVISN(+.98)PEVK.S Y 15.00 1260.6238 11 -12.9 421.2098 3 52.07 2 21508 AEV_1_3_RA2_01_1232.d 0 1 1 1548 1558 Acetylation (N-term); Deamidation (NQ)
K.DSASVNAGT(+87.05)GNER.L Y 15.00 1363.6150 13 -28.1 455.5328 3 24.22 1 6219 AEV 2_3_RA2_01_1224.d 3.99E5 1 1 645 657 Phosphorylation to amine thiol
total 280 peptides
C1GLA5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.TLSDYNIQKESTLHLVLR.L N 168.41 2129.1479 18 4.3 533.2966 4 75.46 2 36962 AEV_1_3_RA2_01_1232.d 2.53E6 8 8 100 117
K.TITLEVESSDTIDNVKSK.I N 129.56 1978.0106 18 12.0 660.3521 3 69.30 2 32324 AEV_1_3_RA2_01_1232.d 5.02E5 3 3 57 74
K.TITLEVESSDTIDNVK.S N 124.08 1762.8837 16 3.3 588.6371 3 74.72 2 36475 AEV_1_3_RA2_01_1232.d 1.58E6 11 11 57 72
K.Q(-17.03)LEDGRTLSDYNIQKESTLHLVLR.L N 112.34 2810.4563 24 0.4 703.6216 4 79.31 3 47526 AEV_3_3_RA3_01_1233.d 2.79E5 2 2 94 117 Pyro-glu from Q
K.C(+57.02)GHTNQLRPK.K Y 101.15 1209.6036 10 3.0 404.2097 3 12.51 3 3761 AEV_3_3_RA3_01_1233.d 2.42E5 3 3 160 169 Carbamidomethylation
K.IQDKEGIPPDQQR.L N 98.11 1522.7739 13 1.5 762.3954 2 34.87 3 16294 AEV_3_3_RA3_01_1233.d 1.15E7 76 76 75 87
K.TLTGKTITLEVESSDTIDNVK.S N 92.12 2263.1794 21 -11.3 755.3919 3 75.31 2 36909 AEV_1_3_RA2_01_1232.d 0 1 1 52 72
K.ESTLHLVLR.L N 84.33 1066.6135 9 -1.4 534.3133 2 63.71 3 35290 AEV_3_3_RA3_01_1233.d 1.35E6 7 7 109 117
R.TLSDYNIQK.E N 73.35 1080.5452 9 3.1 541.2816 2 51.60 2 21255 AEV_1_3_RA2_01_1232.d 2.25E6 9 9 100 108
K.SKIQDKEGIPPDQQR.L N 72.68 1737.9009 15 -0.3 580.3074 3 29.55 3 13140 AEV_3_3_RA3_01_1233.d 5.57E6 26 26 73 87
K.C(+58.01)GHTNQLRPK.K Y 72.55 1210.5876 10 1.0 606.3017 2 14.58 3 4870 AEV_3_3_RA3_01_1233.d 2.54E5 2 2 160 169 Carboxymethyl
R.TLSDYNIQK(+14.02)ESTLHLVLR.L N 69.11 2143.1636 18 5.1 536.8009 4 77.62 2 38667 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 100 117 Methylation(KR)
K.Q(-17.03)LEDGRTLSDYN(+.98)IQKESTLHLVLR.L N 66.52 2811.4402 24 10.2 703.8745 4 79.63 2 40272 AEV_1_3_RA2_01_1232.d 2E4 1 1 94 117 Pyro-glu from Q; Deamidation (NQ)
K.Q(-17.03)LEDGRTLSDYNIQK.E N 63.55 1761.8533 15 3.2 881.9368 2 71.84 3 41677 AEV_3_3_RA3_01_1233.d 2.53E5 3 3 94 108 Pyro-glu from Q
K.EGIPPDQQR.L N 57.93 1038.5094 9 4.7 520.2644 2 28.63 2 10098 AEV_1_3_RA2_01_1232.d 1.55E6 32 32 79 87
R.ALASKYNC(+57.02)DK.M Y 57.06 1168.5547 10 -13.9 585.2765 2 17.61 3 6542 AEV_3_3_RA3_01_1233.d 4.11E5 3 3 129 138 Carbamidomethylation
K.C(+57.02)GHTN(-17.03)QLRPK.K Y 56.10 1192.5771 10 1.5 597.2968 2 23.43 3 9688 AEV_3_3_RA3_01_1233.d 1.88E6 7 7 160 169 Carbamidomethylation; Ammonia-loss (N)
K.IQDK(+14.02)EGIPPDQQR.L N 55.85 1536.7896 13 3.3 513.2722 3 44.97 2 17919 AEV_1_3_RA2_01_1232.d 1.79E6 15 15 75 87 Methylation(KR)
R.LIFAGKQLEDGR.T N 54.40 1345.7354 12 -3.6 449.5841 3 63.99 3 35493 AEV_3_3_RA3_01_1233.d 3.09E5 4 4 88 99
K.IQDKEGIPPDQ(+.98)QR.L N 51.40 1523.7579 13 12.7 508.9330 3 34.43 3 15994 AEV_3_3_RA3_01_1233.d 5.63E6 14 14 75 87 Deamidation (NQ)
K.TITLEVES(+14.02)SDTIDNVK.S N 49.05 1776.8993 16 -2.9 889.4543 2 77.31 3 45956 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 57 72 Methylation(others)
R.TLSDYNIQKESTLHLVLR(+14.02).L N 47.10 2143.1636 18 0.8 536.7986 4 76.77 2 37995 AEV_1_3_RA2_01_1232.d 8.35E4 1 1 100 117 Methylation(KR)
K.IQDKEGIPPDQQR(+14.02).L N 46.75 1536.7896 13 -1.1 513.2699 3 41.44 3 20328 AEV_3_3_RA3_01_1233.d 2.56E6 10 10 75 87 Methylation(KR)
K.IQD(+14.02)KEGIPPDQQR.L N 39.36 1536.7896 13 -7.4 513.2667 3 46.75 3 23658 AEV_3_3_RA3_01_1233.d 0 2 2 75 87 Methylation(others)
R.LIFAGK.Q N 39.20 647.4006 6 -10.6 648.4011 1 50.93 3 26322 AEV_3_3_RA3_01_1233.d 6.06E6 5 5 88 93
K.E(-18.01)GIPPDQQR.L N 38.97 1020.4988 9 31.1 511.2726 2 33.77 2 12486 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 79 87 Pyro-glu from E
K.IQDKEGIPPDQQ(+.98)R.L N 38.89 1523.7579 13 11.4 508.9324 3 39.27 3 18953 AEV_3_3_RA3_01_1233.d 3.46E6 4 4 75 87 Deamidation (NQ)
K.IQ(+.98)DKEGIPPDQQR.L N 34.63 1523.7579 13 15.3 508.9344 3 38.27 2 14644 AEV_1_3_RA2_01_1232.d 7.43E5 2 2 75 87 Deamidation (NQ)
K.IQDKE(+14.02)GIPPDQQR.L N 32.53 1536.7896 13 -11.9 513.2643 3 47.20 2 19035 AEV_1_3_RA2_01_1232.d 5.4E5 3 3 75 87 Methylation(others)
K.TITLEVESSDTIDNVK(+214.97).S N 32.15 1977.8547 16 -11.7 989.9230 2 75.43 1 38220 AEV 2_3_RA2_01_1224.d 2.5E4 1 1 57 72 4-sulfophenyl isothiocyanate
R.LIFAGK(+383.23)QLEDGR.T N 32.08 1728.9634 12 -4.3 577.3259 3 64.31 3 35736 AEV_3_3_RA3_01_1233.d 2.91E4 1 1 88 99 Ubiquitination
K.TITLE(+6.01)VESSDTIDNVKSK.I N 31.05 1984.0188 18 -45.0 662.3171 3 68.87 3 39354 AEV_3_3_RA3_01_1233.d 2.47E4 1 1 57 74 Replacement of proton by lithium
K.ES(+59.02)TLHLVLR.L N 31.03 1125.6328 9 -42.3 563.7999 2 75.47 3 44495 AEV_3_3_RA3_01_1233.d 0 1 1 109 117 Aminoethylcysteine
R.TLSDYNIQKE(+14.02)STLHLVLR.L N 30.63 2143.1636 18 -4.4 536.7958 4 77.19 3 45851 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 100 117 Methylation(others)
R.LIFAGK(+14.02).Q N 30.36 661.4163 6 -101.8 662.3562 1 71.24 1 34908 AEV 2_3_RA2_01_1224.d 3.77E5 4 4 88 93 Methylation(KR)
K.IQD(-18.01)K(+14.02)EGIPPDQQR.L N 30.05 1518.7791 13 -30.9 507.2513 3 34.44 3 15998 AEV_3_3_RA3_01_1233.d 5.97E4 3 3 75 87 Dehydration; Methylation(KR)
K.TITLEVESSDTIDNVK(-.98).S N 27.99 1761.8997 16 18.1 588.3178 3 74.63 2 36340 AEV_1_3_RA2_01_1232.d 1.16E5 1 1 57 72 Amidation
R.T(-18.01)LSDYNIQK(+14.02)ESTLHLVLR.L N 27.42 2125.1531 18 -11.4 532.2895 4 75.58 2 37059 AEV_1_3_RA2_01_1232.d 0 1 1 100 117 Dehydration; Methylation(KR)
K.QLEDGRT(-2.02)LSDYNIQKESTLHLVLR.L N 26.77 2825.4670 24 -24.9 566.0866 5 75.48 3 44506 AEV_3_3_RA3_01_1233.d 0 1 1 94 117 2-amino-3-oxo-butanoic_acid
K.E(+41.03)STLHLVLR.L N 25.34 1107.6400 9 -15.5 370.2149 3 63.95 3 35461 AEV_3_3_RA3_01_1233.d 0 1 1 109 117 Amidination of lysines or N-terminal amines with methyl acetimidate
K.Q(-17.03)LEDGR.T N 24.76 699.3187 6 -88.0 700.2645 1 36.99 1 12732 AEV 2_3_RA2_01_1224.d 5.68E5 2 2 94 99 Pyro-glu from Q
K.TITLEVESSDTIDNVK(+14.02).S N 24.01 1776.8993 16 1.8 889.4586 2 77.63 2 38679 AEV_1_3_RA2_01_1232.d 2.34E4 1 1 57 72 Methylation(KR)
R.TLS(+79.97)DY(+31.99)NIQKESTLHLVLR.L N 23.33 2241.1042 18 25.4 561.2975 4 75.38 3 44421 AEV_3_3_RA3_01_1233.d 7.3E4 1 1 100 117 Phosphorylation (STY); Dihydroxy
R.VESDHPATTEK.V Y 23.02 1212.5623 11 -119.3 607.2161 2 80.67 1 42360 AEV 2_3_RA2_01_1224.d 0 1 1 31 41
K.TITLEVESSDTIDNVK(+229.01).S N 22.97 1991.8976 16 -29.8 664.9534 3 77.44 1 39804 AEV 2_3_RA2_01_1224.d 4.39E4 1 1 57 72 Pyridoxal phosphate
R.TLS(-18.01)DYNIQ(+.98)KESTLHLVLR.L N 22.64 2112.1216 18 -24.1 705.0308 3 79.31 3 47529 AEV_3_3_RA3_01_1233.d 6.6E4 1 1 100 117 Dehydration; Deamidation (NQ)
MPTTH(+142.11)ALSESSK.L Y 22.55 1429.7235 12 1.7 477.5826 3 52.63 2 21795 AEV_1_3_RA2_01_1232.d 0 1 1 1 12 Diphthamide
K.SKIQDK(-1.03)EGIPPDQQR.L N 21.71 1736.8693 15 -18.6 435.2165 4 30.29 3 13554 AEV_3_3_RA3_01_1233.d 0 1 1 73 87 Lysine oxidation to aminoadipic semialdehyde
K.TLTGK(-1.03)TITLEVESSDTIDNVK.S N 21.30 2262.1477 21 9.8 755.0639 3 80.46 2 40927 AEV_1_3_RA2_01_1232.d 0 1 1 52 72 Lysine oxidation to aminoadipic semialdehyde
K.TITLEVES(-18.01)SDTIDNVK.S N 21.12 1744.8730 16 3.3 873.4467 2 83.15 2 42987 AEV_1_3_RA2_01_1232.d 1.43E5 1 1 57 72 Dehydration
MPTTHALSESSK(+21.98)(+42.01).L Y 20.85 1351.6053 12 -59.6 676.7697 2 74.69 1 37623 AEV 2_3_RA2_01_1224.d 4.14E4 1 1 1 12 Sodium adduct; Acetylation (K)
K.TLT(+79.97)GK(+42.01).T N 20.73 640.2833 5 -31.0 641.2708 1 85.30 1 46025 AEV 2_3_RA2_01_1224.d 5.18E4 1 1 52 56 Phosphorylation (STY); Acetylation (K)
K.IQD(+21.98)KEGIPPDQQR.L N 19.88 1544.7559 13 60.3 387.2195 4 46.78 2 18824 AEV_1_3_RA2_01_1232.d 0 1 1 75 87 Sodium adduct
K.TITLEVES(+14.02)SDTIDNVKSK.I N 19.45 1992.0262 18 27.0 665.0339 3 71.20 2 33740 AEV_1_3_RA2_01_1232.d 0 1 1 57 74 Methylation(others)
K.T(+43.01)LTGK(+42.01).T N 19.31 603.3228 5 -123.9 604.2552 1 90.63 1 50080 AEV 2_3_RA2_01_1224.d 2.03E4 1 1 52 56 Carbamylation; Acetylation (K)
R.R(+14.02)VESDHPATTEK(+14.02).V Y 19.27 1396.6946 12 18.4 699.3674 2 79.42 2 40100 AEV_1_3_RA2_01_1232.d 0 1 1 30 41 Methylation(KR)
R.A(+43.01)LASK(+42.01).Y Y 19.09 573.3122 5 -37.7 574.2979 1 49.19 3 25208 AEV_3_3_RA3_01_1233.d 0 1 1 129 133 Carbamylation; Acetylation (K)
K.C(+57.02)GHT(-18.01)N(+.98)QLRPK.K Y 19.04 1192.5771 10 5.5 398.5352 3 25.14 2 8571 AEV_1_3_RA2_01_1232.d 5.31E5 1 1 160 169 Carbamidomethylation; Dehydration; Deamidation (NQ)
K.EGIPPDQQRLIFAGKQLEDGR.T N 18.79 2366.2341 21 -0.8 789.7513 3 93.19 3 56405 AEV_3_3_RA3_01_1233.d 8.31E4 1 1 79 99
K.Q(+.98)LED(-18.01)GR.T N 18.70 699.3187 6 -0.6 700.3256 1 32.32 2 11793 AEV_1_3_RA2_01_1232.d 2.3E5 2 2 94 99 Deamidation (NQ); Dehydration
R.GGIIEPSLR(+14.02).A Y 18.30 954.5498 9 5.5 319.1923 3 58.73 3 31469 AEV_3_3_RA3_01_1233.d 0 1 1 120 128 Methylation(KR)
K.QLED(-18.01)GR.T N 18.21 698.3347 6 -79.1 699.2867 1 91.61 1 50790 AEV 2_3_RA2_01_1224.d 3.77E4 1 1 94 99 Dehydration
R.VESDHPATT(+79.97)EK.V Y 18.13 1292.5286 11 8.5 647.2770 2 68.26 1 32628 AEV 2_3_RA2_01_1224.d 1.49E4 1 1 31 41 Phosphorylation (STY)
K.VSATM(+15.99)QIFVK.T Y 17.95 1138.6056 10 -4.4 570.3076 2 76.56 3 45341 AEV_3_3_RA3_01_1233.d 3.48E5 1 1 42 51 Oxidation (M)
R.LPPRATNC(+57.02)R.K Y 17.61 1083.5607 9 -1.7 362.1935 3 15.95 3 5633 AEV_3_3_RA3_01_1233.d 4.04E5 2 2 148 156 Carbamidomethylation
K.IQDK(+31.99)EGIPPDQQR.L N 17.09 1554.7638 13 -97.6 519.2113 3 32.91 1 10600 AEV 2_3_RA2_01_1224.d 1.11E5 1 1 75 87 Dihydroxy
K.QLEDGRTLSDYN(+162.05)IQK.E N 16.98 1940.9326 15 25.6 389.2037 5 16.29 3 5828 AEV_3_3_RA3_01_1233.d 1.44E4 1 1 94 108 Hexose (NSY)
K.SK(+27.99)IQDK.E N 16.81 745.3970 6 -18.8 746.3902 1 86.72 2 45442 AEV_1_3_RA2_01_1232.d 3.74E5 1 1 73 78 Formylation
R.RVES(+79.97)DHPATTEK(+31.99).V Y 16.45 1480.6195 12 9.4 494.5518 3 73.58 1 36748 AEV 2_3_RA2_01_1224.d 8.67E4 1 1 30 41 Phosphorylation (STY); Dihydroxy
R.GGIIEPSLR.A Y 16.45 940.5341 9 -109.7 471.2227 2 70.14 1 34062 AEV 2_3_RA2_01_1224.d 0 1 1 120 128
K.T(+42.01)ITLEVESSDTIDNVKS(+79.97)K.I N 16.35 2099.9875 18 -72.0 700.9528 3 86.08 1 46633 AEV 2_3_RA2_01_1224.d 3.81E3 1 1 57 74 Acetylation (N-term); Phosphorylation (STY)
K.T(+42.01)(-18.01)ITLEVESSDTIDNVK.S N 16.07 1786.8837 16 41.7 596.6600 3 79.02 3 47305 AEV_3_3_RA3_01_1233.d 4.97E4 1 1 57 72 Acetylation (N-term); Dehydration
R.VESDHPAT(+79.97)TEK(+14.02).V Y 15.56 1306.5442 11 -15.9 436.5151 3 50.79 1 20648 AEV 2_3_RA2_01_1224.d 3.06E5 1 1 31 41 Phosphorylation (STY); Methylation(KR)
R.TLSDYNIQK(+42.01).E N 15.56 1122.5557 9 -91.6 562.2337 2 48.63 1 19436 AEV 2_3_RA2_01_1224.d 3.78E4 1 1 100 108 Acetylation (K)
R.L(+108.00)IFAGKQLEDGR.T N 15.35 1453.7329 12 -7.6 485.5812 3 65.29 3 36506 AEV_3_3_RA3_01_1233.d 9.49E4 1 1 88 99 O-Ethylphosphorylation
total 75 peptides
C1GA20
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.VLEQLSGQTPVYSK.A Y 143.34 1547.8195 14 2.5 774.9189 2 67.38 2 30935 AEV_1_3_RA2_01_1232.d 7.14E6 13 13 37 50
K.LVLNISVGESGDRLTR.A Y 117.34 1727.9530 16 4.0 576.9939 3 74.53 2 36290 AEV_1_3_RA2_01_1232.d 3E6 6 6 18 33
K.IAVHVTVRGPKAEEILER.G Y 108.41 2016.1479 18 -5.0 505.0417 4 65.79 3 36899 AEV_3_3_RA3_01_1233.d 3.31E5 3 3 66 83
K.LVLNISVGESGDR.L Y 108.21 1357.7201 13 1.5 679.8683 2 74.33 2 36125 AEV_1_3_RA2_01_1232.d 1.1E6 4 4 18 30
R.AAKVLEQLSGQTPVYSK.A Y 107.41 1817.9886 17 -1.8 607.0024 3 67.10 3 37952 AEV_3_3_RA3_01_1233.d 4.72E5 4 4 34 50
K.VLEQLSGQTPVYSKAR.Y Y 107.15 1774.9578 16 5.9 592.6633 3 63.98 2 28543 AEV_1_3_RA2_01_1232.d 1.89E5 2 2 37 52
R.IQKLVLNISVGESGDRLTR.A Y 106.33 2097.1904 19 -4.6 525.3025 4 72.35 3 42065 AEV_3_3_RA3_01_1233.d 8.27E5 4 4 15 33
K.VLEQLSGQTPVYSK(+14.02).A Y 91.86 1561.8351 14 1.5 781.9260 2 69.21 2 32281 AEV_1_3_RA2_01_1232.d 3.79E5 2 2 37 50 Methylation(KR)
K.VLEQ(+.98)LSGQTPVYSK.A Y 91.22 1548.8035 14 -1.9 775.4075 2 68.36 3 38999 AEV_3_3_RA3_01_1233.d 1.5E6 4 4 37 50 Deamidation (NQ)
R.GPKAEEILER.G Y 87.58 1140.6138 10 3.6 571.3162 2 46.81 3 23690 AEV_3_3_RA3_01_1233.d 2.29E6 12 12 74 83
K.IGSSHKINQTETIK.W Y 87.31 1554.8365 14 0.6 519.2864 3 28.95 3 12772 AEV_3_3_RA3_01_1233.d 9.98E5 4 4 149 162
K.VLE(+14.02)QLSGQTPVYSK.A Y 81.94 1561.8351 14 -3.5 781.9221 2 69.06 3 39504 AEV_3_3_RA3_01_1233.d 8.8E5 3 3 37 50 Methylation(others)
K.INQTETIKWFK.S Y 80.59 1406.7557 11 4.4 469.9279 3 68.71 2 31902 AEV_1_3_RA2_01_1232.d 2.08E6 7 7 155 165
K.IGSSHKINQTETIKWFK.S Y 79.41 2016.0792 17 -8.3 505.0229 4 62.35 3 34253 AEV_3_3_RA3_01_1233.d 1.22E6 3 3 149 165
R.KQNFSETGNFGFGISEHIDLGIK.Y Y 73.15 2537.2549 23 1.4 635.3219 4 111.87 3 62490 AEV_3_3_RA3_01_1233.d 4.76E4 1 1 94 116
R.GLKVKEYELR.K Y 70.84 1233.7080 10 -1.6 412.2426 3 48.36 3 24677 AEV_3_3_RA3_01_1233.d 1.6E6 8 8 84 93
K.SRFEGIVR Y 64.72 962.5297 8 0.2 321.8506 3 44.12 3 22032 AEV_3_3_RA3_01_1233.d 7.3E6 18 18 166 173
K.YDPGIGIYGMDFYC(+57.02)C(+57.02)MTRPGER.V Y 63.59 2657.1172 22 2.4 886.7151 3 83.75 2 43432 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 117 138 Carbamidomethylation
K.LVLNISVGESGDR(+14.02)LTR.A Y 62.43 1741.9686 16 -5.5 581.6603 3 76.06 3 44969 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 18 33 Methylation(KR)
R.NEKIAVHVTVR.G Y 61.77 1264.7251 11 -0.5 317.1884 4 41.37 3 20270 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 63 73
K.LVLNISVGESGDRLTR(+14.02).A Y 56.38 1741.9686 16 -3.2 581.6616 3 74.84 3 44000 AEV_3_3_RA3_01_1233.d 2.09E5 2 2 18 33 Methylation(KR)
K.INQTETIKWFKSRFEGIVR Y 55.38 2351.2749 19 -5.4 471.2597 5 79.52 3 47698 AEV_3_3_RA3_01_1233.d 2.28E5 2 2 155 173
K.IAVHVTVRGPK.A Y 54.94 1175.7139 11 -8.0 588.8595 2 43.55 3 21634 AEV_3_3_RA3_01_1233.d 6.6E5 5 5 66 76
K.VLEQLSGQ(+.98)TPVYSK.A Y 53.73 1548.8035 14 4.4 775.4124 2 68.86 3 39365 AEV_3_3_RA3_01_1233.d 1.07E6 2 2 37 50 Deamidation (NQ)
K.AEEILER.G Y 51.62 858.4446 7 0.0 430.2296 2 37.73 3 18020 AEV_3_3_RA3_01_1233.d 3.5E6 7 7 77 83
R.IQKLVLNISVGESGDR(+14.02)LTR.A Y 49.85 2111.2063 19 -31.9 528.7920 4 74.53 3 43761 AEV_3_3_RA3_01_1233.d 3.2E4 2 2 15 33 Methylation(KR)
K.INQTETIK.W Y 48.55 945.5131 8 2.4 473.7650 2 24.33 2 8200 AEV_1_3_RA2_01_1232.d 3.63E5 3 3 155 162
K.SRFEGIVR(+14.02) Y 47.61 976.5453 8 0.0 326.5224 3 53.95 3 28353 AEV_3_3_RA3_01_1233.d 4.39E5 5 5 166 173 Methylation(KR)
K.LVLN(+.98)ISVGESGDRLTR.A Y 47.38 1728.9370 16 -10.2 577.3137 3 74.90 2 36546 AEV_1_3_RA2_01_1232.d 0 1 1 18 33 Deamidation (NQ)
K.VLEQLSGQ(+.98)TPVYSK(+14.02).A Y 45.78 1562.8192 14 -6.1 782.4121 2 70.10 3 40304 AEV_3_3_RA3_01_1233.d 3.3E4 1 1 37 50 Deamidation (NQ); Methylation(KR)
K.VKEYELRK.Q Y 45.51 1063.6025 8 -2.8 355.5405 3 19.34 3 7481 AEV_3_3_RA3_01_1233.d 4E5 2 2 87 94
K.SNPMRELR.I Y 42.29 1001.5076 8 2.8 501.7625 2 34.71 2 12942 AEV_1_3_RA2_01_1232.d 6.34E5 3 3 7 14
R.GPKAEE(+14.02)ILER.G Y 42.15 1154.6295 10 -1.9 578.3209 2 50.32 3 25927 AEV_3_3_RA3_01_1233.d 1.71E5 2 2 74 83 Methylation(others)
K.VLEQLS(-2.02)GQTPVYSK.A Y 40.81 1545.8038 14 -3.8 516.2733 3 67.58 2 31066 AEV_1_3_RA2_01_1232.d 0 1 1 37 50 2-amino-3-oxo-butanoic_acid
K.VLEQ(+15.00)LSGQTPVYSK.A Y 38.86 1562.8192 14 -4.7 782.4132 2 70.51 3 40627 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 37 50 Deamidation followed by a methylation
K.VKEYELR.K Y 38.44 935.5076 7 0.8 468.7614 2 28.38 3 12456 AEV_3_3_RA3_01_1233.d 3.72E6 10 10 87 93
K.SRFE(+14.02)GIVR Y 37.57 976.5453 8 1.0 326.5227 3 52.31 3 27303 AEV_3_3_RA3_01_1233.d 1.16E6 4 4 166 173 Methylation(others)
K.I(+42.01)AVHVTVR(+14.02).G Y 36.35 949.5709 8 -12.4 317.5270 3 53.70 3 28175 AEV_3_3_RA3_01_1233.d 3.83E4 1 1 66 73 Acetylation (N-term); Methylation(KR)
R.FEGIVR Y 34.68 719.3966 6 3.4 360.7068 2 49.10 2 19995 AEV_1_3_RA2_01_1232.d 1.14E6 5 5 168 173
K.AEEILER(+14.02).G Y 34.05 872.4603 7 1.1 437.2379 2 46.74 3 23649 AEV_3_3_RA3_01_1233.d 1.75E6 8 8 77 83 Methylation(KR)
R.GLKVKEYELRK.Q Y 33.24 1361.8030 11 0.3 341.4581 4 37.69 3 17999 AEV_3_3_RA3_01_1233.d 5.73E5 4 4 84 94
K.I(+42.01)AVHVTVRGPK.A Y 32.00 1217.7244 11 -12.8 406.9102 3 47.12 2 18994 AEV_1_3_RA2_01_1232.d 3.86E5 2 2 66 76 Acetylation (N-term)
K.VKE(+14.02)YELR.K Y 30.87 949.5233 7 -5.4 475.7664 2 42.90 2 16907 AEV_1_3_RA2_01_1232.d 1.15E5 2 2 87 93 Methylation(others)
R.A(+43.01)AK(+14.02)VLEQLSGQTPVYSK.A Y 30.59 1875.0101 17 -28.6 625.9928 3 67.18 3 37999 AEV_3_3_RA3_01_1233.d 0 1 1 34 50 Carbamylation; Methylation(KR)
K.EYELR.K Y 30.45 708.3442 5 -0.7 709.3510 1 29.29 3 12975 AEV_3_3_RA3_01_1233.d 5.15E4 1 1 89 93
K.IAVHVTVRGPKAEEILER(+14.02).G Y 30.31 2030.1636 18 -2.7 407.0389 5 67.44 3 38205 AEV_3_3_RA3_01_1233.d 1.65E5 1 1 66 83 Methylation(KR)
R.G(+42.01)LKVKEYELR.K Y 30.23 1275.7186 10 -64.8 426.2193 3 52.26 2 21607 AEV_1_3_RA2_01_1232.d 3.22E4 1 1 84 93 Acetylation (N-term)
R.ELRIQK(+183.04)LVLNISVGESGDR.L Y 29.69 2308.2209 19 -58.0 578.0291 4 72.08 3 41859 AEV_3_3_RA3_01_1233.d 0 1 1 12 30 Aminoethylbenzenesulfonylation
M(+42.01)AEGK.K N 29.58 576.2578 5 -92.2 577.2119 1 33.52 1 10920 AEV 2_3_RA2_01_1224.d 0 1 1 1 5 Acetylation (Protein N-term)
K.INQTET(+14.02)IK.W Y 26.87 959.5287 8 -2.7 480.7704 2 33.79 3 15611 AEV_3_3_RA3_01_1233.d 5.31E4 1 1 155 162 Methylation(others)
K.VLEQLSGQTP(+13.98)VYSK.A Y 26.83 1561.7987 14 -66.8 781.8545 2 75.06 1 37952 AEV 2_3_RA2_01_1224.d 1.56E5 1 1 37 50 Proline oxidation to pyroglutamic acid
R.AAKVLEQLSGQTPVYSK(+14.02).A Y 26.69 1832.0043 17 -68.8 611.6334 3 69.56 2 32520 AEV_1_3_RA2_01_1232.d 5.16E4 1 1 34 50 Methylation(KR)
K.A(+42.01)EEILER.G Y 26.30 900.4552 7 -5.6 451.2324 2 39.38 2 15171 AEV_1_3_RA2_01_1232.d 7.23E5 2 2 77 83 Acetylation (N-term)
K.I(+43.01)AVHVTVR.G Y 25.96 936.5505 8 -26.9 313.1824 3 43.41 3 21541 AEV_3_3_RA3_01_1233.d 1.7E6 1 1 66 73 Carbamylation
K.IN(+.98)QTETIKWFK.S Y 25.35 1407.7397 11 0.2 470.2539 3 70.29 3 40451 AEV_3_3_RA3_01_1233.d 1.41E5 1 1 155 165 Deamidation (NQ)
K.V(+42.01)KEY(+79.96)ELR.K Y 25.21 1057.4750 7 -62.9 353.4767 3 48.62 1 19458 AEV 2_3_RA2_01_1224.d 0 1 1 87 93 Acetylation (N-term); Sulfation
R.NEK(+31.99)IAVHVTVR.G Y 25.01 1296.7150 11 -113.5 325.1492 4 62.53 1 28417 AEV 2_3_RA2_01_1224.d 1.89E5 1 1 63 73 Dihydroxy
K.ARYTVR.T Y 24.94 764.4293 6 6.5 383.2244 2 15.03 2 4350 AEV_1_3_RA2_01_1232.d 1.34E5 2 2 51 56
R.GPKAEEILER(+.98).G Y 24.90 1141.5979 10 18.0 381.5468 3 46.98 3 23802 AEV_3_3_RA3_01_1233.d 9.74E4 1 1 74 83 Deamidation (R)
K.EYELRK.Q Y 24.47 836.4392 6 -0.6 419.2266 2 18.68 3 7128 AEV_3_3_RA3_01_1233.d 2.05E5 2 2 89 94
K.IAVHVTVR.G Y 24.28 893.5447 8 -86.4 447.7410 2 62.45 1 28355 AEV 2_3_RA2_01_1224.d 2.33E5 1 1 66 73
K.SKIGSSHK.I Y 23.82 842.4610 8 -57.1 422.2137 2 51.98 1 21350 AEV 2_3_RA2_01_1224.d 2.42E5 1 1 147 154
R.IQ(+.98)KLVLNISVGESGDRLTR.A Y 23.79 2098.1746 19 -9.5 700.3922 3 73.25 2 35309 AEV_1_3_RA2_01_1232.d 0 1 1 15 33 Deamidation (NQ)
K.LVLN(+.98)ISVGESGDR(+14.02).L Y 23.67 1372.7197 13 -15.0 687.3569 2 74.68 3 43880 AEV_3_3_RA3_01_1233.d 0 1 1 18 30 Deamidation (NQ); Methylation(KR)
K.SRFEGIVR(+21.98)(+14.02) Y 23.40 998.5273 8 22.6 333.8572 3 44.62 3 22317 AEV_3_3_RA3_01_1233.d 0 1 1 166 173 Sodium adduct; Methylation(KR)
R.FEGIVR(-43.05) Y 23.37 676.3431 6 12.9 677.3591 1 81.00 2 41354 AEV_1_3_RA2_01_1232.d 4.01E4 1 1 168 173 Arginine oxidation to glutamic semialdehyde
R.TFGIR(+14.02).R Y 22.89 606.3489 5 9.9 304.1848 2 52.04 3 27079 AEV_3_3_RA3_01_1233.d 8.21E4 1 1 57 61 Methylation(KR)
R.T(+79.97)FGIR.R Y 21.66 672.2996 5 4.8 337.1587 2 57.83 1 24976 AEV 2_3_RA2_01_1224.d 6.45E4 1 1 57 61 Phosphorylation (STY)
K.IGSSHKINQTETIKWFKSR.F Y 21.60 2259.2124 19 7.1 565.8144 4 74.55 2 36288 AEV_1_3_RA2_01_1232.d 5.79E4 1 1 149 167
R.GPK(+14.02)AEEILER.G Y 21.21 1154.6295 10 5.3 385.8858 3 55.92 3 29533 AEV_3_3_RA3_01_1233.d 2.56E5 1 1 74 83 Methylation(KR)
R.YTVR(+31.99)TFGIR.R Y 20.73 1143.6036 9 11.2 382.2128 3 35.82 3 16829 AEV_3_3_RA3_01_1233.d 0 1 1 53 61 Dihydroxy
K.I(+127.06)AVHVTVR.G Y 20.45 1020.6080 8 -32.8 341.1988 3 43.13 3 21374 AEV_3_3_RA3_01_1233.d 0 1 1 66 73 N-Succinimidyl-2-morpholine acetate
R.TFGIR.R Y 20.38 592.3333 5 -17.2 593.3303 1 64.66 2 29015 AEV_1_3_RA2_01_1232.d 0 2 2 57 61
K.INQTETIK(+14.02)WFK.S Y 19.21 1420.7715 11 -25.0 711.3752 2 70.78 3 40839 AEV_3_3_RA3_01_1233.d 0 1 1 155 165 Methylation(KR)
R.FEGIVR(+14.02) Y 18.62 733.4122 6 -13.5 367.7084 2 44.85 2 17859 AEV_1_3_RA2_01_1232.d 0 1 1 168 173 Methylation(KR)
R.GPKAEEILER(+14.02).G Y 18.52 1154.6295 10 -81.0 385.8526 3 67.76 1 32241 AEV 2_3_RA2_01_1224.d 1.47E5 1 1 74 83 Methylation(KR)
K.INQT(-2.02)ETIKWFK.S Y 18.29 1404.7401 11 -9.5 469.2495 3 69.00 2 32097 AEV_1_3_RA2_01_1232.d 4.26E4 1 1 155 165 2-amino-3-oxo-butanoic_acid
K.I(+42.01)GSS(+79.97)HK.I N 18.28 749.3109 6 -66.0 750.2687 1 99.21 1 55405 AEV 2_3_RA2_01_1224.d 5.14E3 1 1 149 154 Acetylation (N-term); Phosphorylation (STY)
K.IGSSHK.I N 17.85 627.3340 6 -50.6 628.3095 1 50.98 1 20763 AEV 2_3_RA2_01_1224.d 3.6E4 1 1 149 154
K.VLEQ(+.98)LSGQ(+.98)TPVYSK.A Y 17.76 1549.7875 14 16.8 775.9141 2 67.60 3 38333 AEV_3_3_RA3_01_1233.d 2.18E5 2 2 37 50 Deamidation (NQ)
K.I(+42.01)GSSHK(+28.03).I N 17.67 697.3759 6 2.9 698.3851 1 98.58 2 50544 AEV_1_3_RA2_01_1232.d 3.56E4 1 1 149 154 Acetylation (N-term); Dimethylation(KR)
K.IGSSHK(+21.98).I N 17.41 649.3160 6 -14.3 650.3140 1 44.19 3 22048 AEV_3_3_RA3_01_1233.d 1.06E4 1 1 149 154 Sodium adduct
K.S(+27.99)NPMR.E Y 17.16 631.2748 5 -14.2 632.2731 1 21.36 2 6957 AEV_1_3_RA2_01_1232.d 0 1 1 7 11 Formylation (Protein N-term)
K.LVLNISVGESGDR(+31.99).L Y 17.16 1389.7100 13 -68.3 464.2123 3 75.15 1 37995 AEV 2_3_RA2_01_1224.d 1.39E5 1 1 18 30 Dihydroxy
K.SKIGS(+79.97)SHKINQ(+.98)TETIK.W Y 16.89 1850.9138 16 4.1 926.4680 2 93.74 3 56673 AEV_3_3_RA3_01_1233.d 7.43E4 1 1 147 162 Phosphorylation (STY); Deamidation (NQ)
K.SRFEGIVR(+37.96) Y 16.89 1000.4856 8 -3.2 334.5014 3 47.92 2 19397 AEV_1_3_RA2_01_1232.d 0 2 2 166 173 Replacement of proton by potassium
K.IGSSHK(+43.99).I N 16.80 671.3239 6 22.8 672.3464 1 41.70 3 20467 AEV_3_3_RA3_01_1233.d 0 1 1 149 154 Carboxylation (DKW)
R.IQK(+14.02)LVLNIS(-18.01)VGESGDRLTR.A Y 16.77 2093.1956 19 -73.0 524.2679 4 73.34 2 35375 AEV_1_3_RA2_01_1232.d 9.92E4 1 1 15 33 Methylation(KR); Dehydration
K.IGSSHK(+14.02)INQT(+79.97)ETIK.W Y 16.15 1648.8185 14 13.6 413.2175 4 17.21 3 6331 AEV_3_3_RA3_01_1233.d 0 1 1 149 162 Methylation(KR); Phosphorylation (STY)
K.V(+42.01)KEY(-18.01)ELR.K Y 16.11 959.5076 7 52.9 320.8600 3 48.92 3 25059 AEV_3_3_RA3_01_1233.d 2.43E5 1 1 87 93 Acetylation (N-term); Dehydration
K.AEEILE(+43.99)R.G Y 16.03 902.4345 7 -82.1 903.3677 1 97.70 1 54805 AEV 2_3_RA2_01_1224.d 3.58E4 1 1 77 83 Carboxylation (E)
M(+15.99)AEGK.K N 15.34 550.2421 5 -81.2 551.2047 1 19.38 1 4613 AEV 2_3_RA2_01_1224.d 0 1 1 1 5 Oxidation (M)
K.I(+226.08)NQTETIK(+42.01).W Y 15.19 1213.6013 8 8.5 607.8131 2 49.27 3 25258 AEV_3_3_RA3_01_1233.d 0 1 1 155 162 Biotinylation; Acetylation (K)
R.AAK(+594.09)VLEQLSGQTPVYSK.A Y 15.06 2412.0806 17 20.9 604.0400 4 68.09 2 31427 AEV_1_3_RA2_01_1232.d 0 1 1 34 50 BisANS
total 94 peptides
C1GK99
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.KGATPSQIGVILRDSHGIAQVK.V Y 128.79 2274.2808 22 3.9 569.5797 4 68.85 3 39335 AEV_3_3_RA3_01_1233.d 1.17E6 4 4 43 64
K.TTPEQVVDQIC(+57.02)K.L Y 126.77 1416.6919 12 0.4 709.3535 2 70.67 2 33350 AEV_1_3_RA2_01_1232.d 8.27E6 16 16 28 39 Carbamidomethylation
K.ANGLAPEIPEDLYMLIKK.A Y 120.58 2014.0808 18 -0.4 672.3673 3 85.38 3 51957 AEV_3_3_RA3_01_1233.d 1.34E6 7 7 77 94
K.KGATPSQIGVILR.D Y 114.24 1338.7983 13 2.7 447.2746 3 65.04 2 29297 AEV_1_3_RA2_01_1232.d 2.83E6 8 8 43 55
K.GKGIASSAIPYSR.N Y 113.06 1305.7041 13 -4.9 653.8561 2 56.52 2 23859 AEV_1_3_RA2_01_1232.d 7.05E6 16 16 8 20
R.ILKANGLAPEIPEDLYMLIKK.A Y 105.68 2368.3440 21 -0.3 593.0931 4 84.08 3 51074 AEV_3_3_RA3_01_1233.d 3.38E5 3 3 74 94
K.GATPSQIGVILR.D Y 104.08 1210.7034 12 -6.0 606.3553 2 71.85 2 34253 AEV_1_3_RA2_01_1232.d 2.11E6 5 5 44 55
K.ANGLAPEIPEDLYMLIK.K Y 101.88 1885.9858 17 1.6 944.0017 2 89.80 2 47149 AEV_1_3_RA2_01_1232.d 1.09E6 4 4 77 93
K.GIASSAIPYSR.N Y 100.12 1120.5876 11 0.6 561.3015 2 63.15 2 28016 AEV_1_3_RA2_01_1232.d 9.05E6 10 10 10 20
R.ILKANGLAPEIPEDLYMLIK.K Y 88.69 2240.2490 20 3.9 747.7599 3 87.80 2 46132 AEV_1_3_RA2_01_1232.d 1.99E5 2 2 74 93
K.GIASSAIPYSRNPPSWLK.T Y 87.99 1943.0265 18 -3.4 648.6805 3 75.62 3 44669 AEV_3_3_RA3_01_1233.d 4.88E5 3 3 10 27
K.TTPEQVVDQIC(+57.02)KLAK.K Y 84.38 1728.9080 15 3.7 577.3121 3 79.61 3 47820 AEV_3_3_RA3_01_1233.d 1.24E6 6 6 28 42 Carbamidomethylation
R.DSHGIAQVK.V Y 83.99 953.4930 9 -0.4 477.7536 2 19.18 3 7416 AEV_3_3_RA3_01_1233.d 5.07E6 11 11 56 64
K.AN(-17.03)GLAPEIPEDLYMLIKK.A Y 82.84 1997.0543 18 -0.1 999.5343 2 90.83 2 47651 AEV_1_3_RA2_01_1232.d 4.38E5 3 3 77 94 Ammonia-loss (N)
K.SVGVLPPTWR.Y Y 76.90 1110.6185 10 -2.2 556.3153 2 73.83 3 43220 AEV_3_3_RA3_01_1233.d 4.04E6 12 12 131 140
K.KGATPSQIGVILR(+14.02).D Y 76.88 1352.8140 13 -1.5 451.9446 3 67.34 3 38118 AEV_3_3_RA3_01_1233.d 4.05E5 3 3 43 55 Methylation(KR)
R.ILKAN(+.98)GLAPEIPEDLYMLIKK.A Y 74.31 2369.3279 21 -4.8 593.3364 4 85.47 2 44672 AEV_1_3_RA2_01_1232.d 2.39E5 3 3 74 94 Deamidation (NQ)
K.GIASSAIPYSR(+14.02).N Y 73.87 1134.6033 11 -2.1 568.3077 2 63.85 3 35388 AEV_3_3_RA3_01_1233.d 3.93E5 1 1 10 20 Methylation(KR)
K.GKGIASSAIPYSR(+14.02).N Y 72.89 1319.7197 13 -1.1 660.8664 2 56.81 3 30082 AEV_3_3_RA3_01_1233.d 2.66E5 2 2 8 20 Methylation(KR)
K.AN(-17.03)GLAPEIPEDLYMLIK.K Y 71.61 1868.9594 17 2.0 935.4888 2 96.55 3 57858 AEV_3_3_RA3_01_1233.d 4.05E5 3 3 77 93 Ammonia-loss (N)
K.SVGVLPPTWRYESATASTLVA Y 68.87 2204.1477 21 0.8 1103.0820 2 82.95 3 50277 AEV_3_3_RA3_01_1233.d 2.89E5 2 2 131 151
K.AN(+.98)GLAPEIPEDLYMLIKK.A Y 67.26 2015.0648 18 2.1 672.6970 3 86.87 3 52924 AEV_3_3_RA3_01_1233.d 3.1E5 2 2 77 94 Deamidation (NQ)
K.TTPEQVVDQ(+.98)IC(+57.02)K.L Y 66.70 1417.6759 12 -0.4 709.8450 2 72.51 3 42194 AEV_3_3_RA3_01_1233.d 1.38E6 6 6 28 39 Deamidation (NQ); Carbamidomethylation
K.TTPEQ(+.98)VVDQIC(+57.02)K.L Y 64.81 1417.6759 12 0.0 709.8452 2 71.70 3 41564 AEV_3_3_RA3_01_1233.d 5.4E5 2 2 28 39 Deamidation (NQ); Carbamidomethylation
K.GATPSQIGVILR(+14.02).D Y 61.72 1224.7190 12 -33.6 613.3462 2 74.90 3 44153 AEV_3_3_RA3_01_1233.d 0 2 2 44 55 Methylation(KR)
R.ILKAN(+.98)GLAPEIPEDLYMLIK.K Y 61.69 2241.2329 20 12.5 748.0942 3 88.76 3 54040 AEV_3_3_RA3_01_1233.d 8.71E4 1 1 74 93 Deamidation (NQ)
K.FRLILIESR.I Y 61.62 1145.6920 9 3.8 382.9061 3 75.53 3 44564 AEV_3_3_RA3_01_1233.d 3.05E5 3 3 113 121
K.VVTGNKILR.I Y 60.76 998.6237 9 -7.7 500.3153 2 34.25 3 15901 AEV_3_3_RA3_01_1233.d 3.13E6 9 9 65 73
R.DSHGIAQ(+.98)VK.V Y 60.16 954.4771 9 4.7 478.2480 2 22.14 3 8970 AEV_3_3_RA3_01_1233.d 1.13E5 3 3 56 64 Deamidation (NQ)
R.YESATASTLVA Y 57.22 1111.5397 11 -4.2 556.7748 2 65.40 3 36592 AEV_3_3_RA3_01_1233.d 4.38E5 2 2 141 151
R.NPPSWLK.T Y 56.67 840.4493 7 -1.8 421.2312 2 57.27 3 30410 AEV_3_3_RA3_01_1233.d 8.09E6 11 11 21 27
R.NPPSWLKTTPEQVVDQIC(+57.02)K.L Y 51.09 2239.1306 19 -3.8 747.3813 3 79.73 3 47865 AEV_3_3_RA3_01_1233.d 9.1E5 2 2 21 39 Carbamidomethylation
K.ANGLAPE(+14.02)IPEDLYMLIKK.A Y 50.87 2028.0964 18 4.7 677.0426 3 86.07 3 52418 AEV_3_3_RA3_01_1233.d 3.78E5 1 1 77 94 Methylation(others)
K.AN(+.98)GLAPEIPEDLYMLIK.K Y 50.04 1886.9698 17 0.1 944.4923 2 91.53 3 55569 AEV_3_3_RA3_01_1233.d 2.02E5 3 3 77 93 Deamidation (NQ)
K.TTPE(+14.02)QVVDQIC(+57.02)K.L Y 49.96 1430.7075 12 0.9 716.3617 2 73.39 2 35409 AEV_1_3_RA2_01_1232.d 9.3E5 1 1 28 39 Methylation(others); Carbamidomethylation
K.ANGLAPEIPEDLYMLIKKAVAVRK.H Y 48.82 2638.4880 24 -0.8 528.7045 5 87.14 3 53082 AEV_3_3_RA3_01_1233.d 3.51E4 1 1 77 100
R.LILIESR.I Y 47.21 842.5225 7 -6.5 422.2658 2 65.78 2 29864 AEV_1_3_RA2_01_1232.d 3.3E6 6 6 115 121
K.KGATPSQ(+.98)IGVILRDSHGIAQVK.V Y 46.73 2275.2646 22 12.8 456.0660 5 70.12 2 32930 AEV_1_3_RA2_01_1232.d 1.3E5 1 1 43 64 Deamidation (NQ)
K.ANGLAPEIPE(+14.02)DLYMLIK.K Y 44.61 1900.0016 17 -4.6 951.0037 2 90.52 3 55023 AEV_3_3_RA3_01_1233.d 2.19E5 2 2 77 93 Methylation(others)
K.ANGLAPEIPEDLYM(+15.99)LIK.K Y 44.14 1901.9808 17 -3.7 951.9942 2 88.22 3 53722 AEV_3_3_RA3_01_1233.d 9.75E4 2 2 77 93 Oxidation (M)
K.GK(-1.03)GIASSAIPYSR.N Y 40.79 1304.6724 13 -4.9 653.3403 2 64.33 3 35751 AEV_3_3_RA3_01_1233.d 1.77E5 2 2 8 20 Lysine oxidation to aminoadipic semialdehyde
R.N(+.98)PPSWLKTTPEQVVDQIC(+57.02)K.L Y 40.39 2240.1147 19 3.1 747.7145 3 79.87 3 47971 AEV_3_3_RA3_01_1233.d 7.08E4 1 1 21 39 Deamidation (NQ); Carbamidomethylation
R.DSHGIAQVK(+14.02).V Y 40.28 967.5087 9 -85.4 484.7203 2 50.70 1 20592 AEV 2_3_RA2_01_1224.d 6.16E4 3 3 56 64 Methylation(KR)
K.TTPEQVVD(+14.02)QIC(+57.02)K.L Y 40.16 1430.7075 12 -1.0 716.3604 2 71.70 3 41611 AEV_3_3_RA3_01_1233.d 2.16E6 2 2 28 39 Methylation(others); Carbamidomethylation
K.VVTGNKILR(+14.02).I Y 40.12 1012.6393 9 -9.6 338.5505 3 43.32 3 21486 AEV_3_3_RA3_01_1233.d 2.16E5 2 2 65 73 Methylation(KR)
K.G(+43.01)K(+14.02)GIASSAIPYSR.N Y 39.90 1362.7255 13 -0.4 455.2489 3 54.00 3 28358 AEV_3_3_RA3_01_1233.d 2.2E5 1 1 8 20 Carbamylation; Methylation(KR)
R.ILKANGLAPEIPE(+14.02)DLYMLIKK.A Y 39.18 2382.3596 21 6.1 596.6008 4 85.16 2 44418 AEV_1_3_RA2_01_1232.d 7.94E4 1 1 74 94 Methylation(others)
K.ANGLAPEIPEDLYMLIK(+14.02).K Y 37.29 1900.0016 17 -0.3 634.3409 3 91.60 2 47997 AEV_1_3_RA2_01_1232.d 5.05E4 1 1 77 93 Methylation(KR)
K.ANGLAPEIPEDLYMLIKK(+14.02).A Y 36.76 2028.0964 18 3.7 677.0419 3 86.30 2 45174 AEV_1_3_RA2_01_1232.d 2.3E5 2 2 77 94 Methylation(KR)
K.GIASSAIP(+13.98)YSR.N Y 32.66 1134.5669 11 -58.9 568.2573 2 72.15 1 35661 AEV 2_3_RA2_01_1224.d 3.03E5 2 2 10 20 Proline oxidation to pyroglutamic acid
R.I(+41.03)LKANGLAPEIPEDLYMLIKK.A Y 31.56 2409.3704 21 -43.3 603.3238 4 84.13 3 51111 AEV_3_3_RA3_01_1233.d 0 1 1 74 94 Amidination of lysines or N-terminal amines with methyl acetimidate
K.GKGIASSAIPYSRNPPSWLK.T Y 29.63 2128.1428 20 9.4 533.0480 4 71.75 2 34153 AEV_1_3_RA2_01_1232.d 9.4E4 1 1 8 27
K.SVGVLP(+31.99)PTWR.Y Y 28.11 1142.6084 10 -28.2 572.2953 2 65.29 2 29459 AEV_1_3_RA2_01_1232.d 3.91E4 1 1 131 140 Dihydroxy
R.ILKAN(+.98)GLAPEIPEDLYMLIKK(+14.02).A Y 28.08 2383.3435 21 7.6 596.8477 4 86.14 2 45072 AEV_1_3_RA2_01_1232.d 7.64E4 1 1 74 94 Deamidation (NQ); Methylation(KR)
K.TTPEQVVDQIC(+57.02)K(+14.02).L Y 28.01 1430.7075 12 -2.3 716.3594 2 72.04 2 34375 AEV_1_3_RA2_01_1232.d 9.3E5 1 1 28 39 Carbamidomethylation; Methylation(KR)
K.TTPEQ(+.98)VVDQ(+.98)IC(+57.02)K.L Y 27.47 1418.6599 12 -63.2 710.2924 2 76.24 1 38848 AEV 2_3_RA2_01_1224.d 6.48E5 3 3 28 39 Deamidation (NQ); Carbamidomethylation
K.GKGIASSAIP(+13.98)YSR.N Y 27.41 1319.6833 13 -51.7 660.8148 2 68.56 1 32936 AEV 2_3_RA2_01_1224.d 5.15E4 1 1 8 20 Proline oxidation to pyroglutamic acid
K.DKDSKFR.L Y 27.27 894.4559 7 -1.8 448.2344 2 9.71 3 2425 AEV_3_3_RA3_01_1233.d 1.38E4 2 2 108 114
K.SVGVLPPTWR(+14.02).Y Y 26.79 1124.6342 10 -5.4 563.3213 2 76.40 3 45260 AEV_3_3_RA3_01_1233.d 0 1 1 131 140 Methylation(KR)
R.N(+42.01)PPSWLK.T Y 25.83 882.4600 7 -0.7 442.2369 2 57.41 3 30519 AEV_3_3_RA3_01_1233.d 1.11E6 1 1 21 27 Acetylation (Protein N-term)
R.LILIESR(+14.02).I Y 25.76 856.5381 7 -16.7 429.2692 2 69.78 3 40061 AEV_3_3_RA3_01_1233.d 7.83E5 6 6 115 121 Methylation(KR)
K.SVGVLPPTWR(+14.02)YESATASTLVA Y 24.85 2218.1633 21 -1.3 1110.0875 2 85.40 3 51973 AEV_3_3_RA3_01_1233.d 4.62E4 1 1 131 151 Methylation(KR)
K.TTPEQVVDQ(+.98)IC(+57.02)K(+14.02).L Y 24.59 1431.6915 12 2.7 716.8550 2 75.88 3 44824 AEV_3_3_RA3_01_1233.d 1.34E5 1 1 28 39 Deamidation (NQ); Carbamidomethylation; Methylation(KR)
K.VVTGNK.I Y 24.35 616.3544 6 -146.4 617.2715 1 67.49 1 32022 AEV 2_3_RA2_01_1224.d 6.76E5 2 2 65 70
R.YYKSVGVLPPTWR.Y Y 24.17 1564.8402 13 -0.3 522.6205 3 71.48 3 41388 AEV_3_3_RA3_01_1233.d 0 2 2 128 140
K.G(+226.08)IASSAIPYSR.N Y 24.15 1346.6653 11 27.0 449.9078 3 56.67 2 23916 AEV_1_3_RA2_01_1232.d 7.69E4 1 1 10 20 Biotinylation
K.AN(+.98)GLAPEIPEDLYMLIKK(+14.02).A Y 23.65 2029.0804 18 11.9 677.3755 3 87.95 2 46169 AEV_1_3_RA2_01_1232.d 5.63E4 1 1 77 94 Deamidation (NQ); Methylation(KR)
R.KHLER.N N 23.22 681.3922 5 1.6 341.7039 2 8.45 3 1997 AEV_3_3_RA3_01_1233.d 1.07E4 2 2 100 104
K.VVT(+79.96)GNK.I Y 22.05 696.3112 6 1.8 697.3198 1 49.77 3 25577 AEV_3_3_RA3_01_1233.d 3.84E4 1 1 65 70 Sulfation
K.VVTGNK(+21.98).I Y 21.28 638.3364 6 -2.9 639.3418 1 81.01 3 48849 AEV_3_3_RA3_01_1233.d 0 1 1 65 70 Sodium adduct
K.SVGVLPP(+31.99)TWR.Y Y 20.83 1142.6084 10 -56.2 572.2794 2 80.79 1 42443 AEV 2_3_RA2_01_1224.d 0 1 1 131 140 Dihydroxy
K.AN(+.98)GLAPEIPEDLYMLIK(+226.08)K.A Y 20.79 2241.1423 18 14.6 561.3010 4 93.54 2 48799 AEV_1_3_RA2_01_1232.d 2.94E4 1 1 77 94 Deamidation (NQ); Biotinylation
R.IHRLSR.Y Y 20.73 780.4718 6 -0.5 391.2430 2 12.83 2 3530 AEV_1_3_RA2_01_1232.d 5.87E4 1 1 122 127
K.VVTGN(+.98)KILR.I Y 20.55 999.6077 9 -1.6 334.2093 3 42.61 2 16764 AEV_1_3_RA2_01_1232.d 8.02E4 1 1 65 73 Deamidation (NQ)
K.GIASS(-18.01)AIPYSR.N Y 20.30 1102.5770 11 -14.9 552.2876 2 24.19 3 10112 AEV_3_3_RA3_01_1233.d 7.22E3 1 1 10 20 Dehydration
MGRLH(+616.18)SKGKGIASSAIPYSR.N Y 19.90 2731.3145 20 52.8 683.8719 4 62.35 3 34230 AEV_3_3_RA3_01_1233.d 0 1 1 1 20 Heme
K.LAKKGATP(+31.99)SQIGVILR.D Y 19.85 1683.0043 16 -16.6 421.7514 4 36.96 3 17561 AEV_3_3_RA3_01_1233.d 0 1 1 40 55 Dihydroxy
K.G(+56.06)IASSAIPYSR.N Y 19.34 1176.6503 11 -24.3 589.3181 2 62.49 3 34338 AEV_3_3_RA3_01_1233.d 0 1 1 10 20 Diethylation
R.YESATAS(-18.01)TLVA Y 18.92 1093.5292 11 -86.6 547.7245 2 64.78 1 30046 AEV 2_3_RA2_01_1224.d 0 1 1 141 151 Dehydration
R.DSHGIAQVK(-.98).V Y 18.77 952.5090 9 -189.9 477.1714 2 33.96 1 11169 AEV 2_3_RA2_01_1224.d 0 1 1 56 64 Amidation
K.GIASSAIPYS(+79.97)R(+14.02).N Y 18.57 1214.5696 11 -19.6 405.8559 3 47.46 1 18756 AEV 2_3_RA2_01_1224.d 3.07E5 1 1 10 20 Phosphorylation (STY); Methylation(KR)
K.DKDSKFR(+14.02).L Y 18.32 908.4716 7 4.3 303.8324 3 13.50 3 4310 AEV_3_3_RA3_01_1233.d 5.84E4 1 1 108 114 Methylation(KR)
K.SVGVLPPT(+79.97)WR.Y Y 18.29 1190.5848 10 13.4 596.3077 2 30.73 3 13811 AEV_3_3_RA3_01_1233.d 2.48E4 1 1 131 140 Phosphorylation (STY)
K.GKGIASSAIPYS(-18.01)R(+14.02).N Y 17.75 1301.7091 13 4.6 434.9123 3 54.11 3 28428 AEV_3_3_RA3_01_1233.d 0 1 1 8 20 Dehydration; Methylation(KR)
R.DSHGIAQVK(+40.03).V Y 17.72 993.5243 9 25.3 332.1904 3 20.31 2 6538 AEV_1_3_RA2_01_1232.d 0 1 1 56 64 Propionaldehyde +40
R.NPPSWLK(+14.02).T Y 17.65 854.4650 7 -91.7 428.2006 2 75.71 1 38434 AEV 2_3_RA2_01_1224.d 1.72E5 1 1 21 27 Methylation(KR)
K.KAVAVRK.H Y 17.36 770.5126 7 -7.6 386.2607 2 8.98 2 2145 AEV_1_3_RA2_01_1232.d 5.81E3 1 1 94 100
R.YESATAST(-18.01)LVA Y 17.36 1093.5292 11 -84.3 365.4863 3 55.08 1 23230 AEV 2_3_RA2_01_1224.d 1.47E5 1 1 141 151 Dehydration
K.V(+43.01)VTGNKILR.I Y 17.33 1041.6294 9 -66.4 348.1940 3 37.90 2 14477 AEV_1_3_RA2_01_1232.d 0 1 1 65 73 Carbamylation
K.GIAS(+79.96)SAIPYSR.N Y 16.36 1200.5444 11 49.1 601.3090 2 65.00 2 29253 AEV_1_3_RA2_01_1232.d 3.28E4 1 1 10 20 Sulfation
K.VVT(+79.97)GN(+.98)KILR.I Y 16.26 1079.5740 9 1.6 360.8658 3 37.82 2 14436 AEV_1_3_RA2_01_1232.d 1.49E5 1 1 65 73 Phosphorylation (STY); Deamidation (NQ)
K.G(+42.01)IASSAIPYSR.N Y 16.14 1162.5981 11 -45.0 582.2802 2 52.82 3 27592 AEV_3_3_RA3_01_1233.d 3.99E4 1 1 10 20 Acetylation (Protein N-term)
K.SVGVLPP(+13.98)TWR.Y Y 16.07 1124.5978 10 -63.0 563.2708 2 82.98 1 44170 AEV 2_3_RA2_01_1224.d 1.25E4 1 1 131 140 Proline oxidation to pyroglutamic acid
K.G(+43.01)IASSAIPYSR.N Y 15.93 1163.5935 11 17.0 388.8784 3 56.39 2 23755 AEV_1_3_RA2_01_1232.d 8.93E5 1 1 10 20 Carbamylation
K.SVGVLPP(+31.99)TWR(+14.02).Y Y 15.82 1156.6240 10 -35.0 579.2991 2 84.30 1 45221 AEV 2_3_RA2_01_1224.d 9.56E4 1 1 131 140 Dihydroxy; Methylation(KR)
R.DSHGIAQVK(+42.01).V Y 15.55 995.5036 9 21.5 332.8489 3 25.83 3 11050 AEV_3_3_RA3_01_1233.d 0 1 1 56 64 Acetylation (K)
R.Y(+42.01)ES(+79.97)ATASTLVA Y 15.09 1233.5166 11 -74.2 1234.4324 1 112.79 1 59569 AEV 2_3_RA2_01_1224.d 2.48E4 1 1 141 151 Acetylation (N-term); Phosphorylation (STY)
K.TTPEQVVDQICK(+42.01).L Y 15.00 1401.6809 12 -4.2 468.2323 3 70.85 1 34598 AEV 2_3_RA2_01_1224.d 5.52E4 1 1 28 39 Acetylation (K)
total 98 peptides
C1GMU5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IVRPDATDAEVKEAVQDPSNQQIFSQALIQSDR.R Y 140.62 3667.8440 33 3.2 917.9713 4 79.05 2 39802 AEV_1_3_RA2_01_1232.d 2.2E5 2 2 165 197
R.GIDDVDGYIEQIKGLYR.R Y 123.82 1952.9843 17 3.7 652.0045 3 84.48 2 43957 AEV_1_3_RA2_01_1232.d 5.56E5 5 5 60 76
R.IDQQAEDVNANMQK.G Y 117.93 1602.7307 14 5.2 535.2536 3 47.03 2 18954 AEV_1_3_RA2_01_1232.d 5.86E5 8 8 246 259
K.EAVQDPSNQQIFSQALIQSDR.R Y 114.36 2373.1560 21 1.9 1187.5875 2 78.40 2 39289 AEV_1_3_RA2_01_1232.d 5.4E5 5 5 177 197
R.GIDDVDGYIEQIK.G Y 105.35 1463.7144 13 0.9 732.8651 2 79.10 2 39840 AEV_1_3_RA2_01_1232.d 7.41E5 5 5 60 72
R.DLLELAQMFQDLDTLVVQQEAAVER.I Y 94.45 2873.4480 25 6.1 958.8292 3 97.95 3 58387 AEV_3_3_RA3_01_1233.d 1.2E4 1 1 221 245
K.Q(-17.03)SPGSGETMNTAQIGKVER.R Y 93.57 1971.9320 19 2.2 986.9755 2 64.75 2 29081 AEV_1_3_RA2_01_1232.d 1.34E5 3 3 117 135 Pyro-glu from Q
R.GIDDVDGYIEQIKGLYRR.L Y 91.10 2109.0854 18 5.3 528.2814 4 81.91 3 49541 AEV_3_3_RA3_01_1233.d 6.39E5 4 4 60 77
R.IDQQAEDVNANM(+15.99)QK.G Y 83.60 1618.7257 14 -0.4 810.3698 2 31.57 3 14314 AEV_3_3_RA3_01_1233.d 5.29E5 8 8 246 259 Oxidation (M)
R.AEADELASETKR.L Y 81.40 1318.6365 12 -1.5 660.3245 2 34.67 3 16179 AEV_3_3_RA3_01_1233.d 1.79E6 10 10 92 103
R.LLSDADPARENAIR.A Y 75.30 1539.8004 14 -1.3 514.2734 3 58.78 3 31504 AEV_3_3_RA3_01_1233.d 6.15E5 5 5 78 91
R.LYQNLIQR.M Y 71.65 1046.5873 8 2.0 524.3019 2 63.45 2 28185 AEV_1_3_RA2_01_1232.d 1.46E6 4 4 104 111
K.Q(-17.03)SPGSGETMNTAQIGK.V Y 70.76 1587.7198 16 3.1 794.8696 2 63.52 2 28240 AEV_1_3_RA2_01_1232.d 1.58E5 2 2 117 132 Pyro-glu from Q
K.GNEEITGAIAK.A Y 67.05 1101.5665 11 3.7 551.7926 2 50.40 2 20646 AEV_1_3_RA2_01_1232.d 1.78E6 5 5 260 270
R.LLSDADPARENAIRAEADELASETKR.L Y 66.44 2840.4263 26 1.3 569.0933 5 75.05 2 36721 AEV_1_3_RA2_01_1232.d 5.02E5 3 3 78 103
R.IVRPDATDAEVK.E Y 66.42 1312.6986 12 2.5 438.5746 3 42.53 3 20982 AEV_3_3_RA3_01_1233.d 1.82E6 8 8 165 176
R.LLSDADPAR.E Y 60.94 956.4927 9 -0.9 479.2532 2 42.95 3 21256 AEV_3_3_RA3_01_1233.d 1.01E6 5 5 78 86
R.LYQNLIQR(+14.02).M Y 59.82 1060.6029 8 2.3 531.3099 2 66.09 2 30019 AEV_1_3_RA2_01_1232.d 2.14E4 1 1 104 111 Methylation(KR)
K.AAITNYQR.V Y 59.65 935.4825 8 3.4 468.7501 2 29.83 2 10691 AEV_1_3_RA2_01_1232.d 1.82E6 7 7 139 146
R.LKAAITNYQR.V Y 58.73 1176.6615 10 -1.5 393.2272 3 40.14 3 19491 AEV_3_3_RA3_01_1233.d 1.1E6 8 8 137 146
K.RLYQNLIQR.M Y 55.57 1202.6884 9 0.2 401.9035 3 59.54 3 32074 AEV_3_3_RA3_01_1233.d 2.35E5 2 2 103 111
K.QSPGSGETM(+15.99)NTAQIGK.V Y 55.40 1620.7413 16 0.9 811.3787 2 32.99 3 15137 AEV_3_3_RA3_01_1233.d 5.76E4 2 2 117 132 Oxidation (M)
K.QSPGSGETMNTAQIGKVER.R Y 53.46 1988.9585 19 0.9 663.9940 3 56.33 3 29746 AEV_3_3_RA3_01_1233.d 8.38E4 2 2 117 135
R.IDQQAEDVNAN(+.98)MQK.G Y 52.68 1603.7147 14 -1.2 802.8636 2 48.91 3 25032 AEV_3_3_RA3_01_1233.d 5.51E4 1 1 246 259 Deamidation (NQ)
K.GLEAQM(+15.99)AR.Q Y 48.06 890.4280 8 -86.1 446.1829 2 28.41 1 8155 AEV 2_3_RA2_01_1224.d 8.19E5 7 7 154 161 Oxidation (M)
R.GIDDVDGYIEQIK(+14.02)GLYR.R Y 46.59 1967.0000 17 0.8 656.6744 3 84.02 3 51037 AEV_3_3_RA3_01_1233.d 1.49E5 1 1 60 76 Methylation(KR)
R.IVRPDATDAEVK(+14.02)EAVQDPSNQQ(+.98)IFSQALIQSDR.R Y 46.44 3682.8438 33 0.6 921.7188 4 79.26 3 47491 AEV_3_3_RA3_01_1233.d 4.22E4 1 1 165 197 Methylation(KR); Deamidation (NQ)
K.EAVQDPSNQ(+.98)Q(+.98)IFSQALIQSDR.R Y 45.27 2375.1240 21 18.7 792.7301 3 78.50 2 39370 AEV_1_3_RA2_01_1232.d 6.89E4 1 1 177 197 Deamidation (NQ)
R.RGDAQKVSQIVR.A Y 43.58 1355.7633 12 9.1 339.9512 4 36.88 2 14013 AEV_1_3_RA2_01_1232.d 2.33E5 2 2 198 209
K.QSPGSGETMNTAQIGK.V Y 43.00 1604.7465 16 12.5 803.3905 2 48.40 3 24692 AEV_3_3_RA3_01_1233.d 9.37E3 1 1 117 132
K.EAVQDPSNQQIFSQ(+.98)ALIQSDR.R Y 38.76 2374.1401 21 3.9 792.3904 3 79.18 2 39909 AEV_1_3_RA2_01_1232.d 0 1 1 177 197 Deamidation (NQ)
K.Q(-17.03)SPGSGETM(+15.99)NTAQIGK.V Y 38.68 1603.7148 16 1.1 802.8656 2 51.54 3 26747 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 117 132 Pyro-glu from Q; Oxidation (M)
R.IDQQAEDVNANM(+15.99)Q(+.98)K.G Y 38.63 1619.7097 14 1.3 810.8632 2 34.16 3 15812 AEV_3_3_RA3_01_1233.d 1E5 1 1 246 259 Oxidation (M); Deamidation (NQ)
K.AIKQSPGSGETMNTAQIGK.V Y 37.16 1916.9625 19 7.0 639.9993 3 47.69 3 24254 AEV_3_3_RA3_01_1233.d 3.99E4 1 1 114 132
R.DLLELAQMFQD(+55.92)LDTLVVQQEAAVER.I Y 37.11 2929.3677 25 30.1 733.3712 4 93.21 3 56414 AEV_3_3_RA3_01_1233.d 1.69E4 1 1 221 245 Replacement of 2 protons by nickel
R.HAILNQC(+57.02)R.D Y 36.51 1010.5080 8 -3.0 506.2598 2 23.69 2 7958 AEV_1_3_RA2_01_1232.d 4.04E5 5 5 48 55 Carbamidomethylation
K.EAVQDPSNQQIFSQALIQSDR(+14.02).R Y 33.21 2387.1716 21 -7.6 796.7251 3 80.50 2 40955 AEV_1_3_RA2_01_1232.d 9.94E4 1 1 177 197 Methylation(KR)
R.AEADELASETK(+14.02)R.L Y 32.78 1332.6521 12 -45.7 667.3029 2 48.91 2 19899 AEV_1_3_RA2_01_1232.d 8.49E4 2 2 92 103 Methylation(KR)
R.RGDAQKVS(+79.97)Q(+.98)IVR.A Y 29.54 1436.7136 12 105.8 360.2237 4 36.98 2 14011 AEV_1_3_RA2_01_1232.d 0 1 1 198 209 Phosphorylation (STY); Deamidation (NQ)
R.LLSDADPAR(+.98)ENAIR.A Y 29.30 1540.7844 14 11.6 514.6080 3 58.91 3 31602 AEV_3_3_RA3_01_1233.d 8.05E4 1 1 78 91 Deamidation (R)
K.EAVQ(+.98)DPSNQQIFSQALIQSDR.R Y 28.63 2374.1401 21 0.2 792.3875 3 79.45 3 47638 AEV_3_3_RA3_01_1233.d 9.61E4 1 1 177 197 Deamidation (NQ)
R.IDQQAEDVNANMQK(+14.02).G Y 28.53 1616.7465 14 6.5 539.9263 3 55.29 2 23157 AEV_1_3_RA2_01_1232.d 2.75E4 2 2 246 259 Methylation(KR)
R.IVRPDATDAE(+14.02)VK.E Y 27.77 1326.7142 12 1.8 664.3656 2 52.23 2 21586 AEV_1_3_RA2_01_1232.d 1.09E4 2 2 165 176 Methylation(others)
R.VQSDFRK.G Y 27.73 878.4610 7 2.8 440.2390 2 13.82 3 4478 AEV_3_3_RA3_01_1233.d 7.87E4 1 1 147 153
R.DLLELAQMFQDLD(+14.02)TLVVQQEAAVER.I Y 27.63 2887.4636 25 15.3 963.5099 3 97.77 3 58330 AEV_3_3_RA3_01_1233.d 0 1 1 221 245 Methylation(others)
R.AEADELASETK.R Y 27.21 1162.5353 11 -74.3 582.2318 2 47.05 1 18504 AEV 2_3_RA2_01_1224.d 2.09E5 3 3 92 102
R.ARHDEILKIER.D Y 26.95 1378.7681 11 -0.6 345.6991 4 40.68 3 19813 AEV_3_3_RA3_01_1233.d 2.5E5 1 1 210 220
R.IDQQAEDVN(+.98)ANMQ(+.98)K.G Y 26.63 1604.6989 14 26.2 803.3777 2 49.94 2 20412 AEV_1_3_RA2_01_1232.d 3.73E4 1 1 246 259 Deamidation (NQ)
K.GLEAQMAR(-.98).Q Y 26.57 873.4490 8 -17.8 874.4407 1 94.72 2 49239 AEV_1_3_RA2_01_1232.d 6.43E4 1 1 154 161 Amidation
R.LLSDAD(+43.99)PAR.E Y 24.91 1000.4825 9 -49.1 501.2239 2 31.56 1 9841 AEV 2_3_RA2_01_1224.d 9.65E4 2 2 78 86 Carboxylation (DKW)
K.AAITN(-17.03)YQRVQSDFR.K Y 24.71 1650.8114 14 -9.7 826.4050 2 69.12 2 32192 AEV_1_3_RA2_01_1232.d 8.01E4 1 1 139 152 Ammonia-loss (N)
K.GLEAQM(+15.99)ARQYR.I Y 24.21 1337.6510 11 -25.4 669.8158 2 57.55 1 24778 AEV 2_3_RA2_01_1224.d 2.32E4 1 1 154 164 Oxidation (M)
R.IDQ(+.98)Q(+.98)AEDVNANMQK.G Y 24.00 1604.6989 14 -57.3 803.3107 2 28.12 1 8000 AEV 2_3_RA2_01_1224.d 5.56E4 1 1 246 259 Deamidation (NQ)
R.IDQQAEDVN(+.98)AN(+.98)MQK.G Y 23.99 1604.6989 14 -22.3 803.3388 2 84.67 1 45519 AEV 2_3_RA2_01_1224.d 0 1 1 246 259 Deamidation (NQ)
R.LYQNLIQ(+.98)R.M Y 23.63 1047.5713 8 -2.7 524.7915 2 63.91 3 35435 AEV_3_3_RA3_01_1233.d 2.12E5 2 2 104 111 Deamidation (NQ)
K.AAITNYQ(+.98)R.V Y 23.15 936.4665 8 -85.9 469.2003 2 46.43 1 18172 AEV 2_3_RA2_01_1224.d 2.77E5 1 1 139 146 Deamidation (NQ)
K.GN(+.98)EEITGAIAK.A Y 22.66 1102.5505 11 -111.5 552.2211 2 60.72 1 27015 AEV 2_3_RA2_01_1224.d 0 1 1 260 270 Deamidation (NQ)
R.RLLSDADPARENAIR(+14.02).A Y 22.52 1709.9172 15 39.2 343.0041 5 72.68 3 42336 AEV_3_3_RA3_01_1233.d 4.57E4 1 1 77 91 Methylation(KR)
R.K(+42.01)(+43.99)GLEAQMAR.Q Y 21.73 1088.5284 9 -28.2 545.2562 2 70.33 1 34215 AEV 2_3_RA2_01_1224.d 8.77E4 1 1 153 161 Acetylation (N-term); Carboxylation (DKW)
R.IVRPDATDAE(+43.99)VK.E Y 21.62 1356.6885 12 14.0 453.2431 3 42.68 3 21083 AEV_3_3_RA3_01_1233.d 0 1 1 165 176 Carboxylation (E)
R.GIDDVDGYIE(+14.02)QIKGLYRR.L Y 21.36 2123.1011 18 -2.1 531.7814 4 81.47 3 49208 AEV_3_3_RA3_01_1233.d 1.68E5 1 1 60 77 Methylation(others)
K.VSQIVR.A Y 20.45 700.4232 6 -102.9 351.1828 2 34.47 1 11510 AEV 2_3_RA2_01_1224.d 4.96E5 2 2 204 209
R.AEADELAS(+79.97)E(+21.98)TK.R Y 20.23 1264.4836 11 19.4 633.2614 2 77.63 1 39959 AEV 2_3_RA2_01_1224.d 7.55E4 1 1 92 102 Phosphorylation (STY); Sodium adduct
K.G(+42.01)LEAQ(+.98)MAR.Q Y 20.08 917.4277 8 27.9 918.4606 1 98.75 3 58646 AEV_3_3_RA3_01_1233.d 9.44E3 1 1 154 161 Acetylation (N-term); Deamidation (NQ)
R.AEADELASETKRLYQNLIQR.M Y 19.84 2347.2131 20 18.3 587.8213 4 81.95 2 42088 AEV_1_3_RA2_01_1232.d 0 1 1 92 111
R.VQSDFRK(+14.02).G Y 19.39 892.4766 7 14.7 447.2522 2 20.39 2 6571 AEV_1_3_RA2_01_1232.d 3.69E4 2 2 147 153 Methylation(KR)
R.DIERGIDDVDGY(-2.02)IEQIK.G Y 19.18 1974.9534 17 21.7 659.3394 3 81.22 3 49001 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 56 72 2-amino-3-oxo-butanoic_acid
K.Q(+.98)SPGSGETMN(+.98)T(+79.97)AQIGK.V Y 19.13 1686.6808 16 -10.7 844.3386 2 88.24 1 48295 AEV 2_3_RA2_01_1224.d 5.18E4 1 1 117 132 Deamidation (NQ); Phosphorylation (STY)
K.QS(-20.03)PGSGETMNTAQIGKVER.R Y 18.89 1968.9324 19 39.8 657.3442 3 64.72 2 29063 AEV_1_3_RA2_01_1232.d 0 1 1 117 135 Formation of five membered aromatic heterocycle
K.GNEEITGAIAKARAR.N Y 18.10 1555.8430 15 9.0 312.1787 5 51.58 3 26771 AEV_3_3_RA3_01_1233.d 0 1 1 260 274
R.VQ(+.98)S(+79.97)DFR.K Y 18.02 831.3163 6 13.1 832.3345 1 112.95 2 54554 AEV_1_3_RA2_01_1232.d 0 1 1 147 152 Deamidation (NQ); Phosphorylation (STY)
R.LYQNLIQRM(+15.99)K.A Y 17.85 1321.7177 10 -89.4 661.8070 2 88.53 1 48516 AEV 2_3_RA2_01_1224.d 4.4E5 1 1 104 113 Oxidation (M)
R.LK(+43.99)AAITNYQR.V Y 17.46 1220.6514 10 3.4 306.1711 4 14.98 2 4331 AEV_1_3_RA2_01_1232.d 0 1 1 137 146 Carboxylation (DKW)
R.L(+43.01)LSDADPAR.E Y 17.45 999.4985 9 -33.6 334.1622 3 45.70 1 17674 AEV 2_3_RA2_01_1224.d 4.13E4 2 2 78 86 Carbamylation
R.GIDDVDGYIEQ(+.98)IKGLY(+79.97)RR.L Y 17.26 2190.0356 18 -11.7 731.0106 3 82.28 1 43617 AEV 2_3_RA2_01_1224.d 0 1 1 60 77 Deamidation (NQ); Phosphorylation (STY)
R.AEADELASET(+79.97)KR.L Y 17.04 1398.6028 12 -27.7 700.2893 2 89.97 1 49594 AEV 2_3_RA2_01_1224.d 0 1 1 92 103 Phosphorylation (STY)
R.A(+42.01)EADELASETK(+21.98).R Y 17.03 1226.5278 11 -13.6 614.2629 2 50.52 1 20506 AEV 2_3_RA2_01_1224.d 1.11E5 1 1 92 102 Acetylation (N-term); Sodium adduct
K.GNEE(+14.02)ITGAIAK.A Y 16.91 1115.5823 11 -99.9 558.7427 2 64.69 1 29997 AEV 2_3_RA2_01_1224.d 8.4E4 1 1 260 270 Methylation(others)
R.GDAQ(+.98)K.V Y 16.79 518.2336 5 -84.6 519.1971 1 24.26 1 6232 AEV 2_3_RA2_01_1224.d 5.67E4 1 1 199 203 Deamidation (NQ)
K.EAVQDPSNQ(+.98)QIFSQALIQSDR(+14.02).R Y 16.71 2388.1558 21 15.0 797.0711 3 79.07 3 47354 AEV_3_3_RA3_01_1233.d 7.67E4 1 1 177 197 Deamidation (NQ); Methylation(KR)
R.AEADELASET(+79.97)K(+14.02).R Y 16.50 1256.5173 11 -35.5 629.2437 2 37.63 1 13075 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 92 102 Phosphorylation (STY); Methylation(KR)
K.GLE(+43.99)AQM(+15.99)AR.Q Y 16.15 934.4178 8 109.3 935.5272 1 100.39 1 55831 AEV 2_3_RA2_01_1224.d 0 1 1 154 161 Carboxylation (E); Oxidation (M)
R.L(+42.01)LSDADPAREN(+.98)AIR.A Y 16.09 1582.7950 14 -19.1 792.3896 2 83.79 2 43468 AEV_1_3_RA2_01_1232.d 1.85E4 1 1 78 91 Acetylation (N-term); Deamidation (NQ)
K.GLEAQM(+31.99)AR.Q Y 15.78 906.4229 8 25.8 907.4536 1 92.60 3 56110 AEV_3_3_RA3_01_1233.d 1.15E4 1 1 154 161 Sulphone
R.R(+42.01)LLSDADPAR(+28.03).E Y 15.63 1182.6356 10 0.8 395.2195 3 62.41 3 34283 AEV_3_3_RA3_01_1233.d 0 1 1 77 86 Acetylation (N-term); Dimethylation(KR)
R.A(+42.01)EADELAS(-18.01)ETK.R Y 15.60 1186.5353 11 -74.5 594.2307 2 29.66 1 8799 AEV 2_3_RA2_01_1224.d 0 1 1 92 102 Acetylation (N-term); Dehydration
K.GLEAQMAR.Q Y 15.60 874.4330 8 -2.9 438.2225 2 33.10 3 15209 AEV_3_3_RA3_01_1233.d 3.05E4 1 1 154 161
R.IVR(+.98)PDATDAEVK.E Y 15.56 1313.6826 12 -41.0 438.8835 3 15.26 2 4444 AEV_1_3_RA2_01_1232.d 4.55E4 1 1 165 176 Deamidation (R)
R.L(+42.01)LSDADPAR.E Y 15.54 998.5032 9 3.6 500.2607 2 36.43 3 17206 AEV_3_3_RA3_01_1233.d 2.09E5 1 1 78 86 Acetylation (N-term)
K.Q(-17.03)SPGSGETM(+15.99)NTAQIGKVERR.L Y 15.40 2144.0281 20 -2.0 715.6819 3 50.99 3 26366 AEV_3_3_RA3_01_1233.d 6.16E4 1 1 117 136 Pyro-glu from Q; Oxidation (M)
R.LLVM(+15.99)GYVQSGGDR.H Y 15.01 1409.6973 13 -77.4 353.4043 4 67.19 1 31786 AEV 2_3_RA2_01_1224.d 6.94E5 1 1 35 47 Oxidation (M)
total 91 peptides
C1G3T9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.TLSDYNIQKESTLHLVLR.L N 168.41 2129.1479 18 4.3 533.2966 4 75.46 2 36962 AEV_1_3_RA2_01_1232.d 2.53E6 8 8 65 82
K.TITLEVESSDTIDNVKSK.I N 129.56 1978.0106 18 12.0 660.3521 3 69.30 2 32324 AEV_1_3_RA2_01_1232.d 5.02E5 3 3 98 115
K.TITLEVESSDTIDNVK.S N 124.08 1762.8837 16 3.3 588.6371 3 74.72 2 36475 AEV_1_3_RA2_01_1232.d 1.58E6 11 11 98 113
K.Q(-17.03)LEDGRTLSDYNIQKESTLHLVLR.L N 112.34 2810.4563 24 0.4 703.6216 4 79.31 3 47526 AEV_3_3_RA3_01_1233.d 2.79E5 2 2 59 82 Pyro-glu from Q
K.IQDKEGIPPDQQR.L N 98.11 1522.7739 13 1.5 762.3954 2 34.87 3 16294 AEV_3_3_RA3_01_1233.d 1.15E7 76 76 40 52
K.TLTGKTITLEVESSDTIDNVK.S N 92.12 2263.1794 21 -11.3 755.3919 3 75.31 2 36909 AEV_1_3_RA2_01_1232.d 0 1 1 93 113
K.TITLEVESVDTIDSVK.S Y 86.14 1747.9091 16 -2.0 874.9600 2 79.61 3 47771 AEV_3_3_RA3_01_1233.d 2.45E5 3 3 22 37
K.ESTLHLVLR.L N 84.33 1066.6135 9 -1.4 534.3133 2 63.71 3 35290 AEV_3_3_RA3_01_1233.d 1.35E6 7 7 74 82
R.TLSDYNIQK.E N 73.35 1080.5452 9 3.1 541.2816 2 51.60 2 21255 AEV_1_3_RA2_01_1232.d 2.25E6 9 9 65 73
K.SKIQDKEGIPPDQQR.L N 72.68 1737.9009 15 -0.3 580.3074 3 29.55 3 13140 AEV_3_3_RA3_01_1233.d 5.57E6 26 26 38 52
R.TLSDYNIQK(+14.02)ESTLHLVLR.L N 69.11 2143.1636 18 5.1 536.8009 4 77.62 2 38667 AEV_1_3_RA2_01_1232.d 1.32E5 1 1 65 82 Methylation(KR)
K.Q(-17.03)LEDGRTLSDYN(+.98)IQKESTLHLVLR.L N 66.52 2811.4402 24 10.2 703.8745 4 79.63 2 40272 AEV_1_3_RA2_01_1232.d 2E4 1 1 59 82 Pyro-glu from Q; Deamidation (NQ)
K.Q(-17.03)LEDGRTLSDYNIQK.E N 63.55 1761.8533 15 3.2 881.9368 2 71.84 3 41677 AEV_3_3_RA3_01_1233.d 2.53E5 3 3 59 73 Pyro-glu from Q
K.EGIPPDQQR.L N 57.93 1038.5094 9 4.7 520.2644 2 28.63 2 10098 AEV_1_3_RA2_01_1232.d 1.55E6 32 32 44 52
K.IQDK(+14.02)EGIPPDQQR.L N 55.85 1536.7896 13 3.3 513.2722 3 44.97 2 17919 AEV_1_3_RA2_01_1232.d 1.79E6 15 15 40 52 Methylation(KR)
R.LIFAGKQLEDGR.T N 54.40 1345.7354 12 -3.6 449.5841 3 63.99 3 35493 AEV_3_3_RA3_01_1233.d 3.09E5 4 4 53 64
MQIFVK.T N 52.37 764.4255 6 -2.4 383.2191 2 61.08 3 33246 AEV_3_3_RA3_01_1233.d 1.59E6 4 4 1 6
K.IQDKEGIPPDQ(+.98)QR.L N 51.40 1523.7579 13 12.7 508.9330 3 34.43 3 15994 AEV_3_3_RA3_01_1233.d 5.63E6 14 14 40 52 Deamidation (NQ)
R.LRGGH Y 50.36 538.2975 5 28.7 539.3203 1 96.97 2 50008 AEV_1_3_RA2_01_1232.d 1.51E5 2 2 311 315
K.TITLEVES(+14.02)SDTIDNVK.S N 49.05 1776.8993 16 -2.9 889.4543 2 77.31 3 45956 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 98 113 Methylation(others)
R.TLSDYNIQKESTLHLVLR(+14.02).L N 47.10 2143.1636 18 0.8 536.7986 4 76.77 2 37995 AEV_1_3_RA2_01_1232.d 8.35E4 1 1 65 82 Methylation(KR)
K.IQDKEGIPPDQQR(+14.02).L N 46.75 1536.7896 13 -1.1 513.2699 3 41.44 3 20328 AEV_3_3_RA3_01_1233.d 2.56E6 10 10 40 52 Methylation(KR)
M(+15.99)QIFVK.T N 44.72 780.4204 6 -3.0 391.2163 2 41.32 3 20205 AEV_3_3_RA3_01_1233.d 9.86E5 6 6 1 6 Oxidation (M)
K.IQD(+14.02)KEGIPPDQQR.L N 39.36 1536.7896 13 -7.4 513.2667 3 46.75 3 23658 AEV_3_3_RA3_01_1233.d 0 2 2 40 52 Methylation(others)
R.LIFAGK.Q N 39.20 647.4006 6 -10.6 648.4011 1 50.93 3 26322 AEV_3_3_RA3_01_1233.d 6.06E6 5 5 53 58
K.E(-18.01)GIPPDQQR.L N 38.97 1020.4988 9 31.1 511.2726 2 33.77 2 12486 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 44 52 Pyro-glu from E
K.IQDKEGIPPDQQ(+.98)R.L N 38.89 1523.7579 13 11.4 508.9324 3 39.27 3 18953 AEV_3_3_RA3_01_1233.d 3.46E6 4 4 40 52 Deamidation (NQ)
K.IQ(+.98)DKEGIPPDQQR.L N 34.63 1523.7579 13 15.3 508.9344 3 38.27 2 14644 AEV_1_3_RA2_01_1232.d 7.43E5 2 2 40 52 Deamidation (NQ)
K.IQDKE(+14.02)GIPPDQQR.L N 32.53 1536.7896 13 -11.9 513.2643 3 47.20 2 19035 AEV_1_3_RA2_01_1232.d 5.4E5 3 3 40 52 Methylation(others)
K.TITLEVESSDTIDNVK(+214.97).S N 32.15 1977.8547 16 -11.7 989.9230 2 75.43 1 38220 AEV 2_3_RA2_01_1224.d 2.5E4 1 1 98 113 4-sulfophenyl isothiocyanate
R.LIFAGK(+383.23)QLEDGR.T N 32.08 1728.9634 12 -4.3 577.3259 3 64.31 3 35736 AEV_3_3_RA3_01_1233.d 2.91E4 1 1 53 64 Ubiquitination
K.TITLE(+6.01)VESSDTIDNVKSK.I N 31.05 1984.0188 18 -45.0 662.3171 3 68.87 3 39354 AEV_3_3_RA3_01_1233.d 2.47E4 1 1 98 115 Replacement of proton by lithium
K.ES(+59.02)TLHLVLR.L N 31.03 1125.6328 9 -42.3 563.7999 2 75.47 3 44495 AEV_3_3_RA3_01_1233.d 0 1 1 74 82 Aminoethylcysteine
R.TLSDYNIQKE(+14.02)STLHLVLR.L N 30.63 2143.1636 18 -4.4 536.7958 4 77.19 3 45851 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 65 82 Methylation(others)
R.LIFAGK(+14.02).Q N 30.36 661.4163 6 -101.8 662.3562 1 71.24 1 34908 AEV 2_3_RA2_01_1224.d 3.77E5 4 4 53 58 Methylation(KR)
K.TITLEVESVDTIDSVKSK.I Y 30.22 1963.0361 18 -15.6 655.3425 3 77.00 3 45747 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 22 39
K.IQD(-18.01)K(+14.02)EGIPPDQQR.L N 30.05 1518.7791 13 -30.9 507.2513 3 34.44 3 15998 AEV_3_3_RA3_01_1233.d 5.97E4 3 3 40 52 Dehydration; Methylation(KR)
K.TITLEVESSDTIDNVK(-.98).S N 27.99 1761.8997 16 18.1 588.3178 3 74.63 2 36340 AEV_1_3_RA2_01_1232.d 1.16E5 1 1 98 113 Amidation
R.T(-18.01)LSDYNIQK(+14.02)ESTLHLVLR.L N 27.42 2125.1531 18 -11.4 532.2895 4 75.58 2 37059 AEV_1_3_RA2_01_1232.d 0 1 1 65 82 Dehydration; Methylation(KR)
K.QLEDGRT(-2.02)LSDYNIQKESTLHLVLR.L N 26.77 2825.4670 24 -24.9 566.0866 5 75.48 3 44506 AEV_3_3_RA3_01_1233.d 0 1 1 59 82 2-amino-3-oxo-butanoic_acid
K.E(+41.03)STLHLVLR.L N 25.34 1107.6400 9 -15.5 370.2149 3 63.95 3 35461 AEV_3_3_RA3_01_1233.d 0 1 1 74 82 Amidination of lysines or N-terminal amines with methyl acetimidate
K.Q(-17.03)LEDGR.T N 24.76 699.3187 6 -88.0 700.2645 1 36.99 1 12732 AEV 2_3_RA2_01_1224.d 5.68E5 2 2 59 64 Pyro-glu from Q
K.TITLEVESSDTIDNVK(+14.02).S N 24.01 1776.8993 16 1.8 889.4586 2 77.63 2 38679 AEV_1_3_RA2_01_1232.d 2.34E4 1 1 98 113 Methylation(KR)
R.TLS(+79.97)DY(+31.99)NIQKESTLHLVLR.L N 23.33 2241.1042 18 25.4 561.2975 4 75.38 3 44421 AEV_3_3_RA3_01_1233.d 7.3E4 1 1 65 82 Phosphorylation (STY); Dihydroxy
K.TITLEVESSDTIDNVK(+229.01).S N 22.97 1991.8976 16 -29.8 664.9534 3 77.44 1 39804 AEV 2_3_RA2_01_1224.d 4.39E4 1 1 98 113 Pyridoxal phosphate
R.TLS(-18.01)DYNIQ(+.98)KESTLHLVLR.L N 22.64 2112.1216 18 -24.1 705.0308 3 79.31 3 47529 AEV_3_3_RA3_01_1233.d 6.6E4 1 1 65 82 Dehydration; Deamidation (NQ)
K.SKIQDK(-1.03)EGIPPDQQR.L N 21.71 1736.8693 15 -18.6 435.2165 4 30.29 3 13554 AEV_3_3_RA3_01_1233.d 0 1 1 38 52 Lysine oxidation to aminoadipic semialdehyde
K.TLTGK(-1.03)TITLEVESSDTIDNVK.S N 21.30 2262.1477 21 9.8 755.0639 3 80.46 2 40927 AEV_1_3_RA2_01_1232.d 0 1 1 93 113 Lysine oxidation to aminoadipic semialdehyde
R.ITDQPSAAVTGK(-.98).T Y 21.12 1185.6354 12 4.1 396.2207 3 38.29 2 14658 AEV_1_3_RA2_01_1232.d 1.1E5 1 1 10 21 Amidation
K.TITLEVES(-18.01)SDTIDNVK.S N 21.12 1744.8730 16 3.3 873.4467 2 83.15 2 42987 AEV_1_3_RA2_01_1232.d 1.43E5 1 1 98 113 Dehydration
K.TLT(+79.97)GK(+42.01).T N 20.73 640.2833 5 -31.0 641.2708 1 85.30 1 46025 AEV 2_3_RA2_01_1224.d 5.18E4 1 1 93 97 Phosphorylation (STY); Acetylation (K)
R.LRGGM(+15.99)QIFVK.T Y 20.13 1163.6484 10 -1.4 388.8896 3 43.43 2 17172 AEV_1_3_RA2_01_1232.d 0 1 1 83 92 Oxidation (M)
K.IQD(+21.98)KEGIPPDQQR.L N 19.88 1544.7559 13 60.3 387.2195 4 46.78 2 18824 AEV_1_3_RA2_01_1232.d 0 1 1 40 52 Sodium adduct
K.TITLEVES(+14.02)SDTIDNVKSK.I N 19.45 1992.0262 18 27.0 665.0339 3 71.20 2 33740 AEV_1_3_RA2_01_1232.d 0 1 1 98 115 Methylation(others)
K.T(+43.01)LTGK(+42.01).T N 19.31 603.3228 5 -123.9 604.2552 1 90.63 1 50080 AEV 2_3_RA2_01_1224.d 2.03E4 1 1 93 97 Carbamylation; Acetylation (K)
MQIFVK(+14.02).T N 19.23 778.4411 6 -94.5 390.1910 2 77.51 1 39863 AEV 2_3_RA2_01_1224.d 5.9E4 1 1 1 6 Methylation(KR)
K.EGIPPDQQRLIFAGKQLEDGR.T N 18.79 2366.2341 21 -0.8 789.7513 3 93.19 3 56405 AEV_3_3_RA3_01_1233.d 8.31E4 1 1 44 64
K.Q(+.98)LED(-18.01)GR.T N 18.70 699.3187 6 -0.6 700.3256 1 32.32 2 11793 AEV_1_3_RA2_01_1232.d 2.3E5 2 2 59 64 Deamidation (NQ); Dehydration
K.QLED(-18.01)GR.T N 18.21 698.3347 6 -79.1 699.2867 1 91.61 1 50790 AEV 2_3_RA2_01_1224.d 3.77E4 1 1 59 64 Dehydration
K.IQDK(+31.99)EGIPPDQQR.L N 17.09 1554.7638 13 -97.6 519.2113 3 32.91 1 10600 AEV 2_3_RA2_01_1224.d 1.11E5 1 1 40 52 Dihydroxy
K.QLEDGRTLSDYN(+162.05)IQK.E N 16.98 1940.9326 15 25.6 389.2037 5 16.29 3 5828 AEV_3_3_RA3_01_1233.d 1.44E4 1 1 59 73 Hexose (NSY)
R.LR(+14.02)GGH Y 16.97 552.3132 5 6.7 553.3242 1 57.00 2 24112 AEV_1_3_RA2_01_1232.d 0 1 1 311 315 Methylation(KR)
K.SK(+27.99)IQDK.E N 16.81 745.3970 6 -18.8 746.3902 1 86.72 2 45442 AEV_1_3_RA2_01_1232.d 3.74E5 1 1 38 43 Formylation
K.T(+42.01)ITLEVESSDTIDNVKS(+79.97)K.I N 16.35 2099.9875 18 -72.0 700.9528 3 86.08 1 46633 AEV 2_3_RA2_01_1224.d 3.81E3 1 1 98 115 Acetylation (N-term); Phosphorylation (STY)
R.ITDQPSAAVTGK.T Y 16.23 1186.6194 12 -17.7 594.3065 2 77.13 3 45801 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 10 21
K.T(+42.01)(-18.01)ITLEVESSDTIDNVK.S N 16.07 1786.8837 16 41.7 596.6600 3 79.02 3 47305 AEV_3_3_RA3_01_1233.d 4.97E4 1 1 98 113 Acetylation (N-term); Dehydration
R.IT(+79.97)DQPSAAVTGK.T Y 15.61 1266.5857 12 20.9 634.3134 2 29.57 2 10516 AEV_1_3_RA2_01_1232.d 0 1 1 10 21 Phosphorylation (STY)
R.TLSDYNIQK(+42.01).E N 15.56 1122.5557 9 -91.6 562.2337 2 48.63 1 19436 AEV 2_3_RA2_01_1224.d 3.78E4 1 1 65 73 Acetylation (K)
K.TITLEVESVDTIDS(+162.05)VK(+14.02).S Y 15.42 1923.9775 16 -8.2 642.3279 3 83.78 3 50860 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 22 37 Hexose (NSY); Methylation(KR)
R.L(+108.00)IFAGKQLEDGR.T N 15.35 1453.7329 12 -7.6 485.5812 3 65.29 3 36506 AEV_3_3_RA3_01_1233.d 9.49E4 1 1 53 64 O-Ethylphosphorylation
R.ITDQPSAAVTGK(+43.01).T Y 15.06 1229.6251 12 -0.9 615.8193 2 59.65 3 32159 AEV_3_3_RA3_01_1233.d 7.19E4 1 1 10 21 Carbamylation
total 71 peptides
C1GB47
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.ASLVLIPNDVDPIELVVFLPALC(+57.02)R.K Y 128.95 2662.4768 24 3.0 1332.2496 2 97.66 2 50258 AEV_1_3_RA2_01_1232.d 1.81E5 4 4 139 162 Carbamidomethylation
K.YGLNHVVGLIENKK.A Y 115.88 1582.8831 14 5.6 528.6379 3 70.56 2 33268 AEV_1_3_RA2_01_1232.d 2.81E6 7 7 125 138
K.KASLVLIPNDVDPIELVVFLPALC(+57.02)RK.M Y 113.87 2918.6667 26 2.8 730.6760 4 92.27 2 48281 AEV_1_3_RA2_01_1232.d 2.53E5 2 2 138 163 Carbamidomethylation
K.KASLVLIPNDVDPIELVVFLPALC(+57.02)R.K Y 111.40 2790.5718 25 -0.8 931.1971 3 95.39 3 57395 AEV_3_3_RA3_01_1233.d 8.15E5 5 5 138 162 Carbamidomethylation
K.YGLNHVVGLIENK.K Y 104.66 1454.7881 13 2.4 485.9378 3 75.10 2 36692 AEV_1_3_RA2_01_1232.d 1.74E6 9 9 125 137
K.LISAIKEGYSDKYEESKR.H Y 99.37 2115.0847 18 -1.6 529.7776 4 55.56 3 29262 AEV_3_3_RA3_01_1233.d 3.54E5 2 2 205 222
K.EGYSDKYEESKR.H Y 82.70 1489.6685 12 2.9 497.5649 3 19.85 3 7752 AEV_3_3_RA3_01_1233.d 1.33E6 7 7 211 222
R.LLKEASAIEAGK.K Y 81.48 1228.7026 12 -0.7 410.5746 3 51.56 3 26756 AEV_3_3_RA3_01_1233.d 2.99E6 8 8 100 111
R.NFGIGQDIQPK.R Y 81.26 1215.6248 11 3.2 608.8216 2 66.96 2 30620 AEV_1_3_RA2_01_1232.d 4.19E6 10 10 39 49
K.ASLVLIPNDVDPIELVVFLPALC(+57.02)RK.M Y 79.08 2790.5718 25 0.8 698.6508 4 95.61 3 57481 AEV_3_3_RA3_01_1233.d 5.83E5 3 3 139 163 Carbamidomethylation
K.TAAVLALTEVRSEDKTELSK.L Y 77.48 2160.1638 20 -0.7 721.0614 3 69.10 3 39540 AEV_3_3_RA3_01_1233.d 5.49E5 5 5 185 204
K.TAAVLALTEVR.S Y 74.93 1142.6659 11 -0.9 572.3397 2 73.51 3 42990 AEV_3_3_RA3_01_1233.d 1.64E6 4 4 185 195
R.NFGIGQDIQPKR.N Y 74.65 1371.7258 12 -2.4 458.2481 3 60.54 3 32825 AEV_3_3_RA3_01_1233.d 1.4E6 7 7 39 50
R.NFGIGQDIQ(+.98)PK.R Y 69.33 1216.6088 11 -1.5 609.3107 2 68.43 3 39063 AEV_3_3_RA3_01_1233.d 5.33E5 3 3 39 49 Deamidation (NQ)
K.KKEDVSKKPYAVK.Y Y 68.48 1518.8770 13 1.2 760.4467 2 13.88 3 4513 AEV_3_3_RA3_01_1233.d 3.42E5 4 4 112 124
R.HWGGGIM(+15.99)GAK.A Y 67.85 1028.4862 10 7.2 515.2541 2 30.78 3 13835 AEV_3_3_RA3_01_1233.d 2.7E5 3 3 223 232 Oxidation (M)
K.LISAIKEGYSDKYEESK.R Y 67.70 1958.9836 17 4.5 490.7554 4 59.16 3 31799 AEV_3_3_RA3_01_1233.d 7.76E4 3 3 205 221
K.EASAIEAGK.K Y 61.30 874.4396 9 -86.6 438.1892 2 25.98 1 6974 AEV 2_3_RA2_01_1224.d 9.42E5 9 9 103 111
R.NFGIGQ(+.98)DIQPK.R Y 59.53 1216.6088 11 -2.4 609.3102 2 67.99 3 38706 AEV_3_3_RA3_01_1233.d 2.17E5 2 2 39 49 Deamidation (NQ)
K.ASLVLIPNDVDPIE(+14.02)LVVFLPALC(+57.02)R.K Y 58.93 2676.4924 24 2.6 893.1738 3 97.68 2 50265 AEV_1_3_RA2_01_1232.d 5.74E4 3 3 139 162 Methylation(others); Carbamidomethylation
R.NTAAQAFK.L Y 58.65 849.4344 8 1.4 425.7251 2 21.51 3 8655 AEV_3_3_RA3_01_1233.d 2.57E6 9 9 76 83
K.MGVPYAIIK.G Y 58.17 990.5572 9 -3.7 496.2840 2 73.41 3 42906 AEV_3_3_RA3_01_1233.d 7.7E5 4 4 164 172
R.HWGGGIMGAK.A Y 57.27 1012.4913 10 7.0 338.5067 3 53.74 2 22361 AEV_1_3_RA2_01_1232.d 2.61E5 5 5 223 232
K.ASENAIKL Y 57.26 844.4654 8 2.6 423.2411 2 50.94 2 20918 AEV_1_3_RA2_01_1232.d 2.37E6 7 7 243 250
R.LGTVVHKK.T Y 55.58 880.5494 8 -6.5 441.2791 2 11.89 3 3447 AEV_3_3_RA3_01_1233.d 4.36E5 4 4 177 184
R.NFGIGQDIQPK(+14.02).R Y 55.24 1229.6404 11 -2.3 615.8260 2 70.24 2 33019 AEV_1_3_RA2_01_1232.d 4.28E5 2 2 39 49 Methylation(KR)
K.M(+15.99)GVPYAIIK.G Y 55.24 1006.5521 9 -0.6 504.2830 2 68.36 2 31628 AEV_1_3_RA2_01_1232.d 8.52E5 4 4 164 172 Oxidation (M)
K.TAAVLALTEVR(+14.02).S Y 50.88 1156.6815 11 -15.4 579.3391 2 77.03 2 38204 AEV_1_3_RA2_01_1232.d 0 2 2 185 195 Methylation(KR)
R.KMGVPYAIIK.G Y 49.34 1118.6521 10 0.0 373.8913 3 65.92 3 37026 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 163 172
K.KTAAVLALTEVR.S Y 48.18 1270.7609 12 -91.5 424.5555 3 77.34 1 39722 AEV 2_3_RA2_01_1224.d 7.93E4 1 1 184 195
K.TAAVLALTE(+14.02)VR.S Y 47.57 1156.6815 11 -15.0 579.3394 2 76.44 3 45279 AEV_3_3_RA3_01_1233.d 1E5 1 1 185 195 Methylation(others)
R.LLKEASAIEAGKK.K Y 45.85 1356.7976 13 -34.3 453.2576 3 42.10 3 20722 AEV_3_3_RA3_01_1233.d 0 3 3 100 112
R.SEDKTELSK.L Y 45.81 1035.5084 9 4.5 518.7638 2 11.51 2 3041 AEV_1_3_RA2_01_1232.d 9.28E4 2 2 196 204
R.SEDKTELSK(+14.02).L Y 44.03 1049.5240 9 5.6 525.7722 2 16.98 2 5155 AEV_1_3_RA2_01_1232.d 2.56E4 1 1 196 204 Methylation(KR)
R.NTAAQ(+.98)AFK.L Y 42.80 850.4185 8 8.4 426.2201 2 26.06 2 8970 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 76 83 Deamidation (NQ)
R.KASENAIKL Y 42.54 972.5604 9 -0.2 487.2874 2 33.01 3 15149 AEV_3_3_RA3_01_1233.d 2.6E5 3 3 242 250
K.ASLVLIPNDVDPIE(+129.04)LVVFLPALC(+57.02)R.K Y 40.52 2791.5193 24 21.8 698.9023 4 95.54 3 57452 AEV_3_3_RA3_01_1233.d 6.15E4 1 1 139 162 Monoglutamyl; Carbamidomethylation
K.LLNKYRPESK.A Y 40.22 1246.7034 10 1.5 312.6836 4 31.07 3 14034 AEV_3_3_RA3_01_1233.d 8.04E5 2 2 84 93
K.EASAIEAGK(+14.02).K Y 40.01 888.4552 9 -2.6 445.2337 2 24.94 3 10590 AEV_3_3_RA3_01_1233.d 5.29E5 3 3 103 111 Methylation(KR)
K.EGYSDKYEESK.R Y 39.92 1333.5674 11 -84.9 667.7344 2 34.22 1 11293 AEV 2_3_RA2_01_1224.d 3.74E5 2 2 211 221
K.E(+14.02)ASAIEAGK.K Y 38.70 888.4552 9 -88.4 889.3839 1 34.44 1 11395 AEV 2_3_RA2_01_1224.d 4.56E4 1 1 103 111 Methylation(others)
K.YGLNHVVGLIENK(+14.02).K Y 38.60 1468.8038 13 10.0 490.6135 3 77.91 2 38901 AEV_1_3_RA2_01_1232.d 2.61E4 1 1 125 137 Methylation(KR)
K.EDVSKKPYAVK.Y Y 38.11 1262.6870 11 4.5 421.9048 3 22.82 2 7566 AEV_1_3_RA2_01_1232.d 2.83E5 2 2 114 124
R.NFGIGQ(+.98)DIQPK(+14.02).R Y 37.09 1230.6244 11 -26.5 616.3032 2 71.47 2 33949 AEV_1_3_RA2_01_1232.d 0 1 1 39 49 Deamidation (NQ); Methylation(KR)
K.AS(+79.97)LVLIPNDVD(+43.99)PIELVVFLPALC(+57.02)R.K Y 36.47 2786.4329 24 -6.7 929.8120 3 95.77 2 49601 AEV_1_3_RA2_01_1232.d 0 1 1 139 162 Phosphorylation (STY); Carboxylation (DKW); Carbamidomethylation
R.SEDKTELSKLISAIK.E Y 35.52 1660.9247 15 0.0 416.2384 4 76.41 2 37714 AEV_1_3_RA2_01_1232.d 1.78E5 2 2 196 210
K.YGLNHVVGLIENKK(+14.02).A Y 35.47 1596.8987 14 3.4 400.2333 4 74.30 2 36106 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 125 138 Methylation(KR)
R.KM(-48.00)GVPYAIIK.G Y 35.32 1070.6488 10 0.9 357.8905 3 44.67 3 22347 AEV_3_3_RA3_01_1233.d 2.15E5 1 1 163 172 Dethiomethyl
K.RPR(+44.03)NFGIGQDIQPKR.N Y 32.43 1825.0071 15 -19.3 457.2502 4 61.63 2 26938 AEV_1_3_RA2_01_1232.d 3.89E4 1 1 36 50 Ethanolation (KR)
K.LISAIKEGYSDK(+14.02)YEESKR.H Y 32.02 2129.1003 18 -9.5 533.2773 4 58.55 3 31328 AEV_3_3_RA3_01_1233.d 0 1 1 205 222 Methylation(KR)
K.YRPESK.A Y 31.51 778.3973 6 -96.0 390.1686 2 17.58 1 4160 AEV 2_3_RA2_01_1224.d 5.67E4 3 3 88 93
K.LLNKY(+79.96)RPESK.A Y 31.29 1326.6602 10 6.4 332.6744 4 31.04 3 13996 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 84 93 Sulfation
K.LISAIK.E Y 30.13 643.4268 6 2.4 644.4357 1 41.40 2 16157 AEV_1_3_RA2_01_1232.d 2.21E5 4 4 205 210
R.N(+.98)FGIGQ(+.98)DIQPK.R Y 29.99 1217.5928 11 24.5 609.8186 2 68.76 2 31927 AEV_1_3_RA2_01_1232.d 3.22E4 1 1 39 49 Deamidation (NQ)
K.K(+54.01)ERLLKEASAIEAGK.K Y 28.94 1695.9519 15 0.1 424.9953 4 51.85 3 26948 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 97 111 MDA adduct +54
R.LLKEASAIEAGK(+14.02).K Y 28.81 1242.7183 12 -0.9 415.2463 3 59.54 3 32071 AEV_3_3_RA3_01_1233.d 2.16E5 1 1 100 111 Methylation(KR)
K.YRPESK(+14.02).A Y 28.60 792.4130 6 -86.1 397.1796 2 26.52 1 7228 AEV 2_3_RA2_01_1224.d 6.94E4 2 2 88 93 Methylation(KR)
K.TAAVLALTEVR(+14.02)SEDKTELSK.L Y 28.48 2174.1794 20 6.9 544.5559 4 71.94 3 41752 AEV_3_3_RA3_01_1233.d 6.35E5 2 2 185 204 Methylation(KR)
K.EASAIEAGKK.K Y 27.91 1002.5345 10 0.1 502.2746 2 11.96 2 3202 AEV_1_3_RA2_01_1232.d 2.23E4 1 1 103 112
K.E(-18.01)ASAIEAGKKK.E Y 26.13 1112.6189 11 -2.6 371.8793 3 9.89 2 2448 AEV_1_3_RA2_01_1232.d 1.86E4 1 1 103 113 Pyro-glu from E
R.SEDKT(+14.02)ELSK.L Y 25.84 1049.5240 9 0.4 525.7695 2 15.94 2 4724 AEV_1_3_RA2_01_1232.d 1.3E4 1 1 196 204 Methylation(others)
K.TAAVLALTEVRSEDKTELSK(+14.02).L Y 25.69 2174.1794 20 4.6 544.5546 4 71.47 3 41380 AEV_3_3_RA3_01_1233.d 7.01E4 1 1 185 204 Methylation(KR)
R.NFGIGQ(+.98)DIQ(+.98)PK.R Y 25.32 1217.5928 11 31.6 1218.6385 1 88.16 2 46280 AEV_1_3_RA2_01_1232.d 4.46E4 1 1 39 49 Deamidation (NQ)
R.N(+.98)FGIGQDIQPK.R Y 25.10 1216.6088 11 -0.9 609.3111 2 70.18 3 40367 AEV_3_3_RA3_01_1233.d 2.3E5 2 2 39 49 Deamidation (NQ)
K.LISAIKEGYSDKYEESK(+14.02)R.H Y 24.94 2129.1003 18 -0.6 426.8271 5 58.95 3 31632 AEV_3_3_RA3_01_1233.d 2.5E5 1 1 205 222 Methylation(KR)
K.TAAVLALT(+79.97)EVR(+14.02).S Y 24.53 1236.6478 11 26.8 310.1775 4 39.58 3 19141 AEV_3_3_RA3_01_1233.d 0 1 1 185 195 Phosphorylation (STY); Methylation(KR)
R.NTAAQAFK(+14.02).L Y 24.06 863.4501 8 -17.1 432.7249 2 34.36 3 15948 AEV_3_3_RA3_01_1233.d 2.86E5 2 2 76 83 Methylation(KR)
K.KEDVSKKPYAVK.Y Y 23.20 1390.7820 12 -5.4 348.7009 4 34.40 2 12780 AEV_1_3_RA2_01_1232.d 2.49E5 2 2 113 124
K.R(+28.03)HWGGGIMGAKANAR.Q Y 22.85 1608.8419 15 -15.6 805.4156 2 86.10 3 52510 AEV_3_3_RA3_01_1233.d 0 1 1 222 236 Dimethylation(KR)
K.TAAVLALTEVR(+.98).S Y 22.62 1143.6499 11 -24.9 572.8180 2 74.68 2 36378 AEV_1_3_RA2_01_1232.d 0 1 1 185 195 Deamidation (R)
R.KASENAIK.L Y 22.53 859.4763 8 -7.0 430.7424 2 51.36 2 21135 AEV_1_3_RA2_01_1232.d 0 1 1 242 249
K.N(+203.08)LQ(+.98)NPLIEKRPR.N Y 22.35 1680.9159 12 -36.1 561.2924 3 29.39 2 10432 AEV_1_3_RA2_01_1232.d 1.23E4 1 1 27 38 HexNAcylation (N); Deamidation (NQ)
K.YGLNHVVGLIEN(+.98)K.K Y 21.80 1455.7721 13 -0.6 486.2643 3 74.79 3 43962 AEV_3_3_RA3_01_1233.d 9.78E4 1 1 125 137 Deamidation (NQ)
K.T(+42.01)AAVLALT(+79.97)EVR(+14.02).S Y 21.39 1278.6584 11 -2.5 427.2257 3 38.30 2 14662 AEV_1_3_RA2_01_1232.d 3.54E5 1 1 185 195 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
K.KPYAVK.Y Y 21.11 704.4221 6 -95.9 353.1845 2 26.27 1 7101 AEV 2_3_RA2_01_1224.d 8.92E4 2 2 119 124
K.YRPES(+79.97)K(+14.02)AEKK.E Y 21.04 1328.6489 10 39.9 333.1828 4 29.23 2 10359 AEV_1_3_RA2_01_1232.d 0 1 1 88 97 Phosphorylation (STY); Methylation(KR)
R.HW(+15.99)GGGIMGAK.A Y 20.80 1028.4862 10 5.2 515.2531 2 44.99 2 17931 AEV_1_3_RA2_01_1232.d 0 1 1 223 232 Oxidation (HW)
R.LLKEASAIE(+14.02)AGK.K Y 20.37 1242.7183 12 -0.6 415.2464 3 61.33 3 33482 AEV_3_3_RA3_01_1233.d 1.62E5 1 1 100 111 Methylation(others)
R.LLK(+28.03)EASAIEAGK(+42.01)K.K Y 19.87 1426.8395 13 6.9 476.6237 3 64.92 2 29195 AEV_1_3_RA2_01_1232.d 8.46E4 1 1 100 112 Dimethylation(KR); Acetylation (K)
K.TELSK.L Y 19.69 576.3119 5 -166.2 577.2234 1 68.32 1 32678 AEV 2_3_RA2_01_1224.d 2.68E5 2 2 200 204
K.EGYSDKYEESK(+170.04).R Y 19.68 1503.6041 11 -44.2 752.7761 2 43.70 1 16525 AEV 2_3_RA2_01_1224.d 2.73E4 1 1 211 221 Menadione quinone derivative
R.KM(+15.99)GVPYAIIK(+226.08).G Y 19.17 1360.7246 10 -20.1 341.1816 4 12.99 2 3585 AEV_1_3_RA2_01_1232.d 0 1 1 163 172 Oxidation (M); Biotinylation
K.YGLNHVVGLIENK(+14.02)K.A Y 19.07 1596.8987 14 0.6 400.2322 4 72.70 2 34891 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 125 138 Methylation(KR)
K.M(-48.00)GVPYAIIK.G Y 19.03 942.5538 9 -0.9 472.2838 2 57.49 3 30580 AEV_3_3_RA3_01_1233.d 1.38E5 1 1 164 172 Dethiomethyl
K.KKEDVSK(+42.01)KPYAVK.Y Y 18.95 1560.8875 13 -19.1 391.2217 4 67.42 3 38188 AEV_3_3_RA3_01_1233.d 1.32E5 1 1 112 124 Acetylation (K)
K.M(+15.99)GVPYAIIKGKAR.L Y 18.92 1418.8068 13 -20.0 355.7019 4 50.13 2 20507 AEV_1_3_RA2_01_1232.d 6.19E5 2 2 164 176 Oxidation (M)
K.EASAIEAGKK(+42.01).K Y 18.90 1044.5450 10 4.2 523.2820 2 27.25 2 9483 AEV_1_3_RA2_01_1232.d 4.84E5 1 1 103 112 Acetylation (K)
K.A(+135.98)SLVLIPNDVDPIELVVFLPALC(+57.02)RK.M Y 18.88 2926.5547 25 1.6 732.6471 4 92.28 2 48287 AEV_1_3_RA2_01_1232.d 0 1 1 139 163 Sulfonation of N-terminus; Carbamidomethylation
R.NFGIGQD(+14.02)IQPKR.N Y 18.57 1385.7415 12 5.0 462.9234 3 64.55 2 28934 AEV_1_3_RA2_01_1232.d 8.62E4 1 1 39 50 Methylation(others)
K.VSSELC(+57.02)VQITDS(+79.97)K.N Y 18.49 1544.6793 13 21.0 773.3632 2 112.04 3 62543 AEV_3_3_RA3_01_1233.d 0 1 1 14 26 Carbamidomethylation; Phosphorylation (STY)
K.ASLVLIPNDVDPIELVVFLPALC(+57.02)RK(-.98).M Y 18.38 2789.5876 25 -13.7 1395.7820 2 95.57 3 57465 AEV_3_3_RA3_01_1233.d 0 1 1 139 163 Carbamidomethylation; Amidation
K.YRPESK(+43.01)AEK(+42.01).K Y 18.01 1191.5884 9 10.9 398.2077 3 17.20 2 5242 AEV_1_3_RA2_01_1232.d 3.27E4 1 1 88 96 Carbamylation; Acetylation (K)
R.LLKEASAIEAGK(-.98).K Y 17.96 1227.7186 12 -73.5 307.9144 4 52.12 3 27135 AEV_3_3_RA3_01_1233.d 7.93E5 1 1 100 111 Amidation
K.R(+42.01)HWGGGIMGAK(+14.02).A Y 17.78 1224.6185 11 15.1 409.2196 3 43.98 3 21911 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 222 232 Acetylation (N-term); Methylation(KR)
K.VSSELC(+57.02)VQIT(+14.02)DSK.N Y 17.26 1478.7286 13 -16.0 370.6835 4 30.07 3 13424 AEV_3_3_RA3_01_1233.d 0 1 1 14 26 Carbamidomethylation; Methylation(others)
R.KM(+15.99)GVPYAIIK.G Y 17.14 1134.6471 10 -69.3 568.2915 2 60.47 2 26186 AEV_1_3_RA2_01_1232.d 1.63E4 1 1 163 172 Oxidation (M)
K.EDVSK(+43.01).K Y 17.06 619.2813 5 170.9 620.3944 1 100.76 1 55959 AEV 2_3_RA2_01_1224.d 0 1 1 114 118 Carbamylation
MSISSS(+79.97)FPLSQS(+79.97)K.V Y 16.85 1557.6187 13 46.2 390.4299 4 73.28 1 36523 AEV 2_3_RA2_01_1224.d 7.04E5 1 1 1 13 Phosphorylation (STY)
K.YRPES(-18.01)KAEK.K Y 16.82 1088.5614 9 -23.0 545.2755 2 16.38 3 5877 AEV_3_3_RA3_01_1233.d 0 1 1 88 96 Dehydration
K.E(+42.01)ASAIEAGK.K Y 16.52 916.4501 9 12.6 917.4689 1 112.37 3 62639 AEV_3_3_RA3_01_1233.d 2.4E4 1 1 103 111 Acetylation (N-term)
R.L(+41.03)LKEASAIEAGK.K Y 16.46 1269.7292 12 -23.6 424.2404 3 55.68 2 23357 AEV_1_3_RA2_01_1232.d 1.76E5 1 1 100 111 Amidination of lysines or N-terminal amines with methyl acetimidate
R.NFGIGQ(+.98)DIQPK(+43.99)R.N Y 16.45 1416.6997 12 5.0 473.2429 3 51.43 3 26665 AEV_3_3_RA3_01_1233.d 0 1 1 39 50 Deamidation (NQ); Carboxylation (DKW)
K.RN(+.98)LS(+79.97)R.M Y 16.03 725.3221 5 -51.4 726.2921 1 90.31 1 49852 AEV 2_3_RA2_01_1224.d 0 1 1 50 54 Deamidation (NQ); Phosphorylation (STY)
R.LLK(+14.02)EASAIEAGK.K Y 16.03 1242.7183 12 -32.7 622.3461 2 61.24 2 26688 AEV_1_3_RA2_01_1232.d 0 1 1 100 111 Methylation(KR)
K.YGLNHVVGLIEN(+.98)KK.A Y 15.96 1583.8671 14 9.3 396.9777 4 71.80 2 34198 AEV_1_3_RA2_01_1232.d 6.6E4 1 1 125 138 Deamidation (NQ)
R.NFGIGQDIQ(+.98)PK(+14.02).R Y 15.85 1230.6244 11 -15.5 616.3099 2 71.70 2 34122 AEV_1_3_RA2_01_1232.d 0 1 1 39 49 Deamidation (NQ); Methylation(KR)
K.T(+127.06)AAVLALTEVR.S Y 15.74 1269.7292 11 -40.1 424.2334 3 66.09 3 37135 AEV_3_3_RA3_01_1233.d 5.79E4 1 1 185 195 N-Succinimidyl-2-morpholine acetate
R.NFGIGQDIQP(+13.98)K.R Y 15.69 1229.6040 11 -51.5 615.7776 2 76.65 1 39174 AEV 2_3_RA2_01_1224.d 0 1 1 39 49 Proline oxidation to pyroglutamic acid
R.N(+.98)TAAQAFK(+28.03).L Y 15.63 878.4498 8 4.8 879.4613 1 38.76 3 18666 AEV_3_3_RA3_01_1233.d 3.29E4 1 1 76 83 Deamidation (NQ); Dimethylation(KR)
K.ANARQTK(-.98).R Y 15.42 786.4460 7 2.3 394.2312 2 102.60 2 51772 AEV_1_3_RA2_01_1232.d 2.74E5 1 1 233 239 Amidation
K.YRPESKAEK(+42.01)K(+42.01).E Y 15.39 1318.6881 10 -40.1 330.6661 4 22.92 3 9389 AEV_3_3_RA3_01_1233.d 8.73E5 1 1 88 97 Acetylation (K)
MSIS(+42.01)SSFPLSQSK.V Y 15.25 1439.6967 13 0.2 720.8557 2 75.81 3 44766 AEV_3_3_RA3_01_1233.d 1.34E5 1 1 1 13 Acetylation (TSCYH)
K.RPR(+14.02)NFGIGQD(-18.01)IQPK.R Y 15.05 1620.8848 14 0.8 325.1845 5 14.89 3 5065 AEV_3_3_RA3_01_1233.d 3.06E5 1 1 36 49 Methylation(KR); Dehydration
K.YRPESKAEK.K Y 15.05 1106.5720 9 -25.9 554.2789 2 62.93 2 27840 AEV_1_3_RA2_01_1232.d 1.32E4 1 1 88 96
total 114 peptides
C1GMZ1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IVNTTSTSGIYGNFGQANYAAAK.L Y 115.82 2347.1443 23 -1.0 783.3879 3 73.71 3 43157 AEV_3_3_RA3_01_1233.d 4.85E5 4 4 439 461
R.GSGGFGGSPKPTAR.R Y 107.30 1274.6367 14 -11.0 638.3186 2 27.30 2 9504 AEV_1_3_RA2_01_1232.d 1.78E6 8 8 754 767
R.GANVVVNDLGGSHTGVGASSK.A Y 105.05 1924.9602 21 -4.0 642.6581 3 60.51 3 32827 AEV_3_3_RA3_01_1233.d 5.95E5 4 4 32 52
K.YNIFVNTIAPNAGTQLTR.T Y 101.27 1992.0428 18 3.4 665.0238 3 81.47 2 41710 AEV_1_3_RA2_01_1232.d 3.45E5 4 4 478 495
K.YNILANVIAPIAASR.M Y 100.87 1584.8987 15 2.1 793.4583 2 86.26 2 45153 AEV_1_3_RA2_01_1232.d 2.46E5 2 2 184 198
R.LNGDYNPLHIDPEFSK.I Y 98.10 1857.8896 16 4.3 620.3065 3 77.17 2 38311 AEV_1_3_RA2_01_1232.d 2.83E5 2 2 801 816
R.VINTSSSAGLFGNFGQTNYSAAK.L Y 97.46 2333.1287 23 -0.8 1167.5707 2 78.78 3 47112 AEV_3_3_RA3_01_1233.d 2.58E5 3 3 145 167
K.LIDVIDKGNAAIVVVGYTTK.D Y 91.81 2088.1831 20 -18.8 697.0552 3 80.24 3 48254 AEV_3_3_RA3_01_1233.d 0 1 1 716 735
K.TGDDLFYNESTIFIR.G Y 90.10 1789.8523 15 1.6 895.9349 2 84.44 3 51349 AEV_3_3_RA3_01_1233.d 4.88E5 4 4 739 753
K.TSEDQAVLYR.L Y 87.83 1180.5724 10 -1.2 591.2928 2 49.93 3 25688 AEV_3_3_RA3_01_1233.d 7.51E5 8 8 791 800
R.SGGHGFPVDTK.L Y 86.22 1100.5250 11 33.6 551.2883 2 30.92 3 13916 AEV_3_3_RA3_01_1233.d 1.21E5 3 3 546 556
R.FDNQTVVITGAGGGLGK.A Y 86.03 1632.8470 17 -6.0 817.4259 2 70.86 3 40900 AEV_3_3_RA3_01_1233.d 1.22E5 3 3 6 22
K.LAIAGAGAELVSTGSKL Y 82.86 1556.8773 17 -28.6 779.4237 2 79.63 3 47786 AEV_3_3_RA3_01_1233.d 0 2 2 885 901
R.FAGVVLPGQTLK.T Y 81.59 1228.7179 12 0.6 615.3666 2 76.19 2 37540 AEV_1_3_RA2_01_1232.d 1E5 2 2 852 863
R.LN(-17.03)GDYNPLHIDPEFSK.I Y 81.14 1840.8632 16 1.8 921.4406 2 83.44 2 43204 AEV_1_3_RA2_01_1232.d 3.07E5 2 2 801 816 Ammonia-loss (N)
K.LGAAVVVNDLVDPESVVQEIRK.A Y 79.34 2349.2903 22 2.2 784.1058 3 85.02 3 51713 AEV_3_3_RA3_01_1233.d 3.52E4 2 2 336 357
K.AEGTPLDYVSRDVILYNVSLGAK.R Y 70.30 2479.2959 23 -2.1 827.4375 3 85.81 3 52244 AEV_3_3_RA3_01_1233.d 9.66E4 1 1 622 644
K.DAKTGDDLFYNESTIFIR.G Y 69.00 2104.0112 18 12.1 702.3528 3 82.52 2 42574 AEV_1_3_RA2_01_1232.d 1.85E4 1 1 736 753
K.VALITGAGAGLGR.A Y 68.48 1154.6771 13 -17.6 578.3357 2 69.87 2 32748 AEV_1_3_RA2_01_1232.d 5.38E4 2 2 315 327
K.AATAAYKPLQR.K Y 68.26 1188.6615 11 -9.5 595.3324 2 32.86 3 15066 AEV_3_3_RA3_01_1233.d 1.4E6 5 5 771 781
R.IDILINNAGILR.D Y 68.15 1323.7874 12 -38.6 662.8754 2 81.40 3 49168 AEV_3_3_RA3_01_1233.d 0 1 1 92 103
R.GS(-2.02)GGFGGSPKPTAR.R Y 66.07 1272.6211 14 -9.0 425.2105 3 27.45 2 9576 AEV_1_3_RA2_01_1232.d 3.37E4 1 1 754 767 2-amino-3-oxo-butanoic_acid
K.GLYEC(+57.02)GSGWFTK.T Y 62.10 1403.6179 12 -0.5 702.8159 2 75.67 3 44657 AEV_3_3_RA3_01_1233.d 2.31E5 2 2 529 540 Carbamidomethylation
R.KPDTVVEEK.T Y 60.04 1043.5498 9 2.2 522.7833 2 15.85 3 5597 AEV_3_3_RA3_01_1233.d 2.51E5 4 4 782 790
R.GAN(+.98)VVVNDLGGSHTGVGASSK.A Y 53.43 1925.9442 21 28.9 643.0072 3 61.37 2 26773 AEV_1_3_RA2_01_1232.d 0 1 1 32 52 Deamidation (NQ)
K.AADVVVDEIK.A Y 53.23 1057.5656 10 -3.3 529.7883 2 62.18 3 34104 AEV_3_3_RA3_01_1233.d 6.74E4 1 1 53 62
K.ILAAIETAK.N Y 52.39 928.5593 9 -7.5 465.2834 2 59.71 2 25687 AEV_1_3_RA2_01_1232.d 2.48E5 3 3 610 618
K.TPILHGLC(+57.02)SLGISGK.H Y 50.33 1551.8442 15 -6.6 518.2853 3 74.45 3 43704 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 822 836 Carbamidomethylation
R.DVILYNVSLGAK.R Y 47.01 1290.7183 12 -9.6 646.3602 2 78.51 3 46951 AEV_3_3_RA3_01_1233.d 8.34E4 3 3 633 644
K.AYALFFGQR.G Y 46.57 1071.5502 9 -86.5 536.7360 2 82.90 1 44105 AEV 2_3_RA2_01_1224.d 1.2E5 1 1 23 31
K.AADVVVDEIKAAGGK.A Y 42.66 1441.7776 15 -2.5 481.5986 3 66.59 3 37539 AEV_3_3_RA3_01_1233.d 1.6E5 1 1 53 67
R.KPDTVVEEKTSEDQAVLYR.L Y 41.71 2206.1116 19 -80.1 552.4910 4 68.33 1 32684 AEV 2_3_RA2_01_1224.d 1.37E5 1 1 782 800
K.ASVEDGEAVVKPAIDAFGRIDILINNAGILR.D Y 40.82 3235.7563 31 -0.3 809.9461 4 91.71 3 55654 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 367 397
K.ASVEDGEAVVKPAIDAFGR.I Y 40.12 1929.9795 19 -12.2 644.3259 3 76.62 2 37905 AEV_1_3_RA2_01_1232.d 1.14E5 1 1 367 385
K.TDASLTPQ(+.98)AILAK.W Y 38.68 1328.7188 13 -15.0 665.3567 2 73.29 2 35337 AEV_1_3_RA2_01_1232.d 0 1 1 259 271 Deamidation (NQ)
K.LGILGFSR.A Y 36.39 861.5072 8 -3.6 431.7593 2 76.23 3 45094 AEV_3_3_RA3_01_1233.d 2.71E5 3 3 462 469
K.AEGTPLDYVSR.D Y 36.29 1206.5880 11 5.6 604.3047 2 66.62 3 37559 AEV_3_3_RA3_01_1233.d 5.57E4 1 1 622 632
K.AVANYDSVEFGER.I Y 35.57 1455.6630 13 -88.1 728.7747 2 71.97 1 35522 AEV 2_3_RA2_01_1224.d 1.08E5 1 1 68 80
R.VIN(+.98)TSSSAGLFGNFGQTNYSAAK.L Y 35.05 2334.1128 23 16.9 779.0580 3 78.72 3 47073 AEV_3_3_RA3_01_1233.d 3.34E4 1 1 145 167 Deamidation (NQ)
K.LGAAVVVNDLVDPESVVQEIR.K Y 33.24 2221.1953 21 -11.3 741.3973 3 88.52 2 46473 AEV_1_3_RA2_01_1232.d 3.74E4 1 1 336 356
K.LAIAGAGAELVSTGS(+79.97)KL Y 32.97 1636.8436 17 20.9 328.3828 5 41.98 3 20682 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 885 901 Phosphorylation (STY)
K.IVTFDAR.S Y 30.95 820.4443 7 -94.1 411.1908 2 63.03 1 28799 AEV 2_3_RA2_01_1224.d 7.51E4 3 3 569 575
R.AAWPYFR.K Y 30.79 909.4497 7 15.5 455.7392 2 72.93 3 42585 AEV_3_3_RA3_01_1233.d 7.67E4 2 2 132 138
K.V(+42.01)HVFGSYK(+43.01).C Y 30.37 1020.5029 8 -69.0 341.1514 3 49.78 1 20152 AEV 2_3_RA2_01_1224.d 5.32E5 1 1 121 128 Acetylation (N-term); Carbamylation
K.SIMANMSNVSGGK.E Y 29.73 1294.6010 13 5.8 648.3115 2 62.00 2 27203 AEV_1_3_RA2_01_1232.d 4.66E5 5 5 588 600
K.TYGPFK.S Y 29.05 711.3591 6 -0.3 712.3662 1 98.61 3 58602 AEV_3_3_RA3_01_1233.d 3.41E5 3 3 841 846
K.TVSIPK(+27.99).L Y 28.93 671.3854 6 -75.0 336.6748 2 65.15 1 30263 AEV 2_3_RA2_01_1224.d 2.69E6 7 7 710 715 Formylation
K.TSEDQAVLYR(+14.02).L Y 26.89 1194.5880 10 -1.0 598.3007 2 58.71 3 31449 AEV_3_3_RA3_01_1233.d 7.04E4 1 1 791 800 Methylation(KR)
K.AAWPYFLK.Q Y 25.95 994.5276 8 0.2 498.2711 2 79.55 3 47716 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 426 433
R.KYPIPTAAK(+42.01)TVSIPK(+28.03).L Y 25.57 1682.9971 15 5.5 421.7589 4 38.68 2 14832 AEV_1_3_RA2_01_1232.d 0 2 2 701 715 Acetylation (K); Dimethylation(KR)
R.DISFK.N N 25.01 608.3170 5 -18.5 609.3130 1 39.75 3 19254 AEV_3_3_RA3_01_1233.d 5.04E4 3 3 104 108
R.KPDTVVEEKTSED(+14.02)QAVLYR.L Y 24.11 2220.1274 19 -16.2 556.0302 4 62.93 3 34682 AEV_3_3_RA3_01_1233.d 1.85E5 1 1 782 800 Methylation(others)
K.G(+42.01)N(+.98)AAIVVVGYT(+79.97)TKDAK.T Y 23.25 1728.8335 16 20.2 433.2244 4 41.57 3 20375 AEV_3_3_RA3_01_1233.d 0 1 1 723 738 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
R.ALALEGAK.Y Y 23.20 771.4490 8 -6.1 386.7294 2 37.33 3 17784 AEV_3_3_RA3_01_1233.d 1.89E5 1 1 470 477
K.AGGRAVGS(-18.01)K.A Y 22.84 783.4351 9 2.1 392.7256 2 21.14 2 6864 AEV_1_3_RA2_01_1232.d 0 1 1 358 366 Dehydration
K.HVFKTYGPFK.S Y 22.77 1222.6498 10 -3.4 612.3301 2 87.28 3 53171 AEV_3_3_RA3_01_1233.d 1.19E5 1 1 837 846
K.SIMANMSNVSGGK(+14.02)EGGSTGDKK(+43.01).I Y 22.73 2211.0259 22 16.4 738.0280 3 76.35 3 45178 AEV_3_3_RA3_01_1233.d 9.91E5 1 1 588 609 Methylation(KR); Carbamylation
K.A(+42.01)ADVVVDE(+43.99)IK.A Y 22.02 1143.5659 10 -3.2 572.7884 2 43.96 3 21896 AEV_3_3_RA3_01_1233.d 0 1 1 53 62 Acetylation (N-term); Carboxylation (E)
K.WND(-18.01)VK.D Y 21.92 642.3126 5 5.9 643.3236 1 76.67 3 45436 AEV_3_3_RA3_01_1233.d 2.79E4 1 1 272 276 Dehydration
R.SGGHGFPVDTK(+43.01).L Y 21.90 1143.5309 11 -56.1 382.1628 3 37.16 1 12803 AEV 2_3_RA2_01_1224.d 0 1 1 546 556 Carbamylation
R.K(+42.01)YPIPTAAKTVSIPK(+28.03).L Y 21.66 1682.9971 15 8.6 421.7602 4 37.86 2 14452 AEV_1_3_RA2_01_1232.d 0 1 1 701 715 Acetylation (N-term); Dimethylation(KR)
K.A(+42.01)ADVVVDEIK.A Y 21.65 1099.5760 10 -4.7 550.7927 2 54.43 2 22715 AEV_1_3_RA2_01_1232.d 0 1 1 53 62 Acetylation (N-term)
K.L(+42.01)AIAGAGAELVSTGSK(+42.01)L Y 21.63 1640.8984 17 -7.8 329.1844 5 43.59 3 21667 AEV_3_3_RA3_01_1233.d 1.61E4 1 1 885 901 Acetylation (N-term); Acetylation (K)
K.AADVVVD(-18.01)EIK.A Y 21.56 1039.5549 10 6.5 347.5278 3 35.59 3 16689 AEV_3_3_RA3_01_1233.d 0 1 1 53 62 Dehydration
R.IIETAINAFGR.I Y 21.02 1203.6611 11 -77.8 602.7910 2 79.48 1 41429 AEV 2_3_RA2_01_1224.d 2.22E4 1 1 81 91
R.KAGGRAVGS(-18.01)K.A Y 20.91 911.5300 10 -11.6 304.8471 3 26.48 3 11447 AEV_3_3_RA3_01_1233.d 1.31E6 1 1 357 366 Dehydration
K.LIDVIDK(+226.08).G Y 20.90 1040.5576 7 -6.7 521.2826 2 78.66 2 39571 AEV_1_3_RA2_01_1232.d 6.51E4 2 2 716 722 Biotinylation
R.A(+71.04)LALEGAK.Y Y 20.55 842.4861 8 -23.4 422.2405 2 53.39 2 22186 AEV_1_3_RA2_01_1232.d 2.75E5 1 1 470 477 Propionamide (K, X@N-term)
K.ILAAIET(+79.97)AK(+42.01).N Y 20.47 1050.5361 9 -1.7 1051.5416 1 97.05 2 50017 AEV_1_3_RA2_01_1232.d 1.13E4 1 1 610 618 Phosphorylation (STY); Acetylation (K)
K.T(+42.01)SEDQAVLY(+79.97)R.L Y 20.22 1302.5493 10 11.6 435.1954 3 48.59 1 19416 AEV 2_3_RA2_01_1224.d 2.66E4 1 1 791 800 Acetylation (N-term); Phosphorylation (STY)
K.V(+43.01)ALITGAGAGLGR.A Y 20.19 1197.6830 13 -27.5 400.2240 3 46.99 3 23804 AEV_3_3_RA3_01_1233.d 1.55E5 1 1 315 327 Carbamylation
K.VHVFGSYK(+43.99).C Y 19.89 979.4763 8 -58.3 327.4803 3 51.92 1 21313 AEV 2_3_RA2_01_1224.d 5.28E4 1 1 121 128 Carboxylation (DKW)
K.SIMANMSNVSGGK(+14.02)EGGSTGDK(+43.01)K.I Y 19.74 2211.0259 22 27.0 738.0358 3 77.62 3 46202 AEV_3_3_RA3_01_1233.d 4.34E5 1 1 588 609 Methylation(KR); Carbamylation
R.WQRSGGHGF(+31.99)PVDTK(+14.02).L Y 19.64 1616.7695 14 -98.2 405.1600 4 31.76 1 9967 AEV 2_3_RA2_01_1224.d 0 1 1 543 556 Dihydroxy; Methylation(KR)
R.AYALLFSK.L Y 19.49 911.5116 8 -86.4 456.7237 2 79.96 1 41817 AEV 2_3_RA2_01_1224.d 6.78E4 1 1 328 335
K.LIDVID(-18.01)K.G Y 19.32 796.4694 7 -57.2 797.4312 1 97.24 3 58088 AEV_3_3_RA3_01_1233.d 7.75E4 1 1 716 722 Dehydration
R.GSGGFGGSPKPTARRPK(+226.08).A Y 19.22 1881.9631 17 -13.9 628.3196 3 73.14 3 42692 AEV_3_3_RA3_01_1233.d 0 1 1 754 770 Biotinylation
R.AVGS(+79.97)K(+27.99).A Y 19.20 568.2258 5 -33.6 569.2139 1 41.10 1 15054 AEV 2_3_RA2_01_1224.d 6.99E4 1 1 362 366 Phosphorylation (STY); Formylation
R.LNGDYNPLHIDPEFSK(+14.02).I Y 19.06 1871.9053 16 8.1 624.9808 3 78.41 3 46827 AEV_3_3_RA3_01_1233.d 3.35E4 1 1 801 816 Methylation(KR)
K.AAGGK(+42.01).A Y 18.98 444.2332 5 -6.6 445.2375 1 19.93 2 6379 AEV_1_3_RA2_01_1232.d 2.36E5 5 5 63 67 Acetylation (K)
K.VHVFGSYK.C Y 18.96 935.4865 8 1.9 312.8367 3 9.38 3 2298 AEV_3_3_RA3_01_1233.d 1.06E4 1 1 121 128
K.LT(+79.97)P(+31.99)EAVK.S Y 18.72 868.3943 7 -13.3 435.1986 2 41.36 1 15222 AEV 2_3_RA2_01_1224.d 0 1 1 557 563 Phosphorylation (STY); Dihydroxy
K.ENGAVVFQ(+.98)TTVVETGK(+14.02).L Y 18.62 1692.8571 16 1.9 424.2224 4 15.62 3 5474 AEV_3_3_RA3_01_1233.d 0 1 1 869 884 Deamidation (NQ); Methylation(KR)
R.AVGSK(-.98).A Y 18.49 459.2805 5 -166.4 460.2114 1 78.10 1 40329 AEV 2_3_RA2_01_1224.d 1.36E4 2 2 362 366 Amidation
K.TYGPF(+31.99)K(+14.02).S Y 18.39 757.3646 6 26.0 758.3916 1 112.24 2 54368 AEV_1_3_RA2_01_1232.d 0 1 1 841 846 Dihydroxy; Methylation(KR)
K.A(+42.01)AT(+79.97)AAYKPLQR.K Y 18.35 1310.6383 11 30.5 437.9000 3 61.20 3 33344 AEV_3_3_RA3_01_1233.d 2.39E5 1 1 771 781 Acetylation (N-term); Phosphorylation (STY)
K.DLDWDLINK(+14.02)VHVFGSYK.C Y 18.03 2062.0522 17 -6.2 1032.0270 2 94.42 3 56971 AEV_3_3_RA3_01_1233.d 0 1 1 112 128 Methylation(KR)
K.VHVFGS(-18.01)YK.C Y 17.82 917.4759 8 -104.8 306.8005 3 64.28 1 29767 AEV 2_3_RA2_01_1224.d 2.47E5 1 1 121 128 Dehydration
K.YPIPTAAK(+14.02)TVSIPK(+42.01).L Y 17.66 1540.8865 14 -6.9 309.1824 5 21.77 3 8785 AEV_3_3_RA3_01_1233.d 0 1 1 702 715 Methylation(KR); Acetylation (K)
K.S(+42.01)IMANMS(-18.01)NVSGGK.E Y 17.55 1318.6010 13 4.4 440.5428 3 80.90 1 42540 AEV 2_3_RA2_01_1224.d 6.12E4 1 1 588 600 Acetylation (N-term); Dehydration
K.SIMANMSNVSGGKEGGSTGDK.K Y 17.47 2025.9095 21 -14.3 676.3008 3 82.13 1 43522 AEV 2_3_RA2_01_1224.d 1.07E5 1 1 588 608
K.TRWQ(+.98)R(+14.02)SGGHGFPVDTK.L Y 17.31 1842.9125 16 -67.6 461.7043 4 58.95 1 25735 AEV 2_3_RA2_01_1224.d 1.34E5 1 1 541 556 Deamidation (NQ); Methylation(KR)
R.AVGS(-18.01)K.A Y 17.18 442.2540 5 -6.2 443.2585 1 15.21 2 4424 AEV_1_3_RA2_01_1232.d 0 1 1 362 366 Dehydration
K.YNIFVNTIAPN(+.98)AGTQLTR(+28.03).T Y 17.18 2021.0581 18 20.2 405.2271 5 73.34 2 35373 AEV_1_3_RA2_01_1232.d 6.5E4 1 1 478 495 Deamidation (NQ); Dimethylation(KR)
K.E(+14.02)GGSTGDK.K Y 17.05 763.3348 8 -5.1 382.6727 2 41.89 1 15507 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 601 608 Methylation(others)
M(+15.99)SELRFDNQTVVITGAGGGLGK.A Y 16.74 2265.1423 22 -84.7 453.9974 5 29.09 1 8501 AEV 2_3_RA2_01_1224.d 0 1 1 1 22 Oxidation (M)
K.LGILGFS(+79.97)R.A Y 16.68 941.4735 8 9.6 942.4899 1 89.52 3 54453 AEV_3_3_RA3_01_1233.d 1.2E2 1 1 462 469 Phosphorylation (STY)
K.IGGFK(+31.99).T Y 16.61 552.2907 5 -35.2 553.2786 1 53.38 1 22170 AEV 2_3_RA2_01_1224.d 1.37E4 2 2 817 821 Dihydroxy
R.S(+79.97)GGHGFPVDTK(+31.99).L Y 16.57 1212.4812 11 62.8 607.2859 2 69.69 3 39998 AEV_3_3_RA3_01_1233.d 7.2E4 1 1 546 556 Phosphorylation (STY); Dihydroxy
K.AVANYDSVEFGERIIETAINAFGR.I Y 16.08 2641.3135 24 3.8 881.4485 3 95.30 2 49444 AEV_1_3_RA2_01_1232.d 0 1 1 68 91
K.TYGPFK(+21.98).S Y 16.02 733.3411 6 -25.3 734.3298 1 98.57 3 58583 AEV_3_3_RA3_01_1233.d 1.99E4 1 1 841 846 Sodium adduct
K.A(+27.99)ATAAYKPLQR.K Y 16.02 1216.6564 11 -7.2 305.1692 4 28.19 3 12371 AEV_3_3_RA3_01_1233.d 1.35E6 1 1 771 781 Formylation
K.LAIAGAGAELVSTGSKL(+21.98) Y 15.97 1578.8593 17 -13.9 527.2864 3 63.40 2 28157 AEV_1_3_RA2_01_1232.d 4E4 1 1 885 901 Sodium adduct
K.GNAAIVVVGYTTKD(+21.98)AK(+14.02).T Y 15.90 1641.8701 16 11.4 548.3035 3 84.63 3 51448 AEV_3_3_RA3_01_1233.d 5.7E4 1 1 723 738 Sodium adduct; Methylation(KR)
K.G(+42.01)ALLK(+42.01).T Y 15.87 584.3533 5 -14.6 585.3521 1 29.02 3 12823 AEV_3_3_RA3_01_1233.d 0 1 1 254 258 Acetylation (N-term); Acetylation (K)
K.EGAKY(-18.01)NILAN(+.98)VIAPIAASR.M Y 15.78 1953.0682 19 5.5 489.2770 4 58.14 2 24721 AEV_1_3_RA2_01_1232.d 0 1 1 180 198 Dehydration; Deamidation (NQ)
K.T(+42.01)VSIPK(+226.08).L Y 15.77 911.4786 6 -2.6 912.4836 1 97.23 3 58086 AEV_3_3_RA3_01_1233.d 6.33E4 1 1 710 715 Acetylation (N-term); Biotinylation
R.WQRSGGHGFPVDTK(+42.01).L Y 15.75 1612.7747 14 -25.2 404.1908 4 64.34 1 29811 AEV 2_3_RA2_01_1224.d 0 1 1 543 556 Acetylation (K)
K.VALITGAGAGLGR(+.98).A Y 15.71 1155.6611 13 -91.5 1156.5626 1 102.54 1 56558 AEV 2_3_RA2_01_1224.d 1.56E4 1 1 315 327 Deamidation (R)
K.DLDWDLIN(+.98)K.V Y 15.66 1131.5448 9 -35.0 566.7599 2 77.00 1 39456 AEV 2_3_RA2_01_1224.d 0 1 1 112 120 Deamidation (NQ)
K.LID(+43.99)VIDK.G Y 15.45 858.4698 7 9.0 430.2461 2 59.61 3 32128 AEV_3_3_RA3_01_1233.d 2.1E5 1 1 716 722 Carboxylation (DKW)
K.LGILGFS(+79.97)RALALEGAK(+42.01).Y Y 15.44 1736.9226 16 -13.5 435.2321 4 41.56 2 16242 AEV_1_3_RA2_01_1232.d 0 1 1 462 477 Phosphorylation (STY); Acetylation (K)
K.EGAKYNILANVIAPIAAS(+79.97)R(-.98).M Y 15.43 2049.0771 19 -3.4 513.2748 4 64.86 2 29158 AEV_1_3_RA2_01_1232.d 8.89E4 1 1 180 198 Phosphorylation (STY); Amidation
R.FAGVVLPGQT(+79.96)LK.T Y 15.42 1308.6747 12 11.4 437.2372 3 29.65 3 13174 AEV_3_3_RA3_01_1233.d 0 1 1 852 863 Sulfation
K.YNIFVN(+.98)TIAPNAGTQLT(+79.97)R.T Y 15.34 2072.9932 18 -60.6 519.2242 4 68.58 1 32872 AEV 2_3_RA2_01_1224.d 0 1 1 478 495 Deamidation (NQ); Phosphorylation (STY)
K.AATAAYKP(+31.99)LQR.K Y 15.31 1220.6512 11 -80.9 306.1454 4 34.72 1 11563 AEV 2_3_RA2_01_1224.d 0 1 1 771 781 Dihydroxy
R.W(+42.01)QRSGGHGFPVDT(+79.97)K(+42.01).L Y 15.26 1734.7515 14 -1.4 434.6945 4 78.13 1 40360 AEV 2_3_RA2_01_1224.d 1.2E5 1 1 543 556 Acetylation (N-term); Phosphorylation (STY); Acetylation (K)
K.V(+27.99)ALITGAGAGLGR.A Y 15.24 1182.6720 13 -26.0 395.2210 3 55.11 2 23065 AEV_1_3_RA2_01_1232.d 5.71E4 1 1 315 327 Formylation
K.SIMANM(+15.99)SNVS(-18.01)GGK.E Y 15.02 1292.5853 13 28.4 647.3183 2 46.22 3 23331 AEV_3_3_RA3_01_1233.d 5.34E4 1 1 588 600 Oxidation (M); Dehydration
K.EGAK(+14.02)Y(-18.01)NILANVIAPIAASR.M Y 15.01 1966.1000 19 -35.1 656.3510 3 82.53 3 49978 AEV_3_3_RA3_01_1233.d 6.38E4 1 1 180 198 Methylation(KR); Dehydration
K.AGGRAVGS(+79.97)K(+28.03).A Y 15.00 909.4433 9 33.7 304.1653 3 11.40 2 2995 AEV_1_3_RA2_01_1232.d 0 1 1 358 366 Phosphorylation (STY); Dimethylation(KR)
total 121 peptides
C1GLX8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.GYVSPYFITDTK.A Y 116.66 1389.6816 12 1.7 695.8492 2 75.59 2 37068 AEV_1_3_RA2_01_1232.d 8E5 4 4 238 249
R.AAVEEGILPGGGTALLK.A Y 115.09 1594.8929 17 -15.2 798.4417 2 78.86 2 39651 AEV_1_3_RA2_01_1232.d 0 3 3 446 462
R.LLQDVASKTNEVAGDGTTTATVLAR.A Y 114.78 2530.3237 25 1.1 844.4495 3 73.85 3 43233 AEV_3_3_RA3_01_1233.d 2.24E5 2 2 113 137
R.SVISDPATSDYEKEKLQER.L Y 110.50 2194.0752 19 1.4 549.5269 4 61.62 2 26928 AEV_1_3_RA2_01_1232.d 5.82E5 4 4 391 409
R.GIQSAVEAVVEYLQANKR.D Y 105.47 1974.0533 18 2.6 659.0268 3 89.14 2 46792 AEV_1_3_RA2_01_1232.d 3.72E5 3 3 159 176
K.TNEVAGDGTTTATVLAR.A Y 95.85 1675.8376 17 -1.0 838.9252 2 62.44 3 34303 AEV_3_3_RA3_01_1233.d 8.92E5 5 5 121 137
K.AVNLQDKFENLGAR.L Y 93.56 1573.8212 14 13.2 525.6213 3 68.63 2 31985 AEV_1_3_RA2_01_1232.d 1.03E6 5 5 99 112
R.NVLIESPYGSPK.I Y 92.01 1302.6819 12 2.6 652.3499 2 67.96 2 31338 AEV_1_3_RA2_01_1232.d 7.86E5 4 4 77 88
K.LTDDFASDFNR.G Y 88.30 1299.5731 11 -2.7 650.7921 2 70.68 3 40781 AEV_3_3_RA3_01_1233.d 1.86E5 3 3 511 521
K.AAANGLTSLNPTNFDQKLGISIIK.N Y 86.25 2485.3540 24 -1.2 829.4576 3 83.14 3 50407 AEV_3_3_RA3_01_1233.d 1.09E5 2 2 463 486
K.ISAVQDIIPALEASTSLR.R Y 85.93 1883.0364 18 1.2 628.6868 3 87.34 2 45851 AEV_1_3_RA2_01_1232.d 1.88E5 3 3 267 284
K.KISAVQDIIPALEASTSLR.R Y 84.97 2011.1313 19 -23.5 671.3687 3 83.59 2 43316 AEV_1_3_RA2_01_1232.d 0 1 1 266 284
R.TIVENSGLEGSVIVGK.L Y 79.37 1600.8672 16 -2.4 801.4390 2 72.07 3 41846 AEV_3_3_RA3_01_1233.d 2.65E5 3 3 495 510
K.SILGDIGILTNATVFTDELDLKLEK.A Y 74.52 2717.4739 25 6.2 906.8375 3 94.15 3 56850 AEV_3_3_RA3_01_1233.d 1.5E5 2 2 327 351
K.AAANGLTSLNPTNFDQK.L Y 69.24 1760.8693 17 -0.5 881.4415 2 73.56 3 43024 AEV_3_3_RA3_01_1233.d 3.24E5 4 4 463 479
K.VGGASEIEVGEKKDR.V Y 64.80 1572.8107 15 1.5 394.2105 4 31.64 3 14350 AEV_3_3_RA3_01_1233.d 5.27E5 3 3 422 436
R.SVISDPATSDYEK.E Y 63.66 1410.6514 13 2.3 706.3346 2 59.88 3 32335 AEV_3_3_RA3_01_1233.d 3.72E5 3 3 391 403
R.VVDALNATR.A Y 62.84 957.5243 9 -0.1 479.7694 2 44.28 2 17579 AEV_1_3_RA2_01_1232.d 8.86E5 6 6 437 445
K.AQKVEFEKPLILLSEK.K Y 61.39 1871.0767 16 2.2 468.7775 4 74.99 2 36607 AEV_1_3_RA2_01_1232.d 1.22E5 2 2 250 265
R.GQLQVAAVK.A Y 59.79 912.5392 9 -88.7 457.2364 2 58.32 1 25309 AEV 2_3_RA2_01_1224.d 2.14E5 5 5 309 317
K.AVTTTLGPK.G Y 51.67 886.5124 9 -14.6 444.2570 2 37.02 2 14036 AEV_1_3_RA2_01_1232.d 3.77E5 4 4 66 74
R.SVISDPATSDYEKEK.L Y 51.09 1667.7889 15 -4.1 834.8983 2 55.27 3 29106 AEV_3_3_RA3_01_1233.d 1.76E5 2 2 391 405
K.AVNLQDKFENLGAR(+14.02).L Y 50.51 1587.8369 14 -4.6 530.2838 3 69.47 3 39827 AEV_3_3_RA3_01_1233.d 0 1 1 99 112 Methylation(KR)
K.TIDDELEVTEGMR.F Y 50.35 1506.6871 13 5.5 754.3550 2 73.51 2 35508 AEV_1_3_RA2_01_1232.d 6.18E4 1 1 222 234
K.ITKDGVTVAK.A Y 48.06 1030.6023 10 -22.9 516.2966 2 24.60 3 10347 AEV_3_3_RA3_01_1233.d 3.13E5 3 3 89 98
K.AVNLQDKFE(+14.02)NLGAR.L Y 47.06 1587.8369 14 -18.2 530.2766 3 70.43 3 40562 AEV_3_3_RA3_01_1233.d 2.12E5 1 1 99 112 Methylation(others)
K.AVNLQ(+.98)DKFENLGAR.L Y 46.31 1574.8052 14 8.0 525.9465 3 70.32 2 33085 AEV_1_3_RA2_01_1232.d 2.64E4 1 1 99 112 Deamidation (NQ)
R.AAVEE(+14.02)GILPGGGTALLK.A Y 45.04 1608.9086 17 1.0 805.4623 2 80.55 2 41000 AEV_1_3_RA2_01_1232.d 1.11E5 1 1 446 462 Methylation(others)
K.AAAN(+.98)GLTSLNPTNFDQK.L Y 44.75 1761.8533 17 -0.2 881.9337 2 75.12 3 44214 AEV_3_3_RA3_01_1233.d 1.27E5 3 3 463 479 Deamidation (NQ)
K.VGGASEIEVGEK.K Y 43.62 1173.5876 12 0.9 587.8016 2 48.87 2 19882 AEV_1_3_RA2_01_1232.d 1.81E5 3 3 422 433
R.AAVE(+14.02)EGILPGGGTALLK.A Y 40.65 1608.9086 17 -19.6 805.4458 2 80.38 3 48367 AEV_3_3_RA3_01_1233.d 0 1 1 446 462 Methylation(others)
K.APGFGDNRK.S Y 40.27 960.4777 9 -1.4 481.2454 2 16.35 3 5868 AEV_3_3_RA3_01_1233.d 3.17E5 4 4 318 326
R.LLQDVASK.T Y 39.64 872.4967 8 -23.4 437.2454 2 39.88 3 19326 AEV_3_3_RA3_01_1233.d 0 4 4 113 120
R.GIQSAVEAVVEYLQANK(+14.02)R.D Y 38.63 1988.0691 18 2.1 663.6984 3 89.26 2 46864 AEV_1_3_RA2_01_1232.d 5.91E4 1 1 159 176 Methylation(KR)
K.APGFGDNR.K Y 38.58 832.3828 8 17.6 417.2060 2 25.98 2 8936 AEV_1_3_RA2_01_1232.d 2.74E4 2 2 318 325
K.LSGGVAVIK.V Y 37.19 842.5225 9 -26.1 422.2575 2 53.63 2 22305 AEV_1_3_RA2_01_1232.d 3.13E5 4 4 413 421
R.AIFSETVK.N Y 34.33 893.4858 8 -18.7 447.7418 2 58.82 2 25123 AEV_1_3_RA2_01_1232.d 1.58E5 2 2 138 145
K.LIS(+79.97)NAMEK(+14.02).V Y 34.28 998.4507 8 -40.8 333.8106 3 45.27 1 17429 AEV 2_3_RA2_01_1224.d 7.65E4 1 1 201 208 Phosphorylation (STY); Methylation(KR)
R.NVLIE(+14.02)SPYGSPK.I Y 34.20 1316.6976 12 0.3 659.3563 2 70.51 2 33229 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 77 88 Methylation(others)
K.FGVEAR.A Y 32.74 677.3496 6 -90.0 339.6516 2 45.03 1 17307 AEV 2_3_RA2_01_1224.d 5.29E5 2 2 48 53
K.LGISIIK.N Y 30.63 742.4952 7 -25.1 372.2456 2 69.58 2 32553 AEV_1_3_RA2_01_1232.d 2.54E5 3 3 480 486
K.LIS(+79.97)NAM(+15.99)EK(+14.02).V Y 28.98 1014.4457 8 -26.4 508.2167 2 27.10 1 7527 AEV 2_3_RA2_01_1224.d 6.02E3 1 1 201 208 Phosphorylation (STY); Oxidation (M); Methylation(KR)
K.NAITRPAR.T Y 28.93 897.5144 8 0.1 449.7645 2 14.86 3 5050 AEV_3_3_RA3_01_1233.d 9.4E4 2 2 487 494
R.LLQDVASK(+14.02).T Y 28.77 886.5123 8 3.6 444.2650 2 54.34 2 22668 AEV_1_3_RA2_01_1232.d 4.25E4 1 1 113 120 Methylation(KR)
K.AQKVEFEKPLILLSEKK.I Y 28.69 1999.1716 17 8.9 400.8452 5 70.40 2 33148 AEV_1_3_RA2_01_1232.d 8.18E4 1 1 250 266
K.LIS(-18.01)NAMEK(+42.01)VGK.E Y 28.53 1212.6536 11 -14.7 405.2192 3 27.28 2 9492 AEV_1_3_RA2_01_1232.d 0 1 1 201 211 Dehydration; Acetylation (K)
K.KDRVVD(-18.01)ALNATR.A Y 27.48 1338.7368 12 4.1 335.6928 4 23.25 2 7757 AEV_1_3_RA2_01_1232.d 0 1 1 434 445 Dehydration
R.S(+79.97)VISDPATSDYEK(+226.08).E Y 25.81 1716.6953 13 -20.1 859.3376 2 79.88 1 41775 AEV 2_3_RA2_01_1224.d 1.25E5 1 1 391 403 Phosphorylation (STY); Biotinylation
R.NVLIESPYGSPK(+14.02).I Y 25.27 1316.6976 12 -13.6 659.3471 2 70.75 2 33411 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 77 88 Methylation(KR)
K.ITKDGVTVAK(+43.01)AVNLQDK(+14.02)FENLGAR.L Y 24.98 2643.4343 24 -41.2 529.6724 5 71.12 2 33686 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 89 112 Carbamylation; Methylation(KR)
K.EDTIILNGEGS(+79.97)K(+14.02).D Y 24.61 1368.6173 12 -2.6 343.1607 4 45.92 1 17821 AEV 2_3_RA2_01_1224.d 0 1 1 368 379 Phosphorylation (STY); Methylation(KR)
R.FRS(-18.01)AGVGLQQQR.F Y 24.10 1327.7109 12 12.9 332.9393 4 30.14 3 13468 AEV_3_3_RA3_01_1233.d 2.22E5 1 1 29 40 Dehydration
K.A(+42.01)VTTTLGPK(+14.02).G Y 23.57 942.5386 9 18.2 315.1925 3 40.31 3 19577 AEV_3_3_RA3_01_1233.d 0 2 2 66 74 Acetylation (N-term); Methylation(KR)
K.LS(+79.96)GGVAVIK.V Y 23.08 922.4794 9 28.3 308.5091 3 32.20 2 11738 AEV_1_3_RA2_01_1232.d 0 1 1 413 421 Sulfation
R.VVDALNAT(-18.01)R.A Y 22.57 939.5137 9 2.0 314.1791 3 41.42 3 20278 AEV_3_3_RA3_01_1233.d 3.04E5 1 1 437 445 Dehydration
K.AVNLQ(+.98)DKFEN(+.98)LGAR.L Y 22.49 1575.7892 14 26.4 526.2842 3 56.77 3 30050 AEV_3_3_RA3_01_1233.d 0 1 1 99 112 Deamidation (NQ)
R.SAGVGLQQQR.F Y 22.12 1042.5519 10 30.8 348.5353 3 32.77 2 12014 AEV_1_3_RA2_01_1232.d 9.31E5 2 2 31 40
R.FRSAGVGLQ(+.98)QQR(+14.02).F Y 22.11 1360.7211 12 0.7 341.1878 4 18.22 3 6876 AEV_3_3_RA3_01_1233.d 0 1 1 29 40 Deamidation (NQ); Methylation(KR)
K.GIDTLAK(+42.01)AVTTTLGPK(+21.98).G Y 22.11 1648.9011 16 16.1 413.2392 4 60.48 3 32773 AEV_3_3_RA3_01_1233.d 0 1 1 59 74 Acetylation (K); Sodium adduct
K.N(+43.01)VAAGC(+57.02)NPMDLRR.G Y 22.06 1515.7035 13 0.0 506.2418 3 49.89 3 25661 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 146 158 Carbamylation; Carbamidomethylation
K.G(+42.01)IDTLAK(+43.99).A Y 22.03 802.4072 7 1.5 803.4157 1 86.40 3 52643 AEV_3_3_RA3_01_1233.d 5.89E2 1 1 59 65 Acetylation (N-term); Carboxylation (DKW)
K.AVTTT(+79.97)LGPK.G Y 21.68 966.4787 9 54.5 323.1844 3 19.57 2 6227 AEV_1_3_RA2_01_1232.d 5.15E4 1 1 66 74 Phosphorylation (STY)
K.EDTIILNGEGSK.D Y 21.55 1274.6354 12 19.8 425.8942 3 36.43 3 17205 AEV_3_3_RA3_01_1233.d 0 1 1 368 379
K.N(+42.01)AITRPAR.T Y 21.52 939.5250 8 8.0 314.1848 3 16.08 2 4782 AEV_1_3_RA2_01_1232.d 0 1 1 487 494 Acetylation (N-term)
K.IT(+79.96)KDGVTVAK.A Y 21.19 1110.5591 10 -8.7 371.1904 3 31.92 2 11608 AEV_1_3_RA2_01_1232.d 2.53E4 1 1 89 98 Sulfation
K.EDTIILNGEGSK(+43.99).D Y 20.94 1318.6252 12 -7.5 660.3149 2 60.21 3 32569 AEV_3_3_RA3_01_1233.d 4.2E4 1 1 368 379 Carboxylation (DKW)
M(+15.99)QRAFTSSRALVLSSASSASSTR.A Y 20.78 2416.2129 23 -49.5 484.2260 5 30.99 1 9511 AEV 2_3_RA2_01_1224.d 0 1 1 1 23 Oxidation (M)
R.GFDSAKGEYVDM(+15.99)IGAGIVDPLK.V Y 20.71 2297.1248 22 63.5 575.3250 4 54.08 3 28406 AEV_3_3_RA3_01_1233.d 0 1 1 522 543 Oxidation (M)
MQRAFTSSRALVLSSASSASSTR.A Y 20.52 2400.2180 23 12.5 601.0693 4 77.32 3 45957 AEV_3_3_RA3_01_1233.d 1.37E5 1 1 1 23
K.APGFGD(-18.01)NRK.S Y 20.35 942.4671 9 -60.7 315.1439 3 31.08 1 9569 AEV 2_3_RA2_01_1224.d 1.57E4 1 1 318 326 Dehydration
K.LISNAMEK.V Y 20.14 904.4688 8 -0.6 453.2414 2 38.75 2 14895 AEV_1_3_RA2_01_1232.d 2.06E5 2 2 201 208
R.ASLLKGIDTLAK.A Y 20.13 1228.7390 12 -29.8 308.1829 4 35.96 3 16902 AEV_3_3_RA3_01_1233.d 0 1 1 54 65
R.A(+42.01)IFSET(-18.01)VK.N Y 20.02 917.4858 8 -9.8 459.7457 2 54.33 2 22687 AEV_1_3_RA2_01_1232.d 5.78E4 1 1 138 145 Acetylation (N-term); Dehydration
K.VPAGSGAGGM(+15.99)GGGMGGMGGGMF Y 19.76 1814.7208 22 -38.6 908.3327 2 88.60 1 48568 AEV 2_3_RA2_01_1224.d 2.66E4 1 1 574 595 Oxidation (M)
K.DGVT(+79.97)VAKAVN(+.98)LQ(+.98)DK.F Y 19.28 1538.7229 14 25.4 770.3883 2 85.47 3 52017 AEV_3_3_RA3_01_1233.d 0 1 1 92 105 Phosphorylation (STY); Deamidation (NQ)
K.D(+45.99)AIAQR.C Y 18.95 718.3432 6 23.5 719.3674 1 86.49 3 52705 AEV_3_3_RA3_01_1233.d 0 1 1 380 385 Beta-methylthiolation (ND)
K.EGVITVKDGK(+42.01).T Y 18.76 1086.5920 10 -17.4 363.1983 3 31.73 2 11518 AEV_1_3_RA2_01_1232.d 0 1 1 212 221 Acetylation (K)
K.DGVT(+79.97)VAK(+42.01).A Y 18.67 810.3524 7 8.2 811.3663 1 58.94 2 25194 AEV_1_3_RA2_01_1232.d 3.1E5 1 1 92 98 Phosphorylation (STY); Acetylation (K)
K.AVN(+162.05)LQDK.F Y 18.30 948.4763 7 4.6 949.4879 1 89.33 3 54341 AEV_3_3_RA3_01_1233.d 0 1 1 99 105 Hexose (NSY)
K.N(+42.01)VAAGC(+57.02)NPMD(-18.01)LR.R Y 17.95 1340.5966 12 -31.2 671.2847 2 69.39 1 33487 AEV 2_3_RA2_01_1224.d 0 1 1 146 157 Acetylation (N-term); Carbamidomethylation; Dehydration
K.G(+226.08)RNVLIESPYGSPK.I Y 17.89 1741.8821 14 -38.2 581.6124 3 57.36 2 24289 AEV_1_3_RA2_01_1232.d 6.76E4 1 1 75 88 Biotinylation
R.ALVLSSASSASSTR(-.98).A Y 17.85 1334.7153 14 -11.2 334.6824 4 18.11 3 6818 AEV_3_3_RA3_01_1233.d 0 1 1 10 23 Amidation
K.GEYVDMIGAGIVDPLKVVR.T Y 17.72 2030.0870 19 2.4 677.7046 3 84.79 2 44168 AEV_1_3_RA2_01_1232.d 0 1 1 528 546
K.N(+42.01)VAAGC(+57.02)NPMDLR(+14.02).R Y 17.60 1372.6228 12 -7.1 344.1606 4 60.75 1 27081 AEV 2_3_RA2_01_1224.d 7.28E5 1 1 146 157 Acetylation (N-term); Carbamidomethylation; Methylation(KR)
K.KD(+21.98)RVVDALNATR.A Y 17.54 1378.7292 12 -11.2 460.5786 3 60.27 2 26061 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 434 445 Sodium adduct
K.ATPDMLGSTGSITITKEDTIILNGEGSK.D Y 17.52 2848.4375 28 68.0 570.7335 5 113.35 1 59711 AEV 2_3_RA2_01_1224.d 0 1 1 352 379
R.S(+79.96)AGVGLQQQR.F Y 17.46 1122.5088 10 98.2 375.2136 3 30.80 3 13853 AEV_3_3_RA3_01_1233.d 0 1 1 31 40 Sulfation
K.AVNLQD(-18.01)K(+14.02)FENLGAR.L Y 17.37 1569.8263 14 5.0 524.2853 3 67.83 3 38518 AEV_3_3_RA3_01_1233.d 0 1 1 99 112 Dehydration; Methylation(KR)
R.N(+42.01)VLIES(-18.01)PYGSPK.I Y 17.24 1326.6819 12 21.5 332.6849 4 31.99 2 11640 AEV_1_3_RA2_01_1232.d 2.34E4 1 1 77 88 Acetylation (N-term); Dehydration
K.DGKT(+79.97)IDDE(+21.98)LEVTEGMR.F Y 17.15 1908.7788 16 -24.4 955.3734 2 96.51 1 54095 AEV 2_3_RA2_01_1224.d 0 1 1 219 234 Phosphorylation (STY); Sodium adduct
K.EDTIILNGEGSK(+14.02).D Y 17.05 1288.6510 12 -96.0 645.2709 2 77.18 1 39682 AEV 2_3_RA2_01_1224.d 2.21E5 1 1 368 379 Methylation(KR)
K.AVN(+.98)LQDK(+14.02)FENLGAR.L Y 17.00 1588.8209 14 -0.6 530.6140 3 69.08 3 39521 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 99 112 Deamidation (NQ); Methylation(KR)
K.AVTTT(+79.97)LGPK(+42.01).G Y 16.99 1008.4893 9 17.4 337.1762 3 56.12 1 23909 AEV 2_3_RA2_01_1224.d 6.25E4 1 1 66 74 Phosphorylation (STY); Acetylation (K)
K.DGVTVAK(+21.98)(+42.01).A Y 16.95 752.3680 7 -71.2 377.1645 2 24.69 1 6412 AEV 2_3_RA2_01_1224.d 7.5E4 1 1 92 98 Sodium adduct; Acetylation (K)
K.DR(+14.02)VVD(+21.98)ALNATR.A Y 16.93 1264.6499 11 83.2 317.1960 4 11.90 2 3183 AEV_1_3_RA2_01_1232.d 0 1 1 435 445 Methylation(KR); Sodium adduct
R.S(+79.97)VISDPATSD(-18.01)YEK.E Y 16.65 1472.6072 13 -20.2 737.2960 2 97.38 1 54604 AEV 2_3_RA2_01_1224.d 4.8E4 1 1 391 403 Phosphorylation (STY); Dehydration
R.FDRGYVSPYFITDTK(+14.02).A Y 16.59 1821.8937 15 10.6 608.3116 3 74.24 2 36057 AEV_1_3_RA2_01_1232.d 4.37E4 1 1 235 249 Methylation(KR)
R.SAGVGLQQQRFAHK(+14.02).E Y 16.55 1539.8270 14 10.0 514.2881 3 63.11 3 34829 AEV_3_3_RA3_01_1233.d 2.03E4 1 1 31 44 Methylation(KR)
K.A(+175.04)VTTTLGPK.G Y 16.52 1061.5546 9 1.2 354.8592 3 60.97 2 26507 AEV_1_3_RA2_01_1232.d 7.32E5 1 1 66 74 Naphthalene-2,3-dicarboxaldehyde
K.DAIAQRC(+57.02)EQIRS(+79.97)VIS(+79.97)DPATSDYEK(+14.02).E Y 16.50 2925.2617 24 -5.4 732.3187 4 86.58 1 47023 AEV 2_3_RA2_01_1224.d 2.45E5 1 1 380 403 Carbamidomethylation; Phosphorylation (STY); Methylation(KR)
K.DGVTVAKAVNLQD(-18.01)K.F Y 16.36 1438.7780 14 9.6 360.7052 4 39.04 2 15004 AEV_1_3_RA2_01_1232.d 4.99E4 1 1 92 105 Dehydration
K.D(+42.01)RVVDALNATR.A Y 16.24 1270.6630 11 1.4 318.6735 4 17.68 3 6575 AEV_3_3_RA3_01_1233.d 4.5E5 1 1 435 445 Acetylation (N-term)
K.AQKVEF(+31.99)EKPLILLS(+79.97)EK.K Y 16.00 1983.0328 16 -79.1 661.9659 3 90.42 1 49927 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 250 265 Dihydroxy; Phosphorylation (STY)
K.AVTTTLGPK(+14.02).G Y 15.93 900.5280 9 -50.5 451.2485 2 46.04 2 18451 AEV_1_3_RA2_01_1232.d 0 1 1 66 74 Methylation(KR)
K.I(+42.01)TK(+42.01)DGVT(+79.97)VAK.A Y 15.92 1194.5897 10 -4.2 598.2996 2 27.61 3 12026 AEV_3_3_RA3_01_1233.d 2.68E4 1 1 89 98 Acetylation (N-term); Acetylation (K); Phosphorylation (STY)
K.GIDTLAK(+21.98).A Y 15.83 738.3888 7 -1.4 370.2012 2 18.71 3 7148 AEV_3_3_RA3_01_1233.d 0 1 1 59 65 Sodium adduct
R.ALVLSS(+162.05)ASSASSTR(+14.02).A Y 15.81 1511.7678 14 0.5 504.9301 3 65.06 2 29291 AEV_1_3_RA2_01_1232.d 9.62E4 1 1 10 23 Hexose (NSY); Methylation(KR)
K.AVTTTLGPK(+43.99).G Y 15.80 930.5022 9 6.7 311.1768 3 32.95 3 15117 AEV_3_3_RA3_01_1233.d 0 1 1 66 74 Carboxylation (DKW)
K.EGVITVK(+42.01)DGK(+226.08).T Y 15.73 1312.6697 10 59.9 329.1944 4 18.84 3 7214 AEV_3_3_RA3_01_1233.d 9.96E4 1 1 212 221 Acetylation (K); Biotinylation
K.LISNAMEK(+42.01)VGK(+42.01).E Y 15.63 1272.6748 11 -30.0 637.3256 2 60.79 3 33021 AEV_3_3_RA3_01_1233.d 4.92E4 1 1 201 211 Acetylation (K)
K.VGGASEIEVGEK(+14.02).K Y 15.58 1187.6034 12 -69.4 594.7678 2 67.64 1 32146 AEV 2_3_RA2_01_1224.d 3.84E4 1 1 422 433 Methylation(KR)
R.GFDSAK.G Y 15.51 623.2914 6 -36.5 624.2759 1 53.65 2 22319 AEV_1_3_RA2_01_1232.d 0 1 1 522 527
K.DAIAQ(+.98)RC(+57.02)EQ(+.98)IRSVISDPATSDY(+79.97)EKEK.L Y 15.33 3090.3853 26 -21.0 773.5874 4 85.77 1 46394 AEV 2_3_RA2_01_1224.d 3.59E5 1 1 380 405 Deamidation (NQ); Carbamidomethylation; Phosphorylation (STY)
R.G(+42.01)IQSAVEAVVEYLQANK(+226.08).R Y 15.32 2086.0405 17 16.9 696.3658 3 92.09 3 55837 AEV_3_3_RA3_01_1233.d 0 1 1 159 175 Acetylation (N-term); Biotinylation
R.ALVLSSASSASSTR(+.98)APLSR.F Y 15.28 1860.9905 19 49.4 373.2238 5 38.39 3 18434 AEV_3_3_RA3_01_1233.d 0 1 1 10 28 Deamidation (R)
K.ITKDGVTVAK(+40.03)AVNLQDKFENLGAR.L Y 15.26 2626.4441 24 -42.2 526.2739 5 69.57 3 39909 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 89 112 Propionaldehyde +40
K.EDTIILN(+.98)GEGSK(+226.08).D Y 15.20 1501.6970 12 -31.1 501.5574 3 56.14 1 23913 AEV 2_3_RA2_01_1224.d 1.22E5 1 1 368 379 Deamidation (NQ); Biotinylation
K.DRVVDALN(-17.03)ATR.A Y 15.20 1211.6259 11 -7.0 303.9116 4 18.14 3 6828 AEV_3_3_RA3_01_1233.d 0 1 1 435 445 Ammonia-loss (N)
R.V(+43.01)VDALNAT(+79.97)R.A Y 15.20 1080.4965 9 -7.4 361.1701 3 53.85 1 22523 AEV 2_3_RA2_01_1224.d 2.62E5 1 1 437 445 Carbamylation; Phosphorylation (STY)
K.DGKTIDDELE(+21.98)VTEGMR.F Y 15.15 1828.8125 16 1.9 610.6126 3 79.50 1 41449 AEV 2_3_RA2_01_1224.d 7.34E4 1 1 219 234 Sodium adduct
K.V(+42.01)PAGSGAGGM(+15.99)GGGM(+15.99)GGMGGGMF Y 15.09 1872.7263 22 24.7 469.2004 4 58.74 1 25595 AEV 2_3_RA2_01_1224.d 3.94E5 1 1 574 595 Acetylation (N-term); Oxidation (M)
K.ITKDGVT(+79.97)VAK(+42.01).A Y 15.05 1152.5791 10 -17.8 577.2866 2 51.25 2 21083 AEV_1_3_RA2_01_1232.d 9.96E4 1 1 89 98 Phosphorylation (STY); Acetylation (K)
total 122 peptides
C1GE52
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.LGFAGNDSPSFVFPTAIATK.S Y 149.46 2039.0364 20 1.9 1020.5274 2 85.74 2 44816 AEV_1_3_RA2_01_1232.d 6.26E5 3 3 19 38
K.SAGGVGGGSGAGRPAVANKPSFLSGGAASAGSQLSAK.R Y 123.40 3185.6177 37 3.4 797.4144 4 66.93 2 30601 AEV_1_3_RA2_01_1232.d 4.22E5 2 2 39 75
R.DITHFVQNLLR.E Y 100.74 1354.7357 11 5.4 452.5883 3 86.01 2 44986 AEV_1_3_RA2_01_1232.d 5.97E5 4 4 225 235
R.FLAPEIFFNPEIYSSDFLTPLPTVVDGVIQSSPIDVR.R Y 99.46 4122.1240 37 4.9 1375.0553 3 97.75 3 58324 AEV_3_3_RA3_01_1233.d 2.74E4 1 1 297 333
K.NIVLSGGSTLYKDFGR.R Y 95.77 1725.9049 16 -0.3 576.3087 3 76.95 2 38143 AEV_1_3_RA2_01_1232.d 3.01E5 3 3 339 354
K.AEYDEIGPSIVR.R Y 91.05 1347.6670 12 -3.7 674.8383 2 70.85 3 40913 AEV_3_3_RA3_01_1233.d 3.09E5 5 5 418 429
R.FALLGGPGST Y 90.20 918.4811 10 -1.0 919.4874 1 79.22 3 47470 AEV_3_3_RA3_01_1233.d 6.82E5 6 6 431 440
K.RGTEDLDFFIGDEAINASGGPGYGISYPIR.H Y 87.64 3186.5256 30 -10.7 1063.1711 3 86.67 2 45408 AEV_1_3_RA2_01_1232.d 1.73E5 1 1 76 105
R.HGPWFGGSLLGQTPEFR.S Y 84.67 1884.9270 17 -1.7 943.4692 2 81.06 3 48888 AEV_3_3_RA3_01_1233.d 1.33E5 2 2 395 411
R.FLAPEIFFNPEIYSSDFLTPLPTVVDGVIQSSPIDVRR.G Y 82.11 4278.2251 38 5.5 1427.0901 3 97.59 3 58239 AEV_3_3_RA3_01_1233.d 8.45E4 2 2 297 334
R.SLTGTVIDSGDGVTHVIPVAEGYVIGSSIK.S Y 77.24 2970.5549 30 1.1 991.1934 3 85.21 3 51833 AEV_3_3_RA3_01_1233.d 3.25E5 2 2 188 217
R.GLYKNIVLSGGSTLYKDFGR.R Y 77.12 2187.1687 20 -11.4 547.7932 4 80.15 2 40684 AEV_1_3_RA2_01_1232.d 1.33E5 1 1 335 354
K.SIPIAGRDITHFVQNLLR.E Y 75.89 2049.1482 18 4.3 513.2965 4 85.67 3 52145 AEV_3_3_RA3_01_1233.d 2.17E5 2 2 218 235
R.GTEDLDFFIGDEAINASGGPGYGISYPIR.H Y 71.02 3030.4246 29 7.6 1516.2311 2 90.10 2 47271 AEV_1_3_RA2_01_1232.d 2.07E5 2 2 77 105
R.DIKHLVDAR.I Y 67.73 1065.5930 9 -1.6 533.8029 2 44.87 3 22478 AEV_3_3_RA3_01_1233.d 5.25E5 3 3 359 367
R.TVTIDVGYER.F Y 65.93 1151.5823 10 3.9 576.8007 2 65.36 2 29501 AEV_1_3_RA2_01_1232.d 1.03E6 5 5 287 296
R.HGPWFGGSLLGQ(+.98)TPEFR.S Y 64.31 1885.9111 17 16.7 629.6548 3 81.58 2 41805 AEV_1_3_RA2_01_1232.d 6.96E4 1 1 395 411 Deamidation (NQ)
K.AEYDEIGPSIVRR.F Y 59.06 1503.7681 13 7.0 502.2668 3 65.79 3 36900 AEV_3_3_RA3_01_1233.d 0 1 1 418 430
R.RFALLGGPGST Y 54.99 1074.5822 11 -13.4 538.2911 2 73.07 2 35242 AEV_1_3_RA2_01_1232.d 2.87E5 4 4 430 440
R.SYC(+57.02)HTKAEYDEIGPSIVR.R Y 41.16 2123.9946 18 -27.0 531.9916 4 64.29 2 28754 AEV_1_3_RA2_01_1232.d 1.68E5 2 2 412 429 Carbamidomethylation
R.SLTGT(-2.02)VIDSGDGVTHVIPVAEGYVIGSSIK.S Y 40.14 2968.5393 30 3.2 990.5236 3 85.52 2 44665 AEV_1_3_RA2_01_1232.d 7.51E3 1 1 188 217 2-amino-3-oxo-butanoic_acid
K.HTVTSPN(+.98)GR.T Y 39.72 968.4675 9 -84.9 485.2000 2 23.12 1 5778 AEV 2_3_RA2_01_1224.d 7.72E4 2 2 278 286 Deamidation (NQ)
K.LGFAGNDSPSFVFPTAIATK(+14.02).S Y 35.68 2053.0520 20 -1.9 1027.5314 2 86.04 3 52403 AEV_3_3_RA3_01_1233.d 3.93E4 2 2 19 38 Methylation(KR)
M.A(+42.01)AQTPAVVMDNGTGFSK.L Y 30.46 1734.8247 17 13.8 868.4316 2 77.37 2 38464 AEV_1_3_RA2_01_1232.d 3.8E4 1 1 2 18 Acetylation (Protein N-term)
R.QEADSSM(+15.99)K.T Y 29.70 910.3702 8 12.1 911.3884 1 99.36 1 55458 AEV 2_3_RA2_01_1224.d 1.66E5 2 2 238 245 Oxidation (M)
MAAQTPAVVMDNGTGFS(+162.05)K.L Y 29.47 1985.9073 18 -47.7 398.1698 5 31.49 1 9798 AEV 2_3_RA2_01_1224.d 0 1 1 1 18 Hexose (NSY)
R.ASEAR.S N 28.07 532.2605 5 -18.6 533.2579 1 67.50 3 38259 AEV_3_3_RA3_01_1233.d 9.61E4 3 3 370 374
R.HGPWFGGSLLGQTPEFR(+14.02).S Y 26.16 1898.9427 17 16.3 633.9985 3 83.04 2 42908 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 395 411 Methylation(KR)
R.SGGLEVQVITHK.R Y 25.04 1266.6931 12 -4.5 423.2364 3 58.32 3 31175 AEV_3_3_RA3_01_1233.d 2.23E5 3 3 380 391
R.SGGAR(-.98).S Y 24.65 445.2397 5 36.6 446.2633 1 62.95 2 27851 AEV_1_3_RA2_01_1232.d 0 1 1 375 379 Amidation
K.VK(+14.02)EEYC(+57.02)Y(-18.01)VC(+57.02)PDIVKEFAR.Y Y 23.67 2300.0969 18 58.1 576.0649 4 77.40 2 38487 AEV_1_3_RA2_01_1232.d 5.4E4 1 1 250 267 Methylation(KR); Carbamidomethylation; Dehydration
K.H(+15.99)LVDAR.I Y 23.23 725.3820 6 -13.0 363.6936 2 73.39 3 43007 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 362 367 Oxidation (HW)
R.Q(+.98)EADSSM(+15.99)K.T Y 23.14 911.3542 8 26.2 456.6963 2 38.31 1 13450 AEV 2_3_RA2_01_1224.d 0 1 1 238 245 Deamidation (NQ); Oxidation (M)
K.HTVTSPNGR.T Y 22.31 967.4835 9 -98.2 484.7015 2 22.40 1 5529 AEV 2_3_RA2_01_1224.d 5.13E4 1 1 278 286
R.S(+27.99)GGAR.S Y 21.93 474.2186 5 2.9 475.2273 1 17.09 3 6255 AEV_3_3_RA3_01_1233.d 0 1 1 375 379 Formylation
R.FALLGGPGST(-2.02) Y 21.38 916.4654 10 -21.5 917.4530 1 79.27 3 47500 AEV_3_3_RA3_01_1233.d 3.34E4 1 1 431 440 2-amino-3-oxo-butanoic_acid
R.DITHFVQNLLR(+14.02).E Y 21.35 1368.7513 11 -107.6 457.2086 3 95.69 1 53581 AEV 2_3_RA2_01_1224.d 8.09E4 1 1 225 235 Methylation(KR)
R.DIK(+43.01)HLVDAR.I Y 20.58 1108.5989 9 -2.0 370.5395 3 48.00 2 19442 AEV_1_3_RA2_01_1232.d 3.44E4 1 1 359 367 Carbamylation
R.Q(+42.01)EADS(-18.01)SMKTAEK.V Y 20.52 1347.5977 12 67.8 450.2370 3 15.35 3 5320 AEV_3_3_RA3_01_1233.d 0 1 1 238 249 Acetylation (N-term); Dehydration
R.H(+27.99)GPWFGGSLLGQTPEFR.S Y 20.24 1912.9220 17 -11.3 479.2324 4 78.96 1 41019 AEV 2_3_RA2_01_1224.d 0 1 1 395 411 Formylation
K.NIVLSGGSTLYK.D Y 20.03 1250.6870 12 45.6 417.9219 3 64.95 2 29214 AEV_1_3_RA2_01_1232.d 3.32E5 1 1 339 350
K.HLVD(-18.01)AR.I Y 19.46 691.3765 6 -32.2 692.3615 1 83.53 2 43267 AEV_1_3_RA2_01_1232.d 1.41E5 2 2 362 367 Dehydration
R.S(+79.96)GGLEVQVITHKR.Q Y 19.32 1502.7511 13 40.8 376.7104 4 52.18 2 21615 AEV_1_3_RA2_01_1232.d 1.87E5 1 1 380 392 Sulfation
R.S(+79.97)GGLEVQVITHKR.Q Y 19.27 1502.7606 13 51.7 376.7169 4 49.00 3 25083 AEV_3_3_RA3_01_1233.d 0 1 1 380 392 Phosphorylation (STY)
M(+15.99)AAQ(+.98)TPAVVMDNGTGFSK.L Y 19.09 1840.8335 18 -1.4 461.2150 4 77.39 1 39765 AEV 2_3_RA2_01_1224.d 0 1 1 1 18 Oxidation (M); Deamidation (NQ)
R.Q(-17.03)RHGPWFGGSLLGQTPEFR(+14.02).S Y 18.41 2166.0759 19 25.9 723.0513 3 82.71 2 42663 AEV_1_3_RA2_01_1232.d 0 1 1 393 411 Pyro-glu from Q; Methylation(KR)
R.ERQEADSSMK(+42.01)TAEKVK.E Y 18.34 1877.9153 16 20.0 376.5978 5 37.26 2 14154 AEV_1_3_RA2_01_1232.d 6.38E4 1 1 236 251 Acetylation (K)
R.SGGAR.S Y 18.18 446.2237 5 -13.2 447.2251 1 32.75 2 12005 AEV_1_3_RA2_01_1232.d 0 1 1 375 379
K.SIPIAGR(+37.96).D Y 18.12 750.3790 7 10.0 751.3938 1 77.85 2 38847 AEV_1_3_RA2_01_1232.d 0 1 1 218 224 Replacement of proton by potassium
R.GLYKNIVLS(-2.02)GGSTLYKDFGR.R Y 18.09 2185.1531 20 3.6 547.2975 4 79.43 3 47627 AEV_3_3_RA3_01_1233.d 0 1 1 335 354 2-amino-3-oxo-butanoic_acid
R.S(+226.08)GGAR.S Y 17.69 672.3013 5 -85.3 673.2513 1 60.99 1 27213 AEV 2_3_RA2_01_1224.d 0 1 1 375 379 Biotinylation
R.SGGLEVQVITHK(+43.01).R Y 17.31 1309.6990 12 -27.2 328.4231 4 25.14 1 6597 AEV 2_3_RA2_01_1224.d 3.57E5 1 1 380 391 Carbamylation
R.RGLYKN(+.98)IVLSGGSTLYK(+42.01).D Y 16.96 1911.0465 17 6.8 383.2192 5 63.46 2 28194 AEV_1_3_RA2_01_1232.d 0 1 1 334 350 Deamidation (NQ); Acetylation (K)
K.HLVDAR(-.98).I Y 16.83 708.4031 6 -171.0 355.1483 2 53.79 1 22419 AEV 2_3_RA2_01_1224.d 0 1 1 362 367 Amidation
K.N(+.98)IVLS(-18.01)GGSTLYK.D Y 16.79 1233.6605 12 5.3 412.2296 3 63.99 2 28552 AEV_1_3_RA2_01_1232.d 0 1 1 339 350 Deamidation (NQ); Dehydration
K.SIPIAGR(+28.03).D Y 16.36 740.4545 7 -14.0 371.2293 2 78.00 2 38975 AEV_1_3_RA2_01_1232.d 2.26E4 1 1 218 224 Dimethylation(KR)
R.D(+27.99)ITHFVQ(+.98)NLLRER.Q Y 16.21 1668.8583 13 -10.6 557.2875 3 69.39 3 39763 AEV_3_3_RA3_01_1233.d 5.42E4 1 1 225 237 Formylation; Deamidation (NQ)
R.ASEARSGGAR.S Y 16.10 960.4736 10 -107.7 321.1307 3 21.38 1 5182 AEV 2_3_RA2_01_1224.d 0 1 1 370 379
R.ASE(+21.98)ARSGGAR.S Y 16.06 982.4556 10 -33.9 492.2184 2 73.46 1 36652 AEV 2_3_RA2_01_1224.d 0 1 1 370 379 Sodium adduct
R.ERQEADSSMKTAEKVK.E Y 15.21 1835.9047 16 -3.0 612.9736 3 55.61 3 29292 AEV_3_3_RA3_01_1233.d 5.56E4 1 1 236 251
R.S(+42.01)GGLEVQVITHK(+21.98).R Y 15.19 1330.6857 12 0.1 333.6787 4 30.36 2 10901 AEV_1_3_RA2_01_1232.d 1.45E5 1 1 380 391 Acetylation (N-term); Sodium adduct
total 61 peptides
C1GA13
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AFEHTADYDEAISDFFR.K Y 122.05 2032.8802 17 1.8 678.6353 3 82.99 2 42864 AEV_1_3_RA2_01_1232.d 4.09E5 5 5 206 222
R.YGANPHQKPAC(+57.02)AFTR.Q Y 112.79 1716.8154 15 4.8 573.2819 3 40.21 2 15569 AEV_1_3_RA2_01_1232.d 1.17E6 5 5 236 250 Carbamidomethylation
K.HVSPAGAAIGVPLNEK.E Y 109.65 1558.8467 16 1.3 520.6235 3 64.51 2 28903 AEV_1_3_RA2_01_1232.d 3.39E5 2 2 295 310
K.YLVLQMDETYAPPTEETR.T Y 103.80 2155.0144 18 -0.4 1078.5140 2 79.71 3 47853 AEV_3_3_RA3_01_1233.d 5.64E4 1 1 391 408
K.YATDTQYIPLR.Y Y 102.56 1339.6772 11 -4.5 670.8429 2 69.57 3 39903 AEV_3_3_RA3_01_1233.d 4.98E5 2 2 225 235
R.VTILSDPKDYPEFLQELEAGDVSEK.K Y 100.05 2821.3909 25 0.5 941.4714 3 86.81 3 52901 AEV_3_3_RA3_01_1233.d 2.49E5 2 2 173 197
R.EVSDGVIAPGYC(+57.02)PDAIALLSK.K Y 97.03 2174.0928 21 1.3 1088.0551 2 84.58 2 44041 AEV_1_3_RA2_01_1232.d 2.69E5 2 2 365 385 Carbamidomethylation
K.FTTELPASAQR.D Y 96.59 1219.6196 11 4.3 610.8197 2 60.80 2 26424 AEV_1_3_RA2_01_1232.d 5.03E5 5 5 438 448
K.SNAIDLLC(+57.02)SGQVPR.D Y 94.94 1528.7667 14 -2.5 765.3887 2 76.03 3 44947 AEV_3_3_RA3_01_1233.d 3.99E5 6 6 520 533 Carbamidomethylation
R.MSSFGDLIALSDIVDVPTAK.I Y 93.62 2078.0605 20 1.9 1040.0396 2 91.41 3 55485 AEV_3_3_RA3_01_1233.d 6.04E5 5 5 341 360
K.VYMVDDVAGIDESGLAQAYAR.A Y 93.17 2242.0576 21 -2.4 1122.0334 2 82.47 3 49936 AEV_3_3_RA3_01_1233.d 1.41E5 2 2 314 334
R.M(+15.99)SSFGDLIALSDIVDVPTAK.I Y 90.19 2094.0554 20 4.2 1048.0394 2 90.08 3 54758 AEV_3_3_RA3_01_1233.d 8.83E4 1 1 341 360 Oxidation (M)
K.KVYMVDDVAGIDESGLAQAYAR.A Y 85.63 2370.1526 22 8.3 791.0647 3 79.34 2 40038 AEV_1_3_RA2_01_1232.d 9.17E4 1 1 313 334
K.VLC(+57.02)GAPGYINLLDALNAWPLVK.E Y 81.37 2396.2925 22 -0.9 1199.1525 2 96.37 3 57795 AEV_3_3_RA3_01_1233.d 1.89E5 4 4 258 279 Carbamidomethylation
K.KYATDTQYIPLR.Y Y 81.30 1467.7721 12 -0.9 490.2642 3 63.88 3 35411 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 224 235
R.NIESDEQDLAAQK.I Y 75.62 1459.6791 13 0.2 730.8470 2 58.19 3 31080 AEV_3_3_RA3_01_1233.d 2.04E5 4 4 111 123
R.EAGFPVEDVSAITHAPEMLGGR.V Y 74.52 2282.1001 22 19.7 761.7223 3 82.78 3 50153 AEV_3_3_RA3_01_1233.d 0 1 1 74 95
R.NIESDEQDLAAQKISK.V Y 74.03 1787.8900 16 2.6 596.9722 3 62.19 3 34116 AEV_3_3_RA3_01_1233.d 8.71E4 1 1 111 126
K.QALGYPAAASFK.H Y 69.69 1222.6345 12 -1.3 612.3237 2 67.34 3 38123 AEV_3_3_RA3_01_1233.d 3.74E5 3 3 283 294
K.SAILSVYDKTGLLDLAK.G Y 61.39 1806.0138 17 19.4 603.0236 3 81.49 3 49206 AEV_3_3_RA3_01_1233.d 2.76E4 2 2 37 53
R.DLTVATIALK.Y Y 54.11 1043.6227 10 1.7 522.8195 2 77.19 3 45848 AEV_3_3_RA3_01_1233.d 1.17E5 2 2 449 458
K.YTQSNSVC(+57.02)YALNGQVIGLGAGQQSR.I Y 53.11 2670.2820 25 2.5 891.1035 3 78.29 2 39205 AEV_1_3_RA2_01_1232.d 1.45E5 1 1 459 483 Carbamidomethylation
R.LLASGGTAK.L Y 46.77 816.4705 9 -37.3 409.2273 2 19.60 3 7630 AEV_3_3_RA3_01_1233.d 8.03E4 3 3 62 70
R.VTILSDPKDYPEFLQELEAGD(+14.02)VSEK.K Y 46.49 2835.4065 25 6.6 946.1490 3 87.75 3 53450 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 173 197 Methylation(others)
K.YATDTQ(+.98)YIPLR.Y Y 45.94 1340.6613 11 -1.7 671.3368 2 70.90 3 40945 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 225 235 Deamidation (NQ)
K.SNAIDLLC(+57.02)SGQ(+.98)VPR.D Y 45.54 1529.7507 14 -4.7 765.8790 2 77.09 3 45767 AEV_3_3_RA3_01_1233.d 4.96E4 1 1 520 533 Carbamidomethylation; Deamidation (NQ)
K.AFEHTADYDE(+14.02)AISDFFR.K Y 44.84 2046.8959 17 3.9 683.3086 3 83.15 3 50417 AEV_3_3_RA3_01_1233.d 2.34E4 1 1 206 222 Methylation(others)
K.S(-2.02)AILSVYDKTGLLDLAK.G Y 42.29 1803.9982 17 -40.5 602.3157 3 81.36 3 49104 AEV_3_3_RA3_01_1233.d 5.69E4 1 1 37 53 2-amino-3-oxo-butanoic_acid
R.TVYGIQLSQR.H Y 42.25 1163.6299 10 2.4 582.8236 2 65.32 3 36527 AEV_3_3_RA3_01_1233.d 2.84E5 5 5 409 418
K.T(-2.02)LHPAVHGGILAR.N Y 39.25 1338.7521 13 -53.4 447.2341 3 52.08 3 27111 AEV_3_3_RA3_01_1233.d 0 1 1 98 110 2-amino-3-oxo-butanoic_acid
R.LAGDKADNWWMR.F Y 34.78 1461.6823 12 71.6 488.2696 3 69.77 3 40053 AEV_3_3_RA3_01_1233.d 0 1 1 489 500
R.N(+27.99)IESDEQDLAAQ(+.98)K.I Y 34.70 1488.6580 13 -12.9 745.3267 2 74.04 1 37117 AEV 2_3_RA2_01_1224.d 8.12E4 1 1 111 123 Formylation; Deamidation (NQ)
K.KVYMVDDVAGIDESGLAQ(+.98)AYAR.A Y 34.55 2371.1365 22 11.3 791.3950 3 79.04 3 47313 AEV_3_3_RA3_01_1233.d 5.21E4 1 1 313 334 Deamidation (NQ)
K.ELKQ(+.98)ALGYPAAASFK.H Y 33.67 1593.8402 15 -11.1 532.2814 3 69.06 2 32137 AEV_1_3_RA2_01_1232.d 2.32E5 2 2 280 294 Deamidation (NQ)
R.YGANPHQKPAC(+57.02)AFTR(+14.02).Q Y 31.07 1730.8311 15 6.9 433.7180 4 41.60 3 20397 AEV_3_3_RA3_01_1233.d 2.12E5 2 2 236 250 Carbamidomethylation; Methylation(KR)
K.IITPK.F Y 30.66 570.3741 5 -83.1 571.3340 1 20.27 3 7956 AEV_3_3_RA3_01_1233.d 4.88E4 2 2 433 437
R.YGANPHQ(+.98)KPAC(+57.02)AFTR.Q Y 29.87 1717.7994 15 0.0 573.6071 3 40.67 3 19792 AEV_3_3_RA3_01_1233.d 3.04E4 1 1 236 250 Deamidation (NQ); Carbamidomethylation
K.YLVLQ(+.98)MDETYAPPTEETR.T Y 29.45 2155.9983 18 10.1 1079.0173 2 80.03 2 40589 AEV_1_3_RA2_01_1232.d 5.93E4 1 1 391 408 Deamidation (NQ)
R.L(+42.01)AGDK.A Y 28.66 544.2856 5 -24.6 545.2795 1 40.81 2 15851 AEV_1_3_RA2_01_1232.d 4.01E4 1 1 489 493 Acetylation (N-term)
R.LLASGGT(-18.01)AK.L Y 28.32 798.4599 9 -28.2 400.2260 2 57.17 2 24186 AEV_1_3_RA2_01_1232.d 0 1 1 62 70 Dehydration
R.Y(-18.01)GANPHQK(+14.02)PAC(+57.02)AFTR.Q Y 27.03 1712.8206 15 77.6 429.2456 4 40.18 2 15559 AEV_1_3_RA2_01_1232.d 0 2 2 236 250 Dehydration; Methylation(KR); Carbamidomethylation
K.VY(+183.04)MVDDVAGIDESGLAQAYAR.A Y 24.38 2425.0930 21 22.3 607.2941 4 73.04 3 42620 AEV_3_3_RA3_01_1233.d 0 1 1 314 334 Aminoethylbenzenesulfonylation
R.LAGDK.A Y 24.16 502.2751 5 -68.4 503.2480 1 45.93 1 17825 AEV 2_3_RA2_01_1224.d 4.78E4 2 2 489 493
K.SLNAK.E Y 23.61 531.3016 5 -127.5 532.2411 1 70.50 1 34346 AEV 2_3_RA2_01_1224.d 8.45E4 1 1 14 18
R.YFFEK(-.98).M Y 23.60 731.3642 5 -102.7 732.2964 1 111.96 1 59332 AEV 2_3_RA2_01_1224.d 2.46E5 1 1 28 32 Amidation
R.LLASGGTAK(+21.98)(+42.01).L Y 23.51 880.4630 9 -24.6 881.4486 1 80.48 2 40956 AEV_1_3_RA2_01_1232.d 0 1 1 62 70 Sodium adduct; Acetylation (K)
K.SN(+.98)AIDLLCSGQVPR.D Y 23.24 1472.7292 14 -34.0 369.1771 4 74.21 1 37246 AEV 2_3_RA2_01_1224.d 0 1 1 520 533 Deamidation (NQ)
K.VDYIVC(+57.02)NLYPFK.Q Y 23.10 1529.7588 12 7.4 510.9307 3 62.09 2 27249 AEV_1_3_RA2_01_1232.d 0 1 1 127 138 Carbamidomethylation
R.VT(+79.97)ILS(-18.01)DPK.D Y 22.98 933.4572 8 15.9 312.1646 3 15.00 2 4341 AEV_1_3_RA2_01_1232.d 3.09E4 1 1 173 180 Phosphorylation (STY); Dehydration
R.E(+14.02)VSDGVIAPGYC(+57.02)PDAIALLSK.K Y 22.83 2188.1084 21 -4.0 1095.0571 2 84.58 3 51421 AEV_3_3_RA3_01_1233.d 6.66E4 2 2 365 385 Methylation(others); Carbamidomethylation
K.SN(+.98)AIDLLC(+57.02)SGQVPR.D Y 22.76 1529.7507 14 -56.7 510.8953 3 80.90 1 42535 AEV 2_3_RA2_01_1224.d 2.12E4 1 1 520 533 Deamidation (NQ); Carbamidomethylation
K.FTTELPAS(+79.97)AQ(+.98)R.D Y 22.43 1300.5701 11 46.1 326.1648 4 42.58 1 15908 AEV 2_3_RA2_01_1224.d 0 1 1 438 448 Phosphorylation (STY); Deamidation (NQ)
K.TGLLDLAKGLVK.H Y 22.33 1226.7598 12 7.0 307.6994 4 64.57 2 28953 AEV_1_3_RA2_01_1232.d 2.83E5 1 1 46 57
K.WLAQLGEVAVSSDAFFPFTDNVFR.A Y 21.63 2715.3333 24 13.0 906.1301 3 96.52 3 57866 AEV_3_3_RA3_01_1233.d 3.17E4 1 1 562 585
K.FTTE(+14.02)LPASAQR.D Y 21.02 1233.6354 11 -5.9 617.8214 2 62.96 3 34711 AEV_3_3_RA3_01_1233.d 4.18E4 1 1 438 448 Methylation(others)
K.Q(-17.03)ALGYPAAASFK.H Y 20.45 1205.6080 12 -89.9 603.7571 2 81.54 1 43062 AEV 2_3_RA2_01_1224.d 1.11E5 1 1 283 294 Pyro-glu from Q
R.HNDILIKPHESFNKIITPK.F Y 20.35 2243.2427 19 -9.3 561.8127 4 79.30 2 40003 AEV_1_3_RA2_01_1232.d 3.44E4 1 1 419 437
K.HVS(+79.97)PAGAAIGVPLNEK.E Y 19.42 1638.8130 16 49.8 410.7309 4 55.32 3 29133 AEV_3_3_RA3_01_1233.d 0 1 1 295 310 Phosphorylation (STY)
K.SNAIDLLC(+57.02)SGQVPRDGVER(+14.02).V Y 19.25 2099.0430 19 31.3 525.7844 4 92.84 1 51648 AEV 2_3_RA2_01_1224.d 4.24E4 1 1 520 538 Carbamidomethylation; Methylation(KR)
K.MAQK(+14.02)SAILSVYDK.T Y 18.96 1466.7803 13 -16.1 367.6964 4 33.58 2 12397 AEV_1_3_RA2_01_1232.d 9.95E4 1 1 33 45 Methylation(KR)
K.RPEK(+42.01)SN(+203.08)AIDLLC(+57.02)SGQVPR.D Y 18.80 2284.1482 18 -8.1 762.3839 3 76.49 2 37778 AEV_1_3_RA2_01_1232.d 1.41E5 1 1 516 533 Acetylation (K); HexNAcylation (N); Carbamidomethylation
K.HVSPAGAAIGVPLNEK(+14.02).E Y 18.71 1572.8623 16 -3.1 525.2931 3 68.26 2 31551 AEV_1_3_RA2_01_1232.d 1.18E5 1 1 295 310 Methylation(KR)
K.SAILSVYDK.T Y 18.46 994.5334 9 -23.3 498.2624 2 16.45 3 5917 AEV_3_3_RA3_01_1233.d 0 1 1 37 45
K.N(+.98)HSRVTILSDPK.D Y 18.17 1366.7205 12 -37.1 342.6747 4 77.91 1 40187 AEV 2_3_RA2_01_1224.d 3.74E4 1 1 169 180 Deamidation (NQ)
K.HVS(+79.97)PAGAAIGVPLNEK(+42.01).E Y 17.99 1680.8236 16 34.9 421.2278 4 54.06 2 22528 AEV_1_3_RA2_01_1232.d 3.2E4 1 1 295 310 Phosphorylation (STY); Acetylation (K)
R.YFFEKM(+15.99)AQK.S Y 17.93 1206.5743 9 24.9 403.2087 3 45.22 3 22699 AEV_3_3_RA3_01_1233.d 4.01E5 1 1 28 36 Oxidation (M)
K.S(+42.01)LNAK(-.98).E Y 17.88 572.3282 5 7.4 573.3397 1 101.99 1 56373 AEV 2_3_RA2_01_1224.d 1.85E5 1 1 14 18 Acetylation (Protein N-term); Amidation
R.LAGD(-18.01)K.A Y 17.70 484.2645 5 -115.1 485.2161 1 45.82 1 17753 AEV 2_3_RA2_01_1224.d 1.89E4 2 2 489 493 Dehydration
K.RPEKSNAIDLLC(+57.02)S(+79.97)GQVPR(+14.02)DGVER(+14.02).V Y 17.52 2703.3164 23 7.4 541.6746 5 73.58 2 35556 AEV_1_3_RA2_01_1232.d 3.6E5 1 1 516 538 Carbamidomethylation; Phosphorylation (STY); Methylation(KR)
R.LLAS(+79.97)GGTAK.L Y 17.32 896.4368 9 10.7 449.2305 2 59.71 3 32201 AEV_3_3_RA3_01_1233.d 2.2E4 1 1 62 70 Phosphorylation (STY)
R.A(+43.01)ARSGAK(+42.01).Y Y 17.18 744.3878 7 -1.5 373.2006 2 20.06 2 6433 AEV_1_3_RA2_01_1232.d 0 2 2 586 592 Carbamylation; Acetylation (K)
R.LLASGGTAKLIR.E Y 17.03 1198.7397 12 8.2 600.3821 2 27.01 3 11713 AEV_3_3_RA3_01_1233.d 0 1 1 62 73
K.S(+28.03)NAIDLLC(+57.02)SGQVPR.D Y 16.85 1556.7981 14 3.6 390.2082 4 52.29 3 27244 AEV_3_3_RA3_01_1233.d 2.47E4 1 1 520 533 Ethylation; Carbamidomethylation
K.EFDRPAALR.Y Y 16.85 1073.5618 9 -96.3 358.8267 3 42.86 1 16076 AEV 2_3_RA2_01_1224.d 1.64E5 1 1 19 27
K.HVSPAGAAIGVPLNEKEKK.V Y 16.70 1944.0792 19 -68.4 486.9938 4 51.37 3 26614 AEV_3_3_RA3_01_1233.d 7.25E5 1 1 295 313
R.VEFEK(+159.04).V Y 16.44 809.3629 5 -34.5 810.3423 1 97.45 1 54648 AEV 2_3_RA2_01_1224.d 1.55E5 1 1 539 543 Membrane protein extraction
K.KSLNAKEFDRPAALR.Y Y 16.34 1714.9478 15 -14.1 429.7382 4 38.80 2 14896 AEV_1_3_RA2_01_1232.d 0 1 1 13 27
K.Q(+127.06)ALGYPAAASFK.H Y 16.12 1349.6979 12 30.2 450.9202 3 70.05 3 40267 AEV_3_3_RA3_01_1233.d 2.17E5 1 1 283 294 N-Succinimidyl-2-morpholine acetate
K.TLHPAVH(+15.99)GGILAR.N Y 16.03 1356.7626 13 -0.5 453.2612 3 54.59 3 28742 AEV_3_3_RA3_01_1233.d 0 1 1 98 110 Oxidation (HW)
K.Q(+.98)ALGYPAAASFK.H Y 16.03 1223.6185 12 -15.2 612.8073 2 65.80 3 36917 AEV_3_3_RA3_01_1233.d 7.7E4 1 1 283 294 Deamidation (NQ)
K.S(+162.05)LNAK.E Y 15.93 693.3544 5 12.2 694.3702 1 66.35 3 37350 AEV_3_3_RA3_01_1233.d 3.38E4 1 1 14 18 Hexose (NSY)
K.A(+226.08)NTKRPEKSNAIDLLC(+57.02)SGQVPR(+14.02).D Y 15.92 2693.3740 22 11.7 674.3586 4 82.13 2 42229 AEV_1_3_RA2_01_1232.d 0 1 1 512 533 Biotinylation; Carbamidomethylation; Methylation(KR)
R.GADR(+14.02)MSSFGDLIALSDIVDVPTAK.I Y 15.85 2491.2627 24 22.8 623.8372 4 63.97 2 28539 AEV_1_3_RA2_01_1232.d 4.16E4 1 1 337 360 Methylation(KR)
K.IITPK(-.98).F Y 15.84 569.3901 5 43.0 570.4218 1 102.10 2 51630 AEV_1_3_RA2_01_1232.d 8.16E4 1 1 433 437 Amidation
R.LLAS(+14.02)GGTAK.L Y 15.63 830.4861 9 29.4 831.5178 1 99.78 1 55623 AEV 2_3_RA2_01_1224.d 2.59E4 1 1 62 70 Methylation(others)
K.ADNWWMR.F Y 15.48 977.4178 7 -28.1 489.7024 2 50.97 1 20761 AEV 2_3_RA2_01_1224.d 8.91E4 1 1 494 500
R.A(+42.01)LN(+.98)LR.W N 15.23 628.3544 5 -49.0 315.1691 2 66.31 1 31109 AEV 2_3_RA2_01_1224.d 0 1 1 505 509 Acetylation (N-term); Deamidation (NQ)
R.EVSDGVIAPGYC(+57.02)PDAIALLSK(+14.02).K Y 15.22 2188.1084 21 -2.6 1095.0586 2 85.93 3 52324 AEV_3_3_RA3_01_1233.d 3.19E4 1 1 365 385 Carbamidomethylation; Methylation(KR)
R.L(+42.01)LASGGTAK(+21.98).L Y 15.14 880.4630 9 -25.1 441.2277 2 40.15 2 15538 AEV_1_3_RA2_01_1232.d 0 1 1 62 70 Acetylation (N-term); Sodium adduct
K.H(+42.01)VS(+79.97)PAGAAIGVPLNEK.E Y 15.01 1680.8236 16 21.5 421.2222 4 40.72 3 19824 AEV_3_3_RA3_01_1233.d 9.8E4 1 1 295 310 Acetylation (N-term); Phosphorylation (STY)
total 90 peptides
C1GAG3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AKDTVIPGPGTLELVYTPK.G Y 162.33 1998.1036 19 1.9 667.0431 3 79.20 2 39923 AEV_1_3_RA2_01_1232.d 1.51E6 5 5 219 237
R.NILGGTVFREPIVINRVPR.L Y 115.01 2149.2483 19 3.5 538.3212 4 78.60 2 39444 AEV_1_3_RA2_01_1232.d 1.11E6 4 4 179 197
K.NPVVELDGDEMTR.I Y 93.70 1473.6769 13 1.6 737.8469 2 68.44 3 39005 AEV_3_3_RA3_01_1233.d 1.16E5 2 2 101 113
R.DKTNDQVTIDSAEAIKK.Y Y 91.07 1874.9585 17 -0.3 469.7468 4 52.90 3 27640 AEV_3_3_RA3_01_1233.d 8.51E5 4 4 128 144
R.FKDIFQSIYESTYKK.S Y 91.03 1895.9668 15 2.8 475.0003 4 78.01 2 38980 AEV_1_3_RA2_01_1232.d 7.73E5 3 3 299 313
K.NPVVELDGDEM(+15.99)TR.I Y 81.81 1489.6719 13 0.3 745.8434 2 61.49 3 33575 AEV_3_3_RA3_01_1233.d 4.16E4 1 1 101 113 Oxidation (M)
R.NILGGTVFREPIVINR.V Y 79.22 1797.0260 16 -1.3 450.2632 4 79.19 3 47437 AEV_3_3_RA3_01_1233.d 1.94E5 3 3 179 194
R.HAFGDQYR.A Y 77.96 992.4464 8 14.1 497.2375 2 27.76 3 12104 AEV_3_3_RA3_01_1233.d 1.51E6 14 14 211 218
K.IVVKNPVVELDGDEMTR.I Y 77.45 1912.9928 17 -6.6 638.6674 3 73.82 3 43208 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 97 113
R.LVPGWKKPIIIGR.H Y 74.76 1475.9340 13 -4.6 492.9830 3 69.45 2 32436 AEV_1_3_RA2_01_1232.d 1.05E6 5 5 198 210
K.DTVIPGPGTLELVYTPK.G Y 74.37 1798.9717 17 -21.7 900.4736 2 84.40 2 43958 AEV_1_3_RA2_01_1232.d 2.3E5 3 3 221 237
K.TNDQVTIDSAEAIKK.Y Y 64.00 1631.8365 15 0.5 544.9531 3 56.76 3 30036 AEV_3_3_RA3_01_1233.d 4.12E5 3 3 130 144
R.ETSTNPIASIFAWTR.G Y 62.88 1692.8472 15 -0.7 847.4303 2 88.82 3 54061 AEV_3_3_RA3_01_1233.d 3.55E5 3 3 400 414
R.FKDIFQSIYESTYK.K Y 59.13 1767.8719 14 7.1 590.3021 3 81.38 2 41648 AEV_1_3_RA2_01_1232.d 2.77E4 1 1 299 312
R.AKDT(-2.02)VIPGPGTLELVYTPK.G Y 59.00 1996.0880 19 -38.8 666.3441 3 79.16 2 39891 AEV_1_3_RA2_01_1232.d 6.31E4 1 1 219 237 2-amino-3-oxo-butanoic_acid
K.TNDQVTIDSAEAIK.K Y 53.50 1503.7417 14 -21.0 752.8623 2 63.93 3 35448 AEV_3_3_RA3_01_1233.d 0 1 1 130 143
K.C(+58.01)ATITPDEER.V Y 52.78 1191.5077 10 15.8 596.7705 2 42.34 3 20869 AEV_3_3_RA3_01_1233.d 1.81E5 3 3 151 160 Carboxymethyl
R.VYLEAVER.R Y 48.31 977.5182 8 4.2 489.7684 2 60.13 2 25966 AEV_1_3_RA2_01_1232.d 6.43E5 4 4 470 477
K.C(+57.02)ATITPDEER.V Y 47.23 1190.5237 10 5.0 596.2721 2 35.79 2 13448 AEV_1_3_RA2_01_1232.d 1.76E5 3 3 151 160 Carbamidomethylation
R.ET(+14.02)STNPIASIFAWTR.G Y 46.39 1706.8628 15 -3.0 854.4361 2 88.70 3 54037 AEV_3_3_RA3_01_1233.d 2.01E5 2 2 400 414 Methylation(others)
K.DLALAC(+57.02)GR.K Y 41.92 874.4330 8 -82.6 438.1877 2 59.96 1 26449 AEV 2_3_RA2_01_1224.d 5.33E5 2 2 452 459 Carbamidomethylation
K.GMPLYMSTK.N Y 39.54 1026.4878 9 16.9 514.2598 2 64.29 2 28871 AEV_1_3_RA2_01_1232.d 2.21E5 2 2 280 288
K.C(+57.02)ATITPDEER(+14.02).V Y 37.93 1204.5394 10 14.2 603.2855 2 46.61 3 23576 AEV_3_3_RA3_01_1233.d 8.09E4 1 1 151 160 Carbamidomethylation; Methylation(KR)
K.YGVGVK.C Y 36.82 621.3486 6 -16.1 622.3458 1 25.68 3 10959 AEV_3_3_RA3_01_1233.d 0 1 1 145 150
R.AAWVTTR.V Y 35.84 803.4290 7 0.3 402.7219 2 39.00 3 18800 AEV_3_3_RA3_01_1233.d 5.31E5 1 1 463 469
R.LIDDMVAQMIK.S Y 35.24 1275.6566 11 10.0 638.8420 2 82.62 2 42595 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 326 336
K.KPIIIGR.H Y 34.30 795.5330 7 -0.1 398.7737 2 35.63 2 13363 AEV_1_3_RA2_01_1232.d 1.86E5 2 2 204 210
R.AK(+14.02)DT(-18.01)VIPGPGTLELVYTPK.G Y 32.10 1994.1088 19 -74.9 665.6604 3 79.11 3 47371 AEV_3_3_RA3_01_1233.d 0 1 1 219 237 Methylation(KR); Dehydration
R.S(+43.01)LSAFS(+79.97)K.K Y 30.79 861.3633 7 21.5 862.3892 1 78.80 3 47185 AEV_3_3_RA3_01_1233.d 8.91E4 1 1 32 38 Carbamylation; Phosphorylation (STY)
K.DLALAC(+57.02)GRK.D Y 30.14 1002.5280 9 31.6 502.2871 2 33.01 3 15144 AEV_3_3_RA3_01_1233.d 3.51E5 3 3 452 460 Carbamidomethylation
R.T(+79.96)RWASIPTTQTR.N Y 29.78 1496.7042 12 52.0 375.2028 4 47.32 2 19105 AEV_1_3_RA2_01_1232.d 0 1 1 77 88 Sulfation
K.LAILK.G N 29.27 556.3948 5 3.4 557.4039 1 50.51 2 20700 AEV_1_3_RA2_01_1232.d 3.58E5 2 2 275 279
R.HAFGDQ(+.98)YR.A Y 28.94 993.4304 8 -36.5 332.1387 3 48.26 1 19224 AEV 2_3_RA2_01_1224.d 0 1 1 211 218 Deamidation (NQ)
R.AKDTVIPGPGTLELVYTPKGGQ(+.98)PER(+31.99).I Y 27.74 2655.3755 25 -6.3 664.8470 4 79.00 3 47287 AEV_3_3_RA3_01_1233.d 0 1 1 219 243 Deamidation (NQ); Dihydroxy
R.NTPER.T Y 27.49 615.2976 5 17.0 616.3154 1 65.51 3 36675 AEV_3_3_RA3_01_1233.d 1.57E5 2 2 72 76
K.YDGRFKDIFQSIYESTYKK.S Y 26.12 2387.1797 19 -0.1 478.4432 5 80.58 3 48520 AEV_3_3_RA3_01_1233.d 1.3E5 2 2 295 313
K.SFD(+21.98)AKGIWYEHR.L Y 25.08 1529.7028 12 -14.5 765.8476 2 91.14 1 50450 AEV 2_3_RA2_01_1224.d 6.08E4 1 1 314 325 Sodium adduct
K.GGQPER.I Y 24.39 642.3085 6 -70.1 643.2708 1 94.19 1 52596 AEV 2_3_RA2_01_1224.d 5.25E4 1 1 238 243
R.N(+226.08)ILGGT(+79.97)VFR.E Y 23.60 1281.5941 9 14.4 428.2115 3 78.59 1 40719 AEV 2_3_RA2_01_1224.d 0 1 1 179 187 Biotinylation; Phosphorylation (STY)
R.NM(+15.99)AASR.R Y 23.53 664.2963 6 -60.9 333.1352 2 22.67 1 5617 AEV 2_3_RA2_01_1224.d 1.53E5 2 2 89 94 Oxidation (M)
K.L(+43.01)AILK.G N 23.18 599.4006 5 -5.4 600.4047 1 35.72 2 13425 AEV_1_3_RA2_01_1232.d 1.63E5 3 3 275 279 Carbamylation
K.DKGLEYR(+14.02)DK.T Y 23.12 1136.5825 9 -11.6 569.2919 2 68.31 2 31597 AEV_1_3_RA2_01_1232.d 0 1 1 121 129 Methylation(KR)
MLSVQ(+.98)LTSVHT(+79.97)R.H Y 22.41 1451.6843 12 23.4 484.9134 3 43.99 3 21914 AEV_3_3_RA3_01_1233.d 0 1 1 1 12 Deamidation (NQ); Phosphorylation (STY)
K.DLALACGR(+14.02).K Y 21.91 831.4272 8 -4.1 832.4312 1 98.75 3 58647 AEV_3_3_RA3_01_1233.d 8.8E3 1 1 452 459 Methylation(KR)
K.EFNLKQMWLSPNGTIR.N Y 21.77 1932.9880 16 -9.1 484.2499 4 66.52 2 30316 AEV_1_3_RA2_01_1232.d 0 1 1 163 178
R.LQ(+.98)K(+14.02)N(+.98)LANAK.L Y 21.73 1014.5709 9 -30.3 1015.5474 1 92.89 2 48540 AEV_1_3_RA2_01_1232.d 7.5E3 1 1 479 487 Deamidation (NQ); Methylation(KR)
K.DTVIPGPGT(+79.97)LELVYTPK(+27.99).G Y 20.79 1906.9329 17 -2.7 636.6498 3 56.08 3 29586 AEV_3_3_RA3_01_1233.d 5.92E4 1 1 221 237 Phosphorylation (STY); Formylation
K.GMPLYM(+15.99)ST(+79.97)K.N Y 20.44 1122.4491 9 -6.9 562.2280 2 52.37 1 21582 AEV 2_3_RA2_01_1224.d 8.35E4 1 1 280 288 Oxidation (M); Phosphorylation (STY)
K.Y(+42.01)GVGVK(-.98).C Y 19.53 662.3751 6 -10.3 332.1914 2 46.72 2 18789 AEV_1_3_RA2_01_1232.d 4.32E4 1 1 145 150 Acetylation (N-term); Amidation
R.S(+42.01)LS(-18.01)AFSK.K Y 19.50 762.3912 7 4.2 763.4017 1 93.36 2 48727 AEV_1_3_RA2_01_1232.d 5.28E4 1 1 32 38 Acetylation (N-term); Dehydration
K.DLALAC(+57.02)GRK(+42.02).D Y 19.28 1044.5498 9 14.2 349.1955 3 54.05 3 28431 AEV_3_3_RA3_01_1233.d 1.75E5 1 1 452 460 Carbamidomethylation; Guanidination
K.DTVIP(+31.99)GPGTLELVYTPK(+42.01)GGQPER.I Y 19.11 2497.2700 23 14.7 625.3340 4 79.81 2 40407 AEV_1_3_RA2_01_1232.d 0 1 1 221 243 Dihydroxy; Acetylation (K)
R.TRWASIPT(+79.97)TQTR.N Y 18.97 1496.7136 12 -32.0 375.1737 4 60.34 1 26735 AEV 2_3_RA2_01_1224.d 1.76E5 1 1 77 88 Phosphorylation (STY)
K.YGVGVK(+14.96).C Y 18.76 636.3119 6 -6.6 637.3149 1 38.65 2 14821 AEV_1_3_RA2_01_1232.d 0 1 1 145 150 Alpha-amino adipic acid
R.VY(+162.05)LEAVERRLQK.N Y 18.67 1664.9097 12 2.9 417.2359 4 77.67 3 46242 AEV_3_3_RA3_01_1233.d 2.64E4 1 1 470 481 Hexose (NSY)
R.WAS(+79.97)IPTTQTRNMAASR(+14.02).R Y 18.44 1883.8713 16 57.3 377.8031 5 23.27 3 9582 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 79 94 Phosphorylation (STY); Methylation(KR)
K.NLANAK(-.98).L Y 18.35 628.3657 6 5.1 315.1917 2 36.30 3 17127 AEV_3_3_RA3_01_1233.d 0 1 1 482 487 Amidation
R.N(+.98)ILGGTVFR.E Y 17.88 976.5342 9 -11.8 326.5148 3 62.63 2 27629 AEV_1_3_RA2_01_1232.d 2.56E4 1 1 179 187 Deamidation (NQ)
R.DK(+14.02)T(-18.01)NDQVTIDSAEAIKK.Y Y 17.83 1870.9636 17 14.5 468.7549 4 55.12 2 23092 AEV_1_3_RA2_01_1232.d 4.49E4 1 1 128 144 Methylation(KR); Dehydration
K.NLAN(+.98)AK.L Y 17.74 630.3337 6 -137.3 631.2544 1 86.25 1 46757 AEV 2_3_RA2_01_1224.d 5.09E4 1 1 482 487 Deamidation (NQ)
K.Q(+.98)M(+15.99)WLSPNGTIR.N Y 17.54 1318.6339 11 -87.7 330.6368 4 51.27 1 20921 AEV 2_3_RA2_01_1224.d 9.4E5 1 1 168 178 Deamidation (NQ); Oxidation (M)
R.TRWASIPTT(-18.01)QTRNMAASR.R Y 17.19 2029.0276 18 4.8 508.2666 4 72.76 2 34933 AEV_1_3_RA2_01_1232.d 6.18E4 1 1 77 94 Dehydration
R.L(+43.01)VPGWK.K Y 17.04 741.4174 6 -162.5 371.6557 2 32.29 1 10244 AEV 2_3_RA2_01_1224.d 1.86E5 1 1 198 203 Carbamylation
K.Q(+27.99)MWLSPNGT(+79.97)IR.N Y 16.89 1409.6163 11 -83.6 470.8401 3 28.36 1 8130 AEV 2_3_RA2_01_1224.d 1.49E5 1 1 168 178 Formylation; Phosphorylation (STY)
K.GGQPER(-43.05).I Y 16.61 599.2551 6 91.1 300.6621 2 33.52 1 10964 AEV 2_3_RA2_01_1224.d 3.81E5 1 1 238 243 Arginine oxidation to glutamic semialdehyde
K.GGQPER(+21.98)(+14.02).I Y 16.55 678.3061 6 -17.8 679.3013 1 90.14 1 49725 AEV 2_3_RA2_01_1224.d 6.22E4 1 1 238 243 Sodium adduct; Methylation(KR)
R.AKDTVIPGPGTLELVYTP(+13.98)K.G Y 16.45 2012.0830 19 -77.8 671.6494 3 85.93 1 46546 AEV 2_3_RA2_01_1224.d 1.03E6 1 1 219 237 Proline oxidation to pyroglutamic acid
R.N(+.98)MAAS(-18.01)R.R Y 16.43 631.2748 6 7.6 632.2869 1 29.09 3 12868 AEV_3_3_RA3_01_1233.d 4.77E4 1 1 89 94 Deamidation (NQ); Dehydration
R.TRWASIPTTQTRNMAASR.R Y 16.41 2047.0381 18 -2.3 512.7656 4 74.88 3 44030 AEV_3_3_RA3_01_1233.d 1.38E5 1 1 77 94
R.WAS(+79.97)IPTTQTRNM(+15.99)AASR(+14.02).R Y 16.41 1899.8662 16 3.4 634.2982 3 44.38 3 22164 AEV_3_3_RA3_01_1233.d 0 1 1 79 94 Phosphorylation (STY); Oxidation (M); Methylation(KR)
K.Y(+42.01)GVGVK(+14.02)C(+57.02)ATITPDEERVK(+42.01).E Y 16.28 2119.0620 18 -38.0 424.8036 5 69.37 3 39748 AEV_3_3_RA3_01_1233.d 0 1 1 145 162 Acetylation (N-term); Methylation(KR); Carbamidomethylation; Acetylation (K)
M(+27.99)LSVQLTSVHTR.H Y 16.16 1398.7289 12 -19.5 700.3581 2 82.04 2 42181 AEV_1_3_RA2_01_1232.d 2.61E4 1 1 1 12 Formylation (Protein N-term)
R.SLSAFSK.K Y 16.14 738.3912 7 -19.0 739.3844 1 82.68 2 42640 AEV_1_3_RA2_01_1232.d 3.15E4 1 1 32 38
K.GRETSTNPIASIFAWTR(+14.02).G Y 16.12 1919.9854 17 -22.8 384.9956 5 62.00 3 33965 AEV_3_3_RA3_01_1233.d 0 1 1 398 414 Methylation(KR)
R.TR(+14.02)WASIPTT(-18.01)QTR.N Y 16.11 1412.7524 12 -23.7 471.9136 3 43.31 3 21481 AEV_3_3_RA3_01_1233.d 1.08E4 1 1 77 88 Methylation(KR); Dehydration
R.I(+42.01)IWKDIK(+42.01)DKGLEYR.D Y 15.93 1860.0145 14 6.7 466.0140 4 72.26 3 41993 AEV_3_3_RA3_01_1233.d 0 1 1 114 127 Acetylation (N-term); Acetylation (K)
K.D(+42.01)RAAWVTTR(+31.99).V Y 15.89 1148.5574 9 -87.2 383.8264 3 23.63 1 5972 AEV 2_3_RA2_01_1224.d 1.47E4 1 1 461 469 Acetylation (N-term); Dihydroxy
M(+42.01)(+15.99)LSVQLT(+79.97)SVHTR.H Y 15.84 1508.7058 12 27.7 503.9232 3 61.84 3 33846 AEV_3_3_RA3_01_1233.d 0 1 1 1 12 Acetylation (Protein N-term); Oxidation (M); Phosphorylation (STY)
K.GRET(+79.97)STNPIASIFAWTR(+14.02).G Y 15.77 1999.9517 17 -42.7 667.6294 3 72.76 1 36145 AEV 2_3_RA2_01_1224.d 1.21E5 1 1 398 414 Phosphorylation (STY); Methylation(KR)
K.N(+.98)LANAK.L Y 15.76 630.3337 6 -72.9 316.1512 2 45.74 1 17698 AEV 2_3_RA2_01_1224.d 1.66E5 1 1 482 487 Deamidation (NQ)
K.DLALACGRKDR(+14.02).A Y 15.63 1230.6503 11 3.8 411.2256 3 17.15 3 6298 AEV_3_3_RA3_01_1233.d 0 1 1 452 462 Methylation(KR)
K.C(+57.02)(+42.01)ATITPDEER.V Y 15.50 1232.5343 10 -33.3 617.2539 2 62.07 1 28051 AEV 2_3_RA2_01_1224.d 6.95E4 1 1 151 160 Carbamidomethylation; Acetylation (N-term)
R.LIDDM(+15.99)VAQM(+15.99)IKSEGGFIIAM(+15.99)K.N Y 15.47 2357.1680 21 0.3 590.2994 4 70.16 3 40345 AEV_3_3_RA3_01_1233.d 0 1 1 326 346 Oxidation (M)
K.NLANAKL Y 15.34 742.4337 7 -10.6 372.2202 2 65.26 3 36487 AEV_3_3_RA3_01_1233.d 2.42E5 1 1 482 488
K.N(+42.01)LANAK(+42.01).L Y 15.20 713.3708 6 -22.5 714.3620 1 52.33 2 21641 AEV_1_3_RA2_01_1232.d 0 1 1 482 487 Acetylation (N-term); Acetylation (K)
total 85 peptides
C1G2J3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.THLQDLIETTSQIHYETFR.A Y 132.14 2331.1494 19 6.6 583.7985 4 80.20 2 40723 AEV_1_3_RA2_01_1232.d 1.07E6 7 7 284 302
K.STLINTIFASHLIDSK.G Y 119.39 1758.9515 16 -0.7 587.3240 3 82.91 2 42821 AEV_1_3_RA2_01_1232.d 5.65E5 3 3 53 68
K.LSDVVNVVPVIAK.S Y 117.68 1351.8075 13 0.1 676.9111 2 78.38 2 39272 AEV_1_3_RA2_01_1232.d 8.05E5 3 3 174 186
K.ESSATGHSSGSRPISPSTNR.E Y 108.48 2013.9464 20 6.5 504.4972 4 21.94 2 7192 AEV_1_3_RA2_01_1232.d 8.7E5 4 4 311 330
R.LRLNIVDTPGYGDQVNNDR.C Y 106.52 2158.0767 19 -1.8 720.3649 3 72.25 3 41986 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 97 115
K.KLSDVVNVVPVIAK.S Y 101.57 1479.9025 14 0.9 494.3085 3 77.51 2 38579 AEV_1_3_RA2_01_1232.d 4.09E5 3 3 173 186
R.SHVGFDSITSQIER.K Y 100.16 1574.7688 14 4.0 525.9323 3 70.96 2 33562 AEV_1_3_RA2_01_1232.d 7.89E5 4 4 18 31
R.LNIVDTPGYGDQVNNDR.C Y 92.64 1888.8915 17 4.4 945.4572 2 69.84 2 32733 AEV_1_3_RA2_01_1232.d 2.36E5 3 3 99 115
K.MYPYDNDELDNEER.A Y 91.67 1801.7101 14 -1.1 901.8613 2 67.17 3 38001 AEV_3_3_RA3_01_1233.d 2.61E5 2 2 213 226
R.AVNAQIKDIIPFAVVGSEK.S Y 90.73 1998.1149 19 -0.5 667.0452 3 81.18 3 48976 AEV_3_3_RA3_01_1233.d 2.73E5 5 5 227 245
R.GFQFNVIC(+57.02)VGQTGLGK.S Y 87.10 1723.8716 16 -0.4 862.9427 2 82.42 2 42495 AEV_1_3_RA2_01_1232.d 2.37E5 2 2 37 52 Carbamidomethylation
K.M(+15.99)YPYDNDELDNEER.A Y 84.42 1817.7050 14 5.1 909.8644 2 63.77 2 28407 AEV_1_3_RA2_01_1232.d 2.79E5 3 3 213 226 Oxidation (M)
K.YIKDQHSAYLRK.E Y 81.35 1520.8099 12 6.6 507.9473 3 30.39 2 10887 AEV_1_3_RA2_01_1232.d 2.32E5 3 3 123 134
K.LSDVVNVVPVIAK(+14.02).S Y 79.14 1365.8231 13 -5.5 683.9151 2 79.87 2 40458 AEV_1_3_RA2_01_1232.d 2.93E4 1 1 174 186 Methylation(KR)
M.A(+42.01)SPLSPVSAQSTVFPR.S Y 78.82 1684.8784 16 -1.5 843.4452 2 82.72 3 50108 AEV_3_3_RA3_01_1233.d 1.99E6 6 6 2 17 Acetylation (Protein N-term)
R.IHC(+57.02)C(+57.02)LFFIQPSGHALKPIDIVVLK.K Y 72.13 2804.5232 24 30.6 561.9291 5 83.29 2 43090 AEV_1_3_RA2_01_1232.d 0 1 1 149 172 Carbamidomethylation
K.SDSLTLEER.M Y 72.05 1048.5037 9 6.0 525.2623 2 49.36 2 20122 AEV_1_3_RA2_01_1232.d 2.63E6 8 8 187 195
R.THLQDLIETTSQIHYETFR(+14.02).A Y 71.66 2345.1650 19 4.5 587.3011 4 81.44 2 41695 AEV_1_3_RA2_01_1232.d 1.97E5 3 3 284 302 Methylation(KR)
R.LNIVDTPGYGDQVNNDRC(+57.02)WDPIVK.Y Y 68.90 2787.3286 24 1.1 930.1178 3 78.91 3 47215 AEV_3_3_RA3_01_1233.d 2.24E5 2 2 99 122 Carbamidomethylation
K.STLINTIFASHLIDSKGR.L Y 65.23 1972.0741 18 5.0 494.0283 4 79.91 2 40491 AEV_1_3_RA2_01_1232.d 6.86E4 1 1 53 70
R.LRPDEPVR.S Y 60.39 980.5403 8 -0.4 491.2772 2 26.68 3 11517 AEV_3_3_RA3_01_1233.d 1.15E6 11 11 71 78
R.SHVGFDSITSQIER(+14.02).K Y 58.01 1588.7845 14 -1.1 530.6016 3 73.92 3 43286 AEV_3_3_RA3_01_1233.d 1.58E4 1 1 18 31 Methylation(KR)
M.A(+42.01)SPLSPVSAQ(+.98)STVFPR.S Y 50.70 1685.8624 16 -1.0 843.9376 2 84.17 3 51141 AEV_3_3_RA3_01_1233.d 0 1 1 2 17 Acetylation (Protein N-term); Deamidation (NQ)
R.SHVGFDSITSQIERK.L Y 47.31 1702.8638 15 -96.5 426.6821 4 76.42 1 38987 AEV 2_3_RA2_01_1224.d 7.92E4 1 1 18 32
K.SDSLTLEER(+14.02).M Y 47.20 1062.5193 9 0.6 532.2672 2 57.82 3 30866 AEV_3_3_RA3_01_1233.d 3.89E5 2 2 187 195 Methylation(KR)
M.A(+42.01)SPLSPVSAQSTVFPR(+14.02).S Y 41.96 1698.8940 16 -5.8 850.4493 2 84.23 3 51181 AEV_3_3_RA3_01_1233.d 1.25E5 2 2 2 17 Acetylation (Protein N-term); Methylation(KR)
K.S(+42.01)TLINTIFASHLIDSK.G Y 37.06 1800.9622 16 -14.8 601.3191 3 83.02 2 42895 AEV_1_3_RA2_01_1232.d 1.9E5 1 1 53 68 Acetylation (N-term)
R.THLQ(+.98)DLIETTSQIHYETFR.A Y 33.89 2332.1335 19 -49.4 584.0118 4 79.68 3 47830 AEV_3_3_RA3_01_1233.d 0 1 1 284 302 Deamidation (NQ)
K.SIIVAGK.Q Y 29.45 686.4326 7 -2.8 344.2226 2 31.96 3 14539 AEV_3_3_RA3_01_1233.d 8E5 3 3 246 252
K.DIIPFAVVGSEK(-.98).S Y 27.61 1272.7078 12 -14.4 319.1796 4 42.05 3 20685 AEV_3_3_RA3_01_1233.d 2.82E4 1 1 234 245 Amidation
K.S(+27.99)DSLTLEER.M Y 27.12 1076.4985 9 22.4 539.2686 2 20.67 3 8208 AEV_3_3_RA3_01_1233.d 2.93E4 1 1 187 195 Formylation
R.NFLTR.T N 25.85 649.3547 5 3.3 325.6857 2 42.01 2 16471 AEV_1_3_RA2_01_1232.d 0 1 1 279 283
K.YIKDQ(+.98)HSAYLRK.E Y 25.57 1521.7939 12 -7.6 508.2681 3 26.81 3 11590 AEV_3_3_RA3_01_1233.d 0 1 1 123 134 Deamidation (NQ)
R.STTEIQAVSHIIEENGVRLR.L Y 24.20 2251.1919 20 -3.6 563.8032 4 78.85 3 47170 AEV_3_3_RA3_01_1233.d 6.57E4 1 1 79 98
K.ELTAQR.E Y 23.06 716.3817 6 -86.3 359.1672 2 22.66 1 5612 AEV 2_3_RA2_01_1224.d 4.36E4 1 1 135 140
K.SD(+14.02)SLTLEER.M Y 22.67 1062.5193 9 1.0 532.2675 2 58.18 3 31074 AEV_3_3_RA3_01_1233.d 2.95E5 1 1 187 195 Methylation(others)
R.AKQLLALK(+14.02).E Y 22.40 897.6011 8 9.6 898.6169 1 102.69 2 51795 AEV_1_3_RA2_01_1232.d 5.87E5 1 1 303 310 Methylation(KR)
R.YIQDT(+79.97)R.I Y 21.23 874.3586 6 44.2 438.2059 2 73.04 1 36319 AEV 2_3_RA2_01_1224.d 2.1E4 1 1 143 148 Phosphorylation (STY)
R.STTEIQ(+.98)AVSHIIEENGVR(+14.02).L Y 20.78 1997.0065 18 1.5 666.6771 3 78.31 3 46743 AEV_3_3_RA3_01_1233.d 1.08E5 1 1 79 96 Deamidation (NQ); Methylation(KR)
R.LRPD(+21.98)EPVR.S Y 20.32 1002.5222 8 2.5 502.2697 2 71.03 3 41032 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 71 78 Sodium adduct
R.NFLTR(+14.02).T N 19.88 663.3704 5 -9.9 332.6892 2 50.28 2 20578 AEV_1_3_RA2_01_1232.d 1.57E4 1 1 279 283 Methylation(KR)
K.EEFAFHNLK.M Y 19.26 1133.5505 9 -88.9 567.7322 2 54.68 1 22993 AEV 2_3_RA2_01_1224.d 3.16E4 1 1 204 212
K.SIIVAGK(+42.01).Q Y 18.81 728.4432 7 -1.6 365.2283 2 41.08 3 20054 AEV_3_3_RA3_01_1233.d 0 1 1 246 252 Acetylation (K)
K.L(+42.01)SDVVN(+.98)VVPVIAK(+14.02).S Y 18.50 1408.8177 13 -9.3 353.2084 4 75.56 2 37041 AEV_1_3_RA2_01_1232.d 3.53E5 1 1 174 186 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
R.YIQDTR.I Y 17.75 794.3923 6 15.5 398.2096 2 17.29 3 6410 AEV_3_3_RA3_01_1233.d 0 1 1 143 148
K.M(+42.01)YPYD(+43.99)NDELDNEER.A Y 17.55 1887.7104 14 3.3 378.5506 5 46.03 2 18443 AEV_1_3_RA2_01_1232.d 0 1 1 213 226 Acetylation (N-term); Carboxylation (DKW)
R.M(+15.99)AFKERIKEEFAFHNLK.M Y 17.41 2153.1091 17 -10.2 539.2791 4 66.01 2 29960 AEV_1_3_RA2_01_1232.d 0 1 1 196 212 Oxidation (M)
K.S(-2.02)DSLTLEER.M Y 17.22 1046.4880 9 1.7 524.2522 2 48.67 3 24871 AEV_3_3_RA3_01_1233.d 0 1 1 187 195 2-amino-3-oxo-butanoic_acid
R.A(+42.01)VNAQIK(+21.98).D Y 17.13 806.4262 7 -12.8 807.4232 1 81.30 3 49124 AEV_3_3_RA3_01_1233.d 2.85E4 1 1 227 233 Acetylation (N-term); Sodium adduct
M(+42.01)ASPLSPVSAQS(+162.05)TVFPR.S Y 16.38 1977.9717 17 -22.2 989.9711 2 91.69 2 48035 AEV_1_3_RA2_01_1232.d 0 1 1 1 17 Acetylation (Protein N-term); Hexose (NSY)
K.S(+226.08)IIVAGKQ(+.98)VR.G Y 16.34 1296.7223 10 -27.1 325.1791 4 42.33 3 20858 AEV_3_3_RA3_01_1233.d 2.31E5 1 1 246 255 Biotinylation; Deamidation (NQ)
R.AVNAQIK(+14.02)D(-18.01)IIPFAVVGSEK.S Y 16.28 1994.1200 19 -35.7 665.6902 3 81.16 3 48965 AEV_3_3_RA3_01_1233.d 1.49E4 1 1 227 245 Methylation(KR); Dehydration
R.THLQDLIET(+13.03)TSQIHYETFR.A Y 16.19 2344.1812 19 -2.7 782.3989 3 80.05 3 48111 AEV_3_3_RA3_01_1233.d 3.12E5 1 1 284 302 Michael addition with methylamine
R.GFQFN(+.98)VIC(+57.02)VGQ(+.98)TGLGK.S Y 15.67 1725.8396 16 9.3 576.2925 3 47.72 2 19295 AEV_1_3_RA2_01_1232.d 0 1 1 37 52 Deamidation (NQ); Carbamidomethylation
K.EEFAFHNLK(+31.99).M Y 15.60 1165.5403 9 -85.9 583.7274 2 75.68 1 38414 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 204 212 Dihydroxy
R.LRLNIVDTPGYGDQVNNDR(-.98).C Y 15.53 2157.0925 19 -18.4 720.0249 3 72.97 2 35096 AEV_1_3_RA2_01_1232.d 0 1 1 97 115 Amidation
R.SHVGFDSIT(+79.97)SQIER(-.98).K Y 15.22 1653.7512 14 -27.8 414.4336 4 62.42 1 28337 AEV 2_3_RA2_01_1224.d 2.05E5 1 1 18 31 Phosphorylation (STY); Amidation
R.LRP(+31.99)DEPVR.S Y 15.05 1012.5301 8 -132.1 338.4727 3 43.45 1 16392 AEV 2_3_RA2_01_1224.d 2.17E5 1 1 71 78 Dihydroxy
total 58 peptides
C1GEM8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.IYQPPVEEDDEHAAQHAR.S Y 140.06 2103.9609 18 6.9 527.0012 4 52.01 2 21465 AEV_1_3_RA2_01_1232.d 2.48E6 12 12 205 222
R.LTVIDTPGFGDYVNNR.D Y 129.97 1779.8792 16 3.0 594.3021 3 79.41 2 40092 AEV_1_3_RA2_01_1232.d 7.19E5 6 6 92 107
R.VNLIPVVAK.A Y 106.71 951.6117 9 0.8 476.8135 2 72.35 2 34653 AEV_1_3_RA2_01_1232.d 1.55E6 3 3 170 178
R.VNLIPVVAKADTLSPSDLAR.F Y 101.48 2078.1736 20 3.2 693.7340 3 81.08 2 41414 AEV_1_3_RA2_01_1232.d 1.24E5 2 2 170 189
R.SLMAAMPFSVIGSEKDVK.T Y 100.80 1908.9689 18 2.3 637.3317 3 80.98 2 41331 AEV_1_3_RA2_01_1232.d 4.44E5 2 2 223 240
K.TTFINTLFSTTIK.N Y 94.37 1485.8079 13 4.0 743.9142 2 85.31 2 44523 AEV_1_3_RA2_01_1232.d 2.18E5 2 2 45 57
K.TTFINTLFSTTIKNYADHK.R Y 90.87 2214.1321 19 10.2 554.5460 4 82.61 2 42639 AEV_1_3_RA2_01_1232.d 4.99E5 3 3 45 63
K.ADTLSPSDLAR.F Y 88.06 1144.5724 11 -2.5 573.2921 2 62.21 3 34169 AEV_3_3_RA3_01_1233.d 2.38E6 7 7 179 189
M.APPTSETASPIGIANLPNQR.H Y 87.14 2033.0541 20 -4.4 678.6890 3 73.88 2 35790 AEV_1_3_RA2_01_1232.d 1.7E5 2 2 2 21
R.LSSRVNLIPVVAK.A Y 84.26 1394.8608 13 -0.9 465.9605 3 69.47 3 39825 AEV_3_3_RA3_01_1233.d 1.74E5 2 2 166 178
R.SLMAAMPFSVIGSEK.D Y 82.57 1566.7786 15 3.0 784.3989 2 84.30 2 43827 AEV_1_3_RA2_01_1232.d 2.01E5 1 1 223 237
R.IRGVIEAQGIK.I Y 80.62 1182.7084 11 -2.5 395.2424 3 52.86 3 27617 AEV_3_3_RA3_01_1233.d 8E5 6 6 194 204
R.FTEQVKIEEQR.F Y 77.19 1405.7201 11 0.8 469.5810 3 50.51 3 26044 AEV_3_3_RA3_01_1233.d 3.68E5 3 3 328 338
K.IYQPPVE(+14.02)EDDEHAAQHAR.S Y 62.78 2117.9766 18 0.4 530.5016 4 56.69 3 29992 AEV_3_3_RA3_01_1233.d 8.56E5 4 4 205 222 Methylation(others)
K.ADTLSPSDLAR(+14.02).F Y 57.31 1158.5880 11 1.9 580.3024 2 67.10 2 30731 AEV_1_3_RA2_01_1232.d 2.17E5 2 2 179 189 Methylation(KR)
R.THMLDLIHTTEESHYEAYR.A Y 56.34 2345.0747 19 9.1 470.0265 5 72.48 2 34719 AEV_1_3_RA2_01_1232.d 1.16E5 1 1 277 295
K.Q(-17.03)LEQELETMQGSAVR.S Y 54.09 1700.8040 15 0.8 851.4099 2 83.23 3 50477 AEV_3_3_RA3_01_1233.d 1.16E5 2 2 366 380 Pyro-glu from Q
K.I(+41.03)YQPPVEEDDEHAAQHAR.S Y 49.30 2144.9875 18 27.5 537.2689 4 50.10 3 25797 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 205 222 Amidination of lysines or N-terminal amines with methyl acetimidate
K.Q(-17.03)VDKTVEIEITKAELEEKFFK.V Y 48.04 2506.3206 21 2.9 627.5892 4 83.43 2 43197 AEV_1_3_RA2_01_1232.d 5.9E4 1 1 69 89 Pyro-glu from Q
R.GVIEAQGIK.I Y 45.54 913.5233 9 -0.1 457.7689 2 46.73 3 23635 AEV_3_3_RA3_01_1233.d 1.06E6 6 6 196 204
K.AD(+14.02)TLSPSDLAR.F Y 40.21 1158.5880 11 -13.6 580.2934 2 65.74 3 36862 AEV_3_3_RA3_01_1233.d 4.7E4 1 1 179 189 Methylation(others)
R.SLM(+15.99)AAM(+15.99)PFSVIGSEKDVK.T Y 39.08 1940.9587 18 11.9 648.0012 3 72.05 2 34385 AEV_1_3_RA2_01_1232.d 7.4E5 1 1 223 240 Oxidation (M)
K.FKEEEENLR.K Y 38.83 1192.5724 9 2.0 597.2947 2 32.33 3 14769 AEV_3_3_RA3_01_1233.d 4.94E5 4 4 317 325
R.SLM(+15.99)AAMPFSVIGSEK.D Y 36.46 1582.7734 15 2.2 792.3958 2 80.42 2 40895 AEV_1_3_RA2_01_1232.d 6.91E4 1 1 223 237 Oxidation (M)
K.IYQ(+.98)PPVEEDDEHAAQHAR.S Y 34.64 2104.9448 18 -79.9 527.2014 4 62.43 1 28332 AEV 2_3_RA2_01_1224.d 2.2E5 1 1 205 222 Deamidation (NQ)
K.QVD(-18.01)KTVEIEITKAELEEKFFK.V Y 31.79 2505.3367 21 8.8 627.3469 4 83.14 3 50410 AEV_3_3_RA3_01_1233.d 0 1 1 69 89 Dehydration
R.SLM(+15.99)AAMPFSVIGSEKDVK.T Y 31.71 1924.9637 18 -10.8 642.6549 3 76.99 3 45687 AEV_3_3_RA3_01_1233.d 4.25E4 1 1 223 240 Oxidation (M)
K.TT(-2.02)FINTLFSTTIK.N Y 31.32 1483.7922 13 -30.8 742.8806 2 85.15 3 51798 AEV_3_3_RA3_01_1233.d 8.35E4 1 1 45 57 2-amino-3-oxo-butanoic_acid
R.KLDNPK.F Y 30.79 713.4072 6 -164.6 714.2970 1 85.82 1 46429 AEV 2_3_RA2_01_1224.d 5.78E4 1 1 311 316
K.R(+42.01)GAAFTIM(+15.99)VAGESGLGK(+42.01).T Y 29.54 1763.8876 17 4.4 441.9811 4 24.71 2 8364 AEV_1_3_RA2_01_1232.d 6.97E4 1 1 28 44 Acetylation (N-term); Oxidation (M); Acetylation (K)
K.FGEARPR.K Y 28.71 831.4351 7 3.5 416.7263 2 16.58 3 5988 AEV_3_3_RA3_01_1233.d 2.87E5 2 2 304 310
R.FTEQVKIEEQR(+14.02).F Y 28.23 1419.7357 11 9.8 474.2572 3 57.44 3 30546 AEV_3_3_RA3_01_1233.d 1.53E5 1 1 328 338 Methylation(KR)
R.IRGVIEAQGIK(+43.01).I Y 28.22 1225.7142 11 -43.5 409.5609 3 52.82 3 27659 AEV_3_3_RA3_01_1233.d 0 1 1 194 204 Carbamylation
K.ADTLS(+79.97)PS(+79.97)DLAR.F Y 28.07 1304.5050 11 37.8 327.1458 4 42.39 1 15809 AEV 2_3_RA2_01_1224.d 3.43E5 1 1 179 189 Phosphorylation (STY)
R.KFGEARPR.K Y 28.01 959.5300 8 8.0 320.8532 3 15.80 2 4664 AEV_1_3_RA2_01_1232.d 1.17E5 1 1 303 310
R.FTEQ(+.98)VKIEEQR(+14.02).F Y 27.86 1420.7197 11 16.9 474.5885 3 59.10 3 31741 AEV_3_3_RA3_01_1233.d 6.66E4 1 1 328 338 Deamidation (NQ); Methylation(KR)
K.DLESTHAAIK.Q Y 27.57 1083.5560 10 -88.1 542.7375 2 48.19 1 19188 AEV 2_3_RA2_01_1224.d 6.26E4 1 1 356 365
K.TTFINTLFSTTIKNYADHKR.R Y 27.47 2370.2332 20 -21.7 475.0436 5 79.74 3 47876 AEV_3_3_RA3_01_1233.d 0 1 1 45 64
K.IYQPPVEED(+14.02)DEHAAQHAR.S Y 25.92 2117.9766 18 18.1 530.5110 4 57.08 2 24146 AEV_1_3_RA2_01_1232.d 0 1 1 205 222 Methylation(others)
K.IYQPPVEEDDEHAAQHAR(+14.02).S Y 25.05 2117.9766 18 3.4 707.0019 3 57.93 2 24602 AEV_1_3_RA2_01_1232.d 8.05E4 1 1 205 222 Methylation(KR)
R.GAAFTIMVAGESGLGK.T Y 24.71 1507.7704 16 -5.8 754.8881 2 79.66 2 40294 AEV_1_3_RA2_01_1232.d 6.27E4 1 1 29 44
R.VDKID(+43.99)LR.V Y 24.52 901.4869 7 -50.2 301.4878 3 54.53 1 22875 AEV 2_3_RA2_01_1224.d 6.49E5 1 1 134 140 Carboxylation (DKW)
K.ADTLS(+79.97)PSDLAR.F Y 23.79 1224.5387 11 16.6 307.1470 4 73.37 1 36580 AEV 2_3_RA2_01_1224.d 0 1 1 179 189 Phosphorylation (STY)
K.T(+43.01)T(+79.97)FINTLFSTTIKNYADHKR.R Y 22.33 2493.2053 20 1.3 624.3094 4 62.89 3 34649 AEV_3_3_RA3_01_1233.d 2.52E5 1 1 45 64 Carbamylation; Phosphorylation (STY)
R.RVDKIDLR.V Y 22.30 1013.5981 8 4.1 338.8747 3 29.87 3 13318 AEV_3_3_RA3_01_1233.d 2.55E5 1 1 133 140
R.SILIR.T N 21.87 600.3959 5 -3.1 301.2043 2 44.18 3 22036 AEV_3_3_RA3_01_1233.d 3.01E5 3 3 272 276
K.LDNPK.F Y 21.52 585.3122 5 61.7 586.3556 1 101.63 1 56251 AEV 2_3_RA2_01_1224.d 0 3 3 312 316
K.ADTLSPSD(-18.01)LAR.F Y 21.20 1126.5618 11 -35.4 376.5146 3 65.07 1 30204 AEV 2_3_RA2_01_1224.d 5.09E5 1 1 179 189 Dehydration
K.LDNPK(+21.98).F Y 20.62 607.2941 5 11.2 608.3082 1 18.68 2 5859 AEV_1_3_RA2_01_1232.d 9.1E3 1 1 312 316 Sodium adduct
K.IYQPPVEE(+14.02)DDEHAAQHAR.S Y 19.06 2117.9766 18 3.4 707.0018 3 56.82 3 30092 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 205 222 Methylation(others)
K.QVDKTVEIE(+43.99)IT(+79.97)K.A Y 18.73 1525.7277 12 10.9 763.8794 2 76.94 3 45652 AEV_3_3_RA3_01_1233.d 4.77E4 1 1 69 80 Carboxylation (E); Phosphorylation (STY)
K.LDN(+.98)PK.F Y 18.56 586.2962 5 6.0 587.3070 1 75.05 2 36654 AEV_1_3_RA2_01_1232.d 9.17E4 1 1 312 316 Deamidation (NQ)
R.S(+79.97)LMAAM(+15.99)PFSVIGSEKDVK.T Y 18.32 2004.9301 18 65.8 402.0197 5 68.32 2 31604 AEV_1_3_RA2_01_1232.d 0 1 1 223 240 Phosphorylation (STY); Oxidation (M)
K.L(+43.01)DNPK.F Y 18.23 628.3180 5 -8.1 629.3202 1 64.97 2 29230 AEV_1_3_RA2_01_1232.d 0 1 1 312 316 Carbamylation
K.DVK(+14.02)TGDGR.I Y 17.39 860.4352 8 -20.0 431.2163 2 23.70 3 9815 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 238 245 Methylation(KR)
K.TGDGR(-.98).I Y 16.81 503.2452 5 7.3 504.2562 1 49.48 2 20179 AEV_1_3_RA2_01_1232.d 0 1 1 241 245 Amidation
R.HAK(+42.01)QVDKTVEIEITK(+43.01).A Y 16.77 1822.9789 15 -80.3 456.7154 4 73.78 1 36911 AEV 2_3_RA2_01_1224.d 0 1 1 66 80 Acetylation (K); Carbamylation
K.TT(+79.97)FIN(+.98)TLFSTTIKNYADHK.R Y 16.49 2295.0825 19 27.8 766.0560 3 80.86 2 41244 AEV_1_3_RA2_01_1232.d 3.25E4 1 1 45 63 Phosphorylation (STY); Deamidation (NQ)
R.LTVIDTPGFGDYVNNR(+14.02).D Y 16.41 1793.8948 16 45.2 449.5012 4 64.88 3 36207 AEV_3_3_RA3_01_1233.d 3.19E5 1 1 92 107 Methylation(KR)
K.NYADHK(+226.08).R Y 16.16 972.4124 6 -25.2 487.2012 2 72.92 1 36249 AEV 2_3_RA2_01_1224.d 2.65E5 1 1 58 63 Biotinylation
K.AD(+43.99)TLS(+79.97)PSDLAR.F Y 16.07 1268.5286 11 -12.1 423.8450 3 49.04 1 19688 AEV 2_3_RA2_01_1224.d 3.76E4 1 1 179 189 Carboxylation (DKW); Phosphorylation (STY)
K.L(+42.01)ISERDRLN(+203.08)KDLESTHAAIK.Q Y 15.97 2553.3398 20 18.5 639.3541 4 92.23 3 55914 AEV_3_3_RA3_01_1233.d 0 1 1 346 365 Acetylation (N-term); HexNAcylation (N)
K.ADT(+14.02)LSPSDLAR.F Y 15.84 1158.5880 11 4.2 580.3037 2 65.94 3 37020 AEV_3_3_RA3_01_1233.d 0 1 1 179 189 Methylation(others)
K.DVK(+14.02)TGDGRIVK.G Y 15.76 1200.6826 11 2.1 301.1786 4 12.79 2 3519 AEV_1_3_RA2_01_1232.d 0 1 1 238 248 Methylation(KR)
R.FRQWEQK.L Y 15.76 1020.5141 7 -4.4 511.2621 2 29.08 3 12861 AEV_3_3_RA3_01_1233.d 9.64E4 1 1 339 345
R.ALQM(+15.99)ETR.K Y 15.70 863.4171 7 122.9 864.5305 1 103.02 1 56704 AEV 2_3_RA2_01_1224.d 0 1 1 296 302 Oxidation (M)
R.GAAFTIMVAGESGLGKTTFINTLFSTTIK.N Y 15.38 2975.5679 29 -3.8 744.8964 4 93.86 3 56726 AEV_3_3_RA3_01_1233.d 0 1 1 29 57
R.G(+27.99)AAFTIMVAGESGLGK.T Y 15.23 1535.7654 16 34.5 512.9467 3 31.25 3 14117 AEV_3_3_RA3_01_1233.d 1.97E5 1 1 29 44 Formylation
total 68 peptides
C1GLU6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TSQKPVTTEQGEEVR.K Y 134.42 1687.8376 15 4.6 563.6224 3 27.29 2 9517 AEV_1_3_RA2_01_1232.d 4.37E6 13 13 134 148
K.HVELALWDTAGQEDYDR.L Y 127.99 2016.9177 17 2.3 673.3147 3 76.66 3 45425 AEV_3_3_RA3_01_1233.d 8.87E5 7 7 52 68
K.TSQKPVTTEQGEEVRK.K Y 124.81 1815.9326 16 4.1 606.3206 3 21.31 2 6932 AEV_1_3_RA2_01_1232.d 3.59E6 10 10 134 149
K.GTFPEVYVPTVFENYVADVEVDGK.H Y 124.68 2673.2849 24 0.0 1337.6498 2 92.26 3 55946 AEV_3_3_RA3_01_1233.d 6E5 4 4 28 51
R.TNDGVREVFESATR.A Y 124.35 1579.7590 14 5.7 527.5966 3 65.86 2 29862 AEV_1_3_RA2_01_1232.d 2.07E6 6 6 163 176
K.TSQKPVTTEQGEEVRKK.I Y 107.49 1944.0276 17 2.7 487.0155 4 15.97 3 5651 AEV_3_3_RA3_01_1233.d 3.46E6 12 12 134 150
K.TSQKPVTTE(+14.02)QGEEVR.K Y 95.27 1701.8533 15 4.0 568.2939 3 35.04 2 13127 AEV_1_3_RA2_01_1232.d 3.86E5 2 2 134 148 Methylation(others)
K.IGAYKYLEC(+57.02)SAR.T Y 90.15 1429.7024 12 -3.4 477.5731 3 61.02 3 33240 AEV_3_3_RA3_01_1233.d 7.8E5 5 5 151 162 Carbamidomethylation
R.KTSQKPVTTEQGEEVR.K Y 86.68 1815.9326 16 0.0 606.3182 3 19.51 3 7589 AEV_3_3_RA3_01_1233.d 5.36E5 2 2 133 148
K.TC(+57.02)LLIVFSK.G Y 86.29 1079.6049 9 0.7 540.8101 2 80.17 2 40700 AEV_1_3_RA2_01_1232.d 9.49E5 5 5 19 27 Carbamidomethylation
K.TSQKPVTTEQGEEVR(+14.02).K Y 83.62 1701.8533 15 0.7 568.2921 3 35.65 3 16726 AEV_3_3_RA3_01_1233.d 9.74E5 8 8 134 148 Methylation(KR)
K.TSQ(+.98)KPVTTEQGEEVR.K Y 78.43 1688.8217 15 0.8 563.9483 3 29.05 3 12839 AEV_3_3_RA3_01_1233.d 5.49E5 5 5 134 148 Deamidation (NQ)
K.TSQKPVTTEQ(+.98)GEEVR.K Y 71.66 1688.8217 15 4.0 563.9501 3 29.45 3 13069 AEV_3_3_RA3_01_1233.d 6.74E5 5 5 134 148 Deamidation (NQ)
K.GTFPEVYVPTVFENYVADVEVDGK(+14.02).H Y 71.59 2687.3005 24 1.2 1344.6592 2 94.33 3 56936 AEV_3_3_RA3_01_1233.d 2.31E5 6 6 28 51 Methylation(KR)
K.TSQKPVTTEQGE(+14.02)EVR.K Y 71.03 1701.8533 15 3.2 568.2935 3 35.54 2 13319 AEV_1_3_RA2_01_1232.d 2.13E5 1 1 134 148 Methylation(others)
K.TSQKPVTTEQGE(+14.02)EVRK.K Y 70.47 1829.9482 16 4.0 610.9925 3 27.73 2 9695 AEV_1_3_RA2_01_1232.d 4.89E5 3 3 134 149 Methylation(others)
K.TSQKPVTTEQGE(+14.02)EVRKK.I Y 69.84 1958.0432 17 6.5 490.5212 4 20.14 3 7922 AEV_3_3_RA3_01_1233.d 2.03E5 1 1 134 150 Methylation(others)
K.YLEC(+57.02)SAR.T Y 68.37 897.4014 7 -87.7 449.6686 2 35.32 1 11846 AEV 2_3_RA2_01_1224.d 1.24E6 6 6 156 162 Carbamidomethylation
K.TSQ(+.98)KPVTTEQGEEVRK.K Y 67.84 1816.9166 16 -0.6 455.2362 4 22.48 3 9145 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 134 149 Deamidation (NQ)
K.WISEVLHFC(+57.02)QGHPIILVGC(+57.02)KK.D Y 67.53 2520.3132 21 2.7 631.0873 4 79.15 3 47403 AEV_3_3_RA3_01_1233.d 7.13E4 1 1 99 119 Carbamidomethylation
K.TSQKPVTTE(+14.02)QGEEVRK.K Y 67.51 1829.9482 16 1.8 458.4952 4 25.66 3 10945 AEV_3_3_RA3_01_1233.d 4.41E5 2 2 134 149 Methylation(others)
R.KLVIVGDGAC(+57.02)GK.T Y 66.40 1215.6646 12 -91.9 608.7837 2 63.98 1 29538 AEV 2_3_RA2_01_1224.d 6.59E5 4 4 7 18 Carbamidomethylation
K.LVIVGDGAC(+57.02)GK.T Y 64.98 1087.5696 11 5.4 544.7950 2 58.17 2 24742 AEV_1_3_RA2_01_1232.d 8.9E5 5 5 8 18 Carbamidomethylation
K.HVELALWDTAGQEDYDR(+14.02).L Y 63.49 2030.9333 17 12.9 677.9938 3 77.48 3 46087 AEV_3_3_RA3_01_1233.d 1.45E5 1 1 52 68 Methylation(KR)
R.TNDGVR(+14.02)EVFESATR.A Y 61.75 1593.7747 14 4.6 532.2679 3 66.30 3 37306 AEV_3_3_RA3_01_1233.d 2.97E5 2 2 163 176 Methylation(KR)
K.TSQKPVTTEQGEEVR(+14.02)K.K Y 61.63 1829.9482 16 4.6 610.9929 3 26.05 2 8966 AEV_1_3_RA2_01_1232.d 4.63E5 5 5 134 149 Methylation(KR)
R.TNDGVREVFE(+14.02)SATR.A Y 61.16 1593.7747 14 7.3 532.2693 3 66.41 2 30243 AEV_1_3_RA2_01_1232.d 1.53E5 2 2 163 176 Methylation(others)
R.KTSQKPVTTEQGEEVRKK.I Y 60.39 2072.1226 18 5.0 519.0405 4 13.52 3 4322 AEV_3_3_RA3_01_1233.d 2.51E4 1 1 133 150
K.TSQKPVTTEQGEE(+14.02)VRKK.I Y 59.38 1958.0432 17 2.6 490.5193 4 19.35 3 7488 AEV_3_3_RA3_01_1233.d 7.98E4 1 1 134 150 Methylation(others)
R.EVFESATR.A Y 58.12 937.4505 8 3.0 469.7339 2 34.73 3 16177 AEV_3_3_RA3_01_1233.d 1.37E6 6 6 169 176
K.HVELALWDTAGQ(+.98)EDYDR.L Y 55.01 2017.9017 17 -79.0 673.5881 3 82.96 1 44156 AEV 2_3_RA2_01_1224.d 1.61E5 1 1 52 68 Deamidation (NQ)
K.TSQKPVTTEQ(+.98)GEEVRK.K Y 52.88 1816.9166 16 -3.9 455.2347 4 23.37 3 9634 AEV_3_3_RA3_01_1233.d 1.86E5 2 2 134 149 Deamidation (NQ)
K.GTFPE(+14.02)VYVPTVFENYVADVEVDGK.H Y 49.53 2687.3005 24 2.3 1344.6606 2 93.42 3 56515 AEV_3_3_RA3_01_1233.d 1.63E5 2 2 28 51 Methylation(others)
K.TSQKPVTTE(+14.02)QGEEVRKK.I Y 48.88 1958.0432 17 3.6 490.5198 4 22.20 2 7305 AEV_1_3_RA2_01_1232.d 4.88E5 2 2 134 150 Methylation(others)
K.DLRDDPRTIEELRK.T Y 45.55 1754.9275 14 3.8 439.7408 4 60.41 3 32722 AEV_3_3_RA3_01_1233.d 2.23E5 1 1 120 133
R.TIEELRK.T Y 44.16 887.5076 7 2.0 444.7619 2 22.66 3 9243 AEV_3_3_RA3_01_1233.d 2.6E6 5 5 127 133
K.TSQK(-1.03)PVTTEQGEEVR.K Y 41.37 1686.8060 15 16.4 563.2852 3 29.28 3 12972 AEV_3_3_RA3_01_1233.d 2.61E5 2 2 134 148 Lysine oxidation to aminoadipic semialdehyde
K.YLE(+14.02)C(+57.02)SAR.T Y 38.80 911.4171 7 0.6 456.7161 2 33.19 3 15250 AEV_3_3_RA3_01_1233.d 7.66E5 3 3 156 162 Methylation(others); Carbamidomethylation
K.WISEVLHFC(+57.02)QGHPIILVGC(+57.02)K.K Y 37.39 2392.2183 20 -1.3 599.0610 4 82.32 2 42368 AEV_1_3_RA2_01_1232.d 2.13E5 1 1 99 118 Carbamidomethylation
K.DLRDDPR.T Y 37.32 885.4304 7 -87.1 443.6839 2 29.11 1 8550 AEV 2_3_RA2_01_1224.d 4.91E5 1 1 120 126
R.DDPRTIEELRK.T Y 36.25 1370.7153 11 4.0 457.9142 3 46.66 2 18761 AEV_1_3_RA2_01_1232.d 1.19E5 1 1 123 133
R.AALLAK.K Y 34.96 585.3849 6 -4.0 586.3899 1 25.65 2 8790 AEV_1_3_RA2_01_1232.d 5.31E4 3 3 177 182
K.YLEC(+57.02)SAR(+14.02).T Y 34.29 911.4171 7 15.6 456.7229 2 33.76 3 15588 AEV_3_3_RA3_01_1233.d 6.04E5 2 2 156 162 Carbamidomethylation; Methylation(KR)
K.TSQKPVTTEQ(+.98)GEEVRK(+14.02).K Y 33.33 1830.9323 16 10.2 458.7450 4 28.60 3 12585 AEV_3_3_RA3_01_1233.d 3.3E5 1 1 134 149 Deamidation (NQ); Methylation(KR)
R.TIEELR.K N 32.95 759.4127 6 -89.9 380.6795 2 49.29 1 19829 AEV 2_3_RA2_01_1224.d 1.21E6 5 5 127 132
K.TSQ(+.98)KPVTTEQGEEVR(+14.02).K Y 31.08 1702.8373 15 7.4 568.6239 3 38.85 2 14920 AEV_1_3_RA2_01_1232.d 2.21E5 2 2 134 148 Deamidation (NQ); Methylation(KR)
R.EVFE(+14.02)SATR.A Y 30.90 951.4661 8 0.9 476.7408 2 43.92 3 21864 AEV_3_3_RA3_01_1233.d 3.11E5 2 2 169 176 Methylation(others)
R.E(+14.02)VFESATR.A Y 27.39 951.4661 8 4.7 476.7426 2 45.77 2 18316 AEV_1_3_RA2_01_1232.d 7.33E4 1 1 169 176 Methylation(others)
K.TSQ(+.98)KPVTTEQ(+.98)GEEVR.K Y 24.10 1689.8057 15 11.4 564.2822 3 30.84 2 11101 AEV_1_3_RA2_01_1232.d 2.85E4 1 1 134 148 Deamidation (NQ)
K.IGAYK(+27.99).Y Y 23.88 578.3064 5 -83.5 579.2654 1 52.49 1 21657 AEV 2_3_RA2_01_1224.d 9.68E4 1 1 151 155 Formylation
R.EVFESATR(+14.02).A Y 22.92 951.4661 8 2.2 476.7414 2 44.90 3 22590 AEV_3_3_RA3_01_1233.d 0 1 1 169 176 Methylation(KR)
R.K(+42.01)TSQ(+.98)K(+42.01)PVTTEQGEEVR.K Y 22.14 1900.9377 16 -9.8 951.4668 2 84.72 3 51512 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 133 148 Acetylation (N-term); Deamidation (NQ); Acetylation (K)
K.TSQKPVTT(+14.02)EQGEEVR.K Y 22.02 1701.8533 15 -91.0 568.2401 3 48.26 1 19221 AEV 2_3_RA2_01_1224.d 5.88E5 1 1 134 148 Methylation(others)
K.T(+13.03)SQKPVTTEQGEEVRK.K Y 21.65 1828.9642 16 8.4 458.2522 4 25.57 3 10891 AEV_3_3_RA3_01_1233.d 3.1E4 1 1 134 149 Michael addition with methylamine
K.IGAY(-18.01)K(+14.02)YLEC(+57.02)SAR.T Y 21.56 1425.7074 12 28.5 476.2566 3 61.07 3 33242 AEV_3_3_RA3_01_1233.d 1.98E5 1 1 151 162 Dehydration; Methylation(KR); Carbamidomethylation
K.TSQKPVTT(-2.02)EQGEEVR.K Y 20.77 1685.8220 15 -26.9 562.9329 3 29.68 3 13204 AEV_3_3_RA3_01_1233.d 6.37E2 1 1 134 148 2-amino-3-oxo-butanoic_acid
R.T(-18.01)NDGVR(+14.02)EVFESATR.A Y 18.48 1575.7640 14 -0.2 526.2618 3 65.13 3 36382 AEV_3_3_RA3_01_1233.d 0 1 1 163 176 Dehydration; Methylation(KR)
R.TIEELR(+14.02)K.T Y 18.09 901.5233 7 2.0 301.5156 3 30.77 3 13827 AEV_3_3_RA3_01_1233.d 4.47E5 1 1 127 133 Methylation(KR)
K.T(+42.01)SQK(+42.01)PVTT(+79.97)EQGEEVR.K Y 17.34 1851.8251 15 -36.4 618.2598 3 39.90 1 14343 AEV 2_3_RA2_01_1224.d 0 1 1 134 148 Acetylation (N-term); Acetylation (K); Phosphorylation (STY)
R.T(+42.01)IEELRK.T Y 16.99 929.5182 7 -70.5 310.8248 3 41.45 1 15252 AEV 2_3_RA2_01_1224.d 2.17E5 1 1 127 133 Acetylation (N-term)
R.KKIGAY(-18.01)K(+14.02).Y Y 15.14 802.5065 7 67.4 803.5679 1 102.46 2 51734 AEV_1_3_RA2_01_1232.d 1.9E4 1 1 149 155 Dehydration; Methylation(KR)
R.KKIGAY(+31.99)K.Y Y 15.10 838.4912 7 -5.6 839.4938 1 105.04 3 60613 AEV_3_3_RA3_01_1233.d 3.16E5 1 1 149 155 Dihydroxy
K.LVIVGD(+14.02)GAC(+57.02)GK.T Y 15.01 1101.5852 11 -6.1 551.7965 2 43.49 3 21653 AEV_3_3_RA3_01_1233.d 7.76E4 1 1 8 18 Methylation(others); Carbamidomethylation
total 63 peptides
C1GBZ4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AANAGGVAVSGLEMAQNAQR.L Y 132.78 1913.9377 20 5.2 638.9899 3 72.23 2 34526 AEV_1_3_RA2_01_1232.d 8.25E5 6 6 376 395
R.EHGGSITPEEIYLIQQIKVER.K Y 115.05 2438.2805 21 3.6 610.5796 4 79.15 3 47400 AEV_3_3_RA3_01_1233.d 2.58E5 2 2 261 281
R.VAISGSGNVAQYAALK.A Y 113.74 1547.8307 16 -0.5 774.9222 2 70.87 2 33518 AEV_1_3_RA2_01_1232.d 6.25E5 3 3 224 239
K.HIGADIDVPAGDIGVSGR.E Y 111.38 1747.8853 18 -1.4 583.6349 3 70.81 3 40889 AEV_3_3_RA3_01_1233.d 1.02E6 6 6 143 160
K.AANAGGVAVSGLEM(+15.99)AQNAQR.L Y 104.45 1929.9326 20 0.8 644.3187 3 65.85 3 36950 AEV_3_3_RA3_01_1233.d 0 1 1 376 395 Oxidation (M)
K.AIEFGGTVC(+57.02)SLSDSK.G Y 94.46 1569.7345 15 -0.8 785.8739 2 72.24 3 42042 AEV_3_3_RA3_01_1233.d 3.29E5 3 3 240 254 Carbamidomethylation
R.VTWENDKGGLEVNR.G Y 91.50 1615.7954 14 -1.9 539.6047 3 60.68 3 32931 AEV_3_3_RA3_01_1233.d 7.45E5 4 4 51 64
R.ALAVAAVPER.T Y 88.50 995.5764 10 1.9 498.7964 2 60.12 2 25959 AEV_1_3_RA2_01_1232.d 1.65E6 3 3 36 45
M.S(+42.01)HLAVEPEFEQAYRELASTLENSTLFDQHPEYRR.A Y 86.62 4103.9614 34 1.6 821.8009 5 90.75 2 47610 AEV_1_3_RA2_01_1232.d 1.08E5 1 1 2 35 Acetylation (Protein N-term)
K.FLGFEQIFK.N Y 79.71 1127.6014 9 2.7 564.8095 2 85.80 2 44842 AEV_1_3_RA2_01_1232.d 7.18E5 3 3 94 102
R.VAISGSGNVAQYAALK(+14.02).A Y 75.42 1561.8463 16 4.2 781.9337 2 74.42 2 36190 AEV_1_3_RA2_01_1232.d 1.75E4 1 1 224 239 Methylation(KR)
R.DC(+57.02)FVTGVETAK.K Y 73.60 1225.5648 11 -1.2 613.7889 2 63.07 2 27925 AEV_1_3_RA2_01_1232.d 5.01E5 4 4 413 423 Carbamidomethylation
M.S(+42.01)HLAVEPEFEQAYRELASTLENSTLFDQHPEYR.R Y 73.07 3947.8601 33 -12.0 987.9604 4 92.66 3 56137 AEV_3_3_RA3_01_1233.d 1E5 2 2 2 34 Acetylation (Protein N-term)
M.S(+42.01)HLAVEPEFEQAYR.E Y 72.35 1716.8107 14 -0.9 859.4119 2 75.20 3 44293 AEV_3_3_RA3_01_1233.d 4.38E5 2 2 2 15 Acetylation (Protein N-term)
R.RALAVAAVPER.T Y 71.15 1151.6775 11 10.2 384.9037 3 53.11 2 22039 AEV_1_3_RA2_01_1232.d 5.4E4 2 2 35 45
R.EHGGSITPEEIYLIQQIK.V Y 69.32 2054.0684 18 2.2 514.5255 4 80.34 2 40838 AEV_1_3_RA2_01_1232.d 2.27E5 2 2 261 278
R.VQFNSALGPYK.G Y 66.70 1222.6345 11 -2.0 612.3233 2 67.73 3 38435 AEV_3_3_RA3_01_1233.d 6.48E5 4 4 68 78
K.SVWYGPGK.A Y 64.98 892.4443 8 -1.3 447.2289 2 53.21 3 27848 AEV_3_3_RA3_01_1233.d 7.49E5 4 4 368 375
K.AIEFGGTVC(+57.02)SLSDSKGSLIAR.E Y 64.66 2167.0942 21 -2.1 723.3705 3 76.98 2 38165 AEV_1_3_RA2_01_1232.d 1E5 1 1 240 260 Carbamidomethylation
K.Q(-17.03)LSTLASTDALRER.C Y 62.70 1542.8002 14 0.1 772.4074 2 75.80 2 37236 AEV_1_3_RA2_01_1232.d 3.68E5 2 2 283 296 Pyro-glu from Q
R.VQFNSALGPYKGGLR.F Y 59.09 1605.8627 15 8.0 536.2991 3 69.16 2 32219 AEV_1_3_RA2_01_1232.d 1.9E4 1 1 68 82
M.S(+42.01)HLAVEPEFEQAYRELASTLEN(+.98)STLFDQHPEYR.R Y 57.72 3948.8442 33 8.1 790.7825 5 92.85 2 48525 AEV_1_3_RA2_01_1232.d 4.11E4 1 1 2 34 Acetylation (Protein N-term); Deamidation (NQ)
K.AIEFGGTVC(+57.02)SLSDSK(+14.02).G Y 56.85 1583.7501 15 -2.2 792.8806 2 73.96 3 43321 AEV_3_3_RA3_01_1233.d 7.94E4 1 1 240 254 Carbamidomethylation; Methylation(KR)
R.KQLSTLASTDALR.E Y 54.95 1402.7780 13 -6.0 468.5971 3 59.20 3 31818 AEV_3_3_RA3_01_1233.d 5.07E4 1 1 282 294
M.SH(+40.03)LAVEPEFEQAYRELASTLENSTLFDQHPEYRR.A Y 52.88 4101.9819 34 23.0 821.4225 5 90.55 3 55012 AEV_3_3_RA3_01_1233.d 1.97E5 1 1 2 35 Propionaldehyde +40
R.EIGFLFGAYKR.Q Y 50.13 1299.6975 11 2.7 434.2410 3 76.90 3 45616 AEV_3_3_RA3_01_1233.d 4.29E5 4 4 161 171
R.DC(+57.02)FVTGVETAKK.Y Y 46.23 1353.6598 12 5.3 677.8408 2 52.22 3 27191 AEV_3_3_RA3_01_1233.d 2.94E5 3 3 413 424 Carbamidomethylation
K.GGADFDPK.G Y 44.23 805.3606 8 0.9 403.6879 2 26.29 3 11306 AEV_3_3_RA3_01_1233.d 8.86E5 3 3 115 122
K.AANAGGVAVS(-2.02)GLEMAQNAQR.L Y 44.04 1911.9221 20 12.8 638.3228 3 71.77 3 41620 AEV_3_3_RA3_01_1233.d 0 1 1 376 395 2-amino-3-oxo-butanoic_acid
R.EHGGSITPEEIYLIQQIK(+14.02)VER.K Y 39.00 2452.2961 21 -43.8 614.0544 4 80.50 3 48452 AEV_3_3_RA3_01_1233.d 0 1 1 261 281 Methylation(KR)
R.FHPTVNMSILK.F Y 37.94 1285.6853 11 -80.5 429.5345 3 79.76 1 41652 AEV 2_3_RA2_01_1224.d 6.02E4 1 1 83 93
K.NALTGLNMGGGK.G Y 35.04 1131.5707 12 -1.4 566.7918 2 61.89 3 33883 AEV_3_3_RA3_01_1233.d 0 2 2 103 114
R.VTWENDKGGLEVNR(+14.02).G Y 33.21 1629.8110 14 16.7 544.2867 3 62.43 3 34323 AEV_3_3_RA3_01_1233.d 0 1 1 51 64 Methylation(KR)
R.HLWEGVLTGK.G Y 31.56 1138.6135 10 -78.4 380.5154 3 80.06 1 41889 AEV 2_3_RA2_01_1224.d 8.24E4 1 1 174 183
K.AANAGGVAVSGLEM(-4.99)AQNAQR.L Y 31.19 1908.9514 20 4.9 637.3275 3 71.90 3 41727 AEV_3_3_RA3_01_1233.d 1.23E5 1 1 376 395 Methionine replacement by azido homoalanine
M.S(+42.01)HLAVEPEFEQAYR(+14.02).E Y 29.15 1730.8263 14 1.5 866.4218 2 77.76 2 38781 AEV_1_3_RA2_01_1232.d 1.11E5 3 3 2 15 Acetylation (Protein N-term); Methylation(KR)
R.EHGGSITPEEIYLIQQIKVER(-.98).K Y 27.64 2437.2964 21 -10.7 610.3248 4 79.50 2 40163 AEV_1_3_RA2_01_1232.d 7.2E4 1 1 261 281 Amidation
R.EHGGSITPEEIYLIQ(+.98)Q(+.98)IK.V Y 26.20 2056.0364 18 -4.2 686.3499 3 79.97 3 48043 AEV_3_3_RA3_01_1233.d 4.89E4 1 1 261 278 Deamidation (NQ)
R.TIQFR.V N 25.42 663.3704 5 -2.5 664.3760 1 84.26 3 51201 AEV_3_3_RA3_01_1233.d 1.17E6 4 4 46 50
K.VAEAM(+15.99)KDQGDWW Y 25.10 1450.6187 12 -3.0 726.3145 2 69.29 3 39684 AEV_3_3_RA3_01_1233.d 3.17E4 1 1 448 459 Oxidation (M)
K.FLGFEQIFKNALTGLNMGGGK.G Y 22.05 2241.1616 21 11.9 748.0701 3 92.65 2 48441 AEV_1_3_RA2_01_1232.d 3.85E4 1 1 94 114
K.VAEAMK(-.98).D Y 21.70 646.3472 6 -32.9 647.3333 1 46.29 3 23371 AEV_3_3_RA3_01_1233.d 0 1 1 448 453 Amidation
K.AIE(+28.03)FGGTVC(+57.02)SLSDSK.G Y 21.09 1597.7657 15 6.5 400.4513 4 71.02 3 41029 AEV_3_3_RA3_01_1233.d 0 1 1 240 254 Ethylation; Carbamidomethylation
K.GSLIAR.E Y 20.81 615.3704 6 -87.1 308.6656 2 42.64 1 15942 AEV 2_3_RA2_01_1224.d 1.22E5 1 1 255 260
K.GGADFDPKGKSDNEIR.K Y 20.72 1704.8066 16 -49.1 569.2482 3 76.27 1 38870 AEV 2_3_RA2_01_1224.d 4.76E4 1 1 115 130
R.KQLST(-2.02)LASTDALR.E Y 20.30 1400.7623 13 -4.5 467.9260 3 59.20 3 31819 AEV_3_3_RA3_01_1233.d 0 1 1 282 294 2-amino-3-oxo-butanoic_acid
K.VAEAMK.D Y 20.25 647.3312 6 -102.2 648.2723 1 75.32 1 38131 AEV 2_3_RA2_01_1224.d 3.57E4 1 1 448 453
K.N(+.98)ALTGLNMGGGK.G Y 20.01 1132.5547 12 25.0 567.2988 2 46.78 3 23677 AEV_3_3_RA3_01_1233.d 7.18E4 1 1 103 114 Deamidation (NQ)
R.EIGFLFGAYK.R Y 19.78 1143.5964 10 9.5 572.8109 2 82.61 2 42585 AEV_1_3_RA2_01_1232.d 3.04E4 1 1 161 170
K.FCSAFMM(+15.99)ELSK.H Y 19.74 1308.5553 11 16.7 328.1516 4 64.32 1 29797 AEV 2_3_RA2_01_1224.d 0 1 1 132 142 Oxidation (M)
K.NALTGLNMGGGK(+43.01).G Y 19.36 1174.5764 12 -10.3 588.2894 2 43.04 3 21313 AEV_3_3_RA3_01_1233.d 0 1 1 103 114 Carbamylation
R.VAISGSGN(+.98)VAQYAALK.A Y 19.35 1548.8147 16 -4.2 388.2093 4 35.99 3 16925 AEV_3_3_RA3_01_1233.d 7.96E4 1 1 224 239 Deamidation (NQ)
K.AIEFGGTVCSLS(+79.97)DSK.G Y 19.17 1592.6793 15 -2.4 399.1761 4 54.34 1 22759 AEV 2_3_RA2_01_1224.d 0 1 1 240 254 Phosphorylation (STY)
R.TIQFR(+31.99).V N 18.84 695.3602 5 -1.4 696.3665 1 45.14 3 22649 AEV_3_3_RA3_01_1233.d 5.52E4 1 1 46 50 Dihydroxy
K.KYTHPDEGKLPSLVTGSNIAGFMK.V Y 18.78 2589.3262 24 -65.0 518.8389 5 84.40 1 45302 AEV 2_3_RA2_01_1224.d 0 1 1 424 447
K.NALTGLNM(+15.99)GGGK.G Y 18.71 1147.5656 12 -71.5 574.7490 2 58.70 1 25566 AEV 2_3_RA2_01_1224.d 9.39E4 1 1 103 114 Oxidation (M)
K.Q(+43.01)LSTLASTDALR.E Y 18.33 1317.6888 12 11.2 330.4332 4 30.20 2 10801 AEV_1_3_RA2_01_1232.d 8.03E4 1 1 283 294 Carbamylation
R.VQFN(+.98)SALGPYK(+27.99).G Y 18.19 1251.6135 11 -2.6 418.2107 3 21.96 3 8878 AEV_3_3_RA3_01_1233.d 1.54E5 1 1 68 78 Deamidation (NQ); Formylation
K.KYTHPD(-18.01)EGK(+14.02)LPSLVTGSNIAGFMK.V Y 18.19 2585.3311 24 -14.6 518.0659 5 75.89 3 44829 AEV_3_3_RA3_01_1233.d 3.21E4 1 1 424 447 Dehydration; Methylation(KR)
K.R(+42.01)VAISGS(+79.97)GNVAQ(+.98)YAALK.A Y 18.08 1826.8927 17 27.7 914.4789 2 81.31 3 49074 AEV_3_3_RA3_01_1233.d 4.14E4 1 1 223 239 Acetylation (N-term); Phosphorylation (STY); Deamidation (NQ)
K.QLSTLASTD(+21.98)ALRER.C Y 18.00 1581.8086 14 -8.5 528.2723 3 24.63 2 8327 AEV_1_3_RA2_01_1232.d 0 1 1 283 296 Sodium adduct
K.QLSTLAST(-18.01)DALR.E Y 17.96 1256.6725 12 13.5 315.1796 4 67.19 1 31790 AEV 2_3_RA2_01_1224.d 0 1 1 283 294 Dehydration
K.S(+42.01)DNEIR(+21.98).K Y 17.60 796.3327 6 2.9 797.3423 1 97.53 1 54693 AEV 2_3_RA2_01_1224.d 9.75E4 1 1 125 130 Acetylation (N-term); Sodium adduct
K.GGLEVNR(-.98).G Y 17.38 742.4086 7 7.2 372.2142 2 72.09 3 41867 AEV_3_3_RA3_01_1233.d 8.41E4 1 1 58 64 Amidation
K.N(+42.01)ALTGLNMGGGK.G Y 17.33 1173.5812 12 -10.8 392.1968 3 16.24 2 4842 AEV_1_3_RA2_01_1232.d 0 1 1 103 114 Acetylation (N-term)
R.T(+42.01)IQFR.V N 17.29 705.3810 5 -22.9 353.6897 2 52.33 1 21551 AEV 2_3_RA2_01_1224.d 6.91E5 1 1 46 50 Acetylation (N-term)
K.G(+42.01)SLIAR(+21.98).E Y 17.28 679.3629 6 -13.6 680.3610 1 53.82 3 28241 AEV_3_3_RA3_01_1233.d 0 1 1 255 260 Acetylation (N-term); Sodium adduct
K.GGADFDPK(+14.02).G Y 17.12 819.3762 8 -36.8 410.6803 2 53.72 1 22371 AEV 2_3_RA2_01_1224.d 0 1 1 115 122 Methylation(KR)
K.Q(+42.01)LSTLASTDALR.E Y 16.59 1316.6936 12 -59.7 330.1610 4 52.11 1 21429 AEV 2_3_RA2_01_1224.d 0 1 1 283 294 Acetylation (N-term)
K.A(+43.01)IEFGGTVC(+57.02)SLSDSK.G Y 16.48 1612.7402 15 -14.5 404.1865 4 75.40 1 38197 AEV 2_3_RA2_01_1224.d 7.47E4 1 1 240 254 Carbamylation; Carbamidomethylation
K.SVWYGPGK(+14.02).A Y 16.40 906.4599 8 8.2 454.2409 2 58.02 3 30962 AEV_3_3_RA3_01_1233.d 1.07E5 1 1 368 375 Methylation(KR)
K.NALTGLNMGGGK(+21.98)(+42.01).G Y 16.28 1195.5631 12 9.2 399.5320 3 38.12 2 14574 AEV_1_3_RA2_01_1232.d 0 1 1 103 114 Sodium adduct; Acetylation (K)
K.AANAGGVAVSGLE(+14.02)MAQNAQR.L Y 16.24 1927.9534 20 8.1 643.6636 3 73.72 2 35672 AEV_1_3_RA2_01_1232.d 1.19E5 1 1 376 395 Methylation(others)
K.N(+43.01)ALTGLNMGGGK.G Y 16.18 1174.5764 12 6.7 588.2994 2 43.56 2 17230 AEV_1_3_RA2_01_1232.d 7.14E4 1 1 103 114 Carbamylation
K.Q(+42.01)LSTLAST(+79.97)DALR(+14.02).E Y 16.18 1410.6755 12 -65.0 353.6532 4 24.85 1 6481 AEV 2_3_RA2_01_1224.d 9.74E4 1 1 283 294 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
K.L(+43.01)PSLVTGSNIAGFMK.V Y 16.02 1576.8282 15 7.3 395.2172 4 54.04 3 28382 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 433 447 Carbamylation
R.FHSKGKSVWYGPGK.A Y 16.00 1576.8149 14 4.1 395.2126 4 27.38 3 11884 AEV_3_3_RA3_01_1233.d 0 1 1 362 375
R.QRHLWEGVLTGK(+42.01).G Y 15.75 1464.7837 12 -64.6 367.1795 4 59.36 1 26024 AEV 2_3_RA2_01_1224.d 1.62E5 1 1 172 183 Acetylation (K)
K.QLS(-15.99)TLASTDALR.E Y 15.75 1258.6881 12 -19.0 630.3394 2 80.29 2 40797 AEV_1_3_RA2_01_1232.d 3.56E4 1 1 283 294 Deoxy
K.GGLEVNR(+31.99).G Y 15.75 775.3824 7 -20.2 776.3740 1 77.53 3 46127 AEV_3_3_RA3_01_1233.d 4E4 1 1 58 64 Dihydroxy
K.Q(+42.01)LST(-18.01)LASTDALR.E Y 15.58 1298.6830 12 23.1 325.6855 4 44.09 3 21980 AEV_3_3_RA3_01_1233.d 0 1 1 283 294 Acetylation (N-term); Dehydration
R.VTWENDKGGLEVN(+162.05)R.G Y 15.43 1777.8481 14 11.0 445.4742 4 78.99 1 41039 AEV 2_3_RA2_01_1224.d 0 1 1 51 64 Hexose (NSY)
K.L(+42.01)PSLVTGSN(+.98)IAGFMK(+14.02).V Y 15.37 1590.8328 15 -39.2 398.6999 4 21.00 3 8370 AEV_3_3_RA3_01_1233.d 2.22E5 1 1 433 447 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
K.SVWY(-18.01)GPGK.A Y 15.18 874.4337 8 -52.9 875.3948 1 96.62 1 54165 AEV 2_3_RA2_01_1224.d 0 1 1 368 375 Dehydration
K.QLSTLASTDALR(+14.02)ER.C Y 15.10 1573.8424 14 -0.1 394.4678 4 78.22 3 46680 AEV_3_3_RA3_01_1233.d 5.55E4 1 1 283 296 Methylation(KR)
R.ELASTLENSTLFDQHPEYR.R Y 15.05 2249.0601 19 -43.4 563.2479 4 86.32 1 46821 AEV 2_3_RA2_01_1224.d 3.92E4 1 1 16 34
total 86 peptides
A0A0A0HVP8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.GRDYVDQLNQILHYLGTPNEETLSR.I Y 159.18 2930.4521 25 6.6 733.6251 4 87.79 2 46077 AEV_1_3_RA2_01_1232.d 5.41E5 4 4 235 259
R.DYVDQLNQILHYLGTPNEETLSR.I Y 124.97 2717.3296 23 -3.0 906.7811 3 92.67 2 48449 AEV_1_3_RA2_01_1232.d 2.56E5 2 2 237 259
R.GFSIDPDENAGYMTEYVATR.W Y 112.76 2234.9790 20 3.8 1118.5010 2 81.87 2 42026 AEV_1_3_RA2_01_1232.d 3.65E5 3 3 177 196
R.APEIMLSFPSYTK.A Y 102.43 1482.7428 13 2.9 742.3809 2 81.23 2 41563 AEV_1_3_RA2_01_1232.d 5.02E5 4 4 200 212
K.VFNQEFVVDER.Y Y 84.15 1380.6674 11 -4.2 691.3381 2 70.95 2 33556 AEV_1_3_RA2_01_1232.d 2.09E5 3 3 12 22
R.LFPSANPDALDLLDR.M Y 82.22 1655.8518 15 -3.3 828.9304 2 84.26 2 43829 AEV_1_3_RA2_01_1232.d 6.66E5 3 3 283 297
R.SGQPLTDAHFQSFIYQILC(+57.02)GLK.Y Y 81.72 2522.2627 22 6.9 841.7673 3 93.17 3 56416 AEV_3_3_RA3_01_1233.d 2.51E5 2 2 121 142 Carbamidomethylation
R.APEIM(+15.99)LSFPSYTK.A Y 79.07 1498.7377 13 7.7 750.3819 2 79.23 2 39953 AEV_1_3_RA2_01_1232.d 9.66E4 1 1 200 212 Oxidation (M)
R.DLKPGNLLVNADC(+57.02)ELK.I Y 77.07 1797.9294 16 3.2 600.3190 3 77.17 2 38312 AEV_1_3_RA2_01_1232.d 3.57E5 2 2 153 168 Carbamidomethylation
R.NLPFMHKIPFQR.L Y 73.42 1526.8180 12 -7.7 382.7088 4 72.74 3 42405 AEV_3_3_RA3_01_1233.d 6.92E5 4 4 271 282
R.ISVEEALEHR.Y Y 72.61 1181.6040 10 4.9 394.8772 3 64.86 2 29194 AEV_1_3_RA2_01_1232.d 5.39E5 4 4 307 316
R.GFSIDPDENAGYMTE(+14.02)YVATR.W Y 71.88 2248.9946 20 -0.3 1125.5043 2 82.93 3 50266 AEV_3_3_RA3_01_1233.d 5.89E4 1 1 177 196 Methylation(others)
R.LFPSANPDALDLLDRMLAFDPSSR.I Y 70.70 2660.3267 24 -6.2 887.7773 3 93.46 3 56535 AEV_3_3_RA3_01_1233.d 3.24E5 4 4 283 306
K.IC(+57.02)DFGLAR.G N 69.66 950.4644 8 10.8 476.2446 2 65.91 2 29886 AEV_1_3_RA2_01_1232.d 1.38E6 5 5 169 176 Carbamidomethylation
R.GFSIDPDENAGYMTEYVATR(+14.02).W Y 58.89 2248.9946 20 1.9 1125.5067 2 83.05 2 42913 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 177 196 Methylation(KR)
R.MILDEVVR.F Y 49.81 973.5266 8 1.0 487.7711 2 73.14 2 35222 AEV_1_3_RA2_01_1232.d 2.08E5 2 2 350 357
R.DLKPGNLLVNADC(+57.02)ELKIC(+57.02)DFGLAR.G Y 45.52 2730.3833 24 -2.7 911.1326 3 84.52 3 51381 AEV_3_3_RA3_01_1233.d 3.74E4 1 1 153 176 Carbamidomethylation
R.NLPFM(+15.99)HKIPFQR.L Y 41.28 1542.8129 12 -1.7 386.7098 4 67.18 3 38006 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 271 282 Oxidation (M)
R.DLK(-1.03)PGNLLVNADC(+57.02)ELKIC(+57.02)DFGLAR.G Y 40.65 2729.3516 24 8.4 683.3509 4 84.76 2 44149 AEV_1_3_RA2_01_1232.d 0 1 1 153 176 Lysine oxidation to aminoadipic semialdehyde; Carbamidomethylation
K.GRDYVDQLNQ(+.98)ILHYLGTPN(+.98)EETLSR.I Y 40.42 2932.4202 25 46.6 734.1465 4 88.24 3 53735 AEV_3_3_RA3_01_1233.d 0 1 1 235 259 Deamidation (NQ)
R.MLAFDPSSR.I Y 38.99 1022.4855 9 13.8 512.2571 2 65.91 3 37038 AEV_3_3_RA3_01_1233.d 7.1E5 4 4 298 306
K.GRDYVDQLNQILHYLGTPNEE(+14.02)TLSR.I Y 35.44 2944.4678 25 -14.9 737.1133 4 88.57 2 46500 AEV_1_3_RA2_01_1232.d 0 1 1 235 259 Methylation(others)
K.VTNVFSK.K Y 34.40 793.4334 7 -88.2 397.6890 2 52.74 1 21802 AEV 2_3_RA2_01_1224.d 6.28E5 5 5 54 60
R.DLKPGNLLVNADC(+57.02)ELK(+14.02).I Y 34.37 1811.9451 16 10.6 604.9954 3 79.42 2 40097 AEV_1_3_RA2_01_1232.d 1.22E5 1 1 153 168 Carbamidomethylation; Methylation(KR)
R.IS(-2.02)VEEALEHR.Y Y 33.41 1179.5884 10 31.7 394.2159 3 64.17 3 35633 AEV_3_3_RA3_01_1233.d 1.26E5 2 2 307 316 2-amino-3-oxo-butanoic_acid
K.VTNVFSKK.I Y 31.31 921.5283 8 3.3 461.7729 2 26.73 2 9256 AEV_1_3_RA2_01_1232.d 1.85E4 1 1 54 61
K.LLQHFR.G Y 30.68 812.4657 6 -3.9 407.2385 2 37.83 3 18094 AEV_3_3_RA3_01_1233.d 1.07E5 3 3 73 78
R.AQEYVR.N Y 30.02 764.3817 6 -76.6 383.1688 2 27.41 1 7688 AEV 2_3_RA2_01_1224.d 2.22E5 2 2 265 270
R.APE(+14.02)IMLSFPSYTK.A Y 29.53 1496.7584 13 -4.2 749.3834 2 82.51 2 42518 AEV_1_3_RA2_01_1232.d 1.06E5 2 2 200 212 Methylation(others)
R.LFPSANPDALDLLDR(+14.02).M Y 28.83 1669.8674 15 3.2 835.9437 2 85.69 2 44775 AEV_1_3_RA2_01_1232.d 2.21E5 1 1 283 297 Methylation(KR)
R.APEIM(+15.99)LSFPSYTK(+42.01).A Y 27.68 1540.7483 13 25.3 386.2041 4 16.95 2 5139 AEV_1_3_RA2_01_1232.d 0 1 1 200 212 Oxidation (M); Acetylation (K)
K.VFNQEFVVD(-18.01)ER.Y Y 27.58 1362.6567 11 -53.9 455.2017 3 65.52 1 30563 AEV 2_3_RA2_01_1224.d 0 1 1 12 22 Dehydration
R.DYVDQ(+.98)LNQILHYLGTPNEETLSR(+14.02).I Y 26.72 2732.3293 23 10.4 911.7932 3 93.48 2 48776 AEV_1_3_RA2_01_1232.d 8.52E4 1 1 237 259 Deamidation (NQ); Methylation(KR)
R.NPNDLEASLQR.G Y 25.19 1255.6156 11 8.1 628.8202 2 61.18 2 26649 AEV_1_3_RA2_01_1232.d 0 1 1 412 422
R.M(-4.99)ILDEVVR.F Y 23.64 968.5403 8 -20.1 485.2677 2 73.18 2 35254 AEV_1_3_RA2_01_1232.d 6.51E4 1 1 350 357 Methionine replacement by azido homoalanine
K.IPFQR.L N 23.57 659.3755 5 -0.2 330.6949 2 38.10 3 18253 AEV_3_3_RA3_01_1233.d 1.83E5 1 1 278 282
R.IGS(+79.96)PR.A N 22.96 608.2588 5 40.4 609.2906 1 21.95 2 7199 AEV_1_3_RA2_01_1232.d 0 1 1 260 264 Sulfation
R.N(+27.99)PNDLEASLQR.G Y 22.81 1283.6106 11 -9.4 642.8065 2 64.03 2 28575 AEV_1_3_RA2_01_1232.d 6.15E4 1 1 412 422 Formylation
K.YIHSANVLHR.D Y 22.65 1208.6414 10 2.4 303.1683 4 36.42 3 17196 AEV_3_3_RA3_01_1233.d 1.04E5 2 2 143 152
R.I(+42.01)GSPR.A N 22.12 570.3126 5 -22.8 571.3068 1 85.87 2 44893 AEV_1_3_RA2_01_1232.d 6.68E4 1 1 260 264 Acetylation (N-term)
R.DYVDQLNQILHYLGTPNEETLSR(+14.02).I Y 21.41 2731.3452 23 -4.8 911.4513 3 92.67 2 48447 AEV_1_3_RA2_01_1232.d 5.88E4 1 1 237 259 Methylation(KR)
R.IGSPR.A N 21.06 528.3020 5 -151.6 529.2292 1 68.13 1 32529 AEV 2_3_RA2_01_1224.d 9.83E4 4 4 260 264
R.M(+15.99)LAFDPSSR.I Y 21.04 1038.4803 9 -25.5 347.1586 3 48.10 1 19145 AEV 2_3_RA2_01_1224.d 8.45E4 1 1 298 306 Oxidation (M)
R.IGSPRAQEYVR(+31.99).N Y 20.89 1306.6630 11 -3.0 654.3368 2 75.89 3 44828 AEV_3_3_RA3_01_1233.d 7.14E4 1 1 260 270 Dihydroxy
K.VT(+79.97)N(+.98)VFSK.K Y 20.10 874.3837 7 -26.1 875.3682 1 92.65 1 51520 AEV 2_3_RA2_01_1224.d 2.91E5 1 1 54 60 Phosphorylation (STY); Deamidation (NQ)
R.MLAFDPS(+79.96)S(+79.97)R.I Y 18.62 1182.4087 9 161.7 395.2072 3 68.02 1 32452 AEV 2_3_RA2_01_1224.d 6.79E4 1 1 298 306 Sulfation; Phosphorylation (STY)
R.DYVDQLN(+.98)Q(+.98)ILHYLGTPNEETLSR(+14.02).I Y 18.04 2733.3132 23 26.3 912.1356 3 93.60 3 56607 AEV_3_3_RA3_01_1233.d 1.26E5 1 1 237 259 Deamidation (NQ); Methylation(KR)
R.IGS(+79.97)PR.A N 17.75 608.2683 5 -10.0 609.2695 1 49.68 1 20074 AEV 2_3_RA2_01_1224.d 0 1 1 260 264 Phosphorylation (STY)
R.WYRAPEIM(+31.99)LSFPSYTK.A Y 17.18 2019.9764 16 41.7 674.3608 3 82.16 2 42247 AEV_1_3_RA2_01_1232.d 0 1 1 197 212 Sulphone
K.ILAKR.A N 17.02 599.4119 5 8.1 300.7156 2 11.16 2 2900 AEV_1_3_RA2_01_1232.d 7.61E4 1 1 62 66
R.M(+42.01)LAFDPSS(+79.97)R.I Y 16.89 1144.4624 9 -47.9 573.2111 2 33.39 1 10856 AEV 2_3_RA2_01_1224.d 0 1 1 298 306 Acetylation (N-term); Phosphorylation (STY)
M(+42.01)TDLPGR(+14.02).K Y 16.75 844.4113 7 -44.8 423.1940 2 70.37 1 34246 AEV 2_3_RA2_01_1224.d 9.73E4 1 1 1 7 Acetylation (Protein N-term); Methylation(KR)
K.YIHSAN(+.98)VLHR.D Y 16.10 1209.6255 10 -19.6 404.2079 3 60.47 3 32763 AEV_3_3_RA3_01_1233.d 6.73E5 3 3 143 152 Deamidation (NQ)
R.I(+27.99)GSPR.A N 15.89 556.2969 5 -29.5 557.2877 1 71.07 3 41069 AEV_3_3_RA3_01_1233.d 0 1 1 260 264 Formylation
K.V(+43.01)TN(+.98)VFSK.K Y 15.82 837.4232 7 -3.4 838.4277 1 84.14 2 43714 AEV_1_3_RA2_01_1232.d 8.45E4 1 1 54 60 Carbamylation; Deamidation (NQ)
R.M(+15.99)LAFD(+21.98)PSSR.I Y 15.82 1060.4624 9 10.7 531.2441 2 72.59 1 35971 AEV 2_3_RA2_01_1224.d 0 1 1 298 306 Oxidation (M); Sodium adduct
MTDLPGR.K Y 15.23 788.3851 7 118.7 789.4859 1 102.16 1 56435 AEV 2_3_RA2_01_1224.d 2.12E4 1 1 1 7
R.MLAFDPSS(+136.03)R.I Y 15.18 1158.5144 9 -53.7 580.2334 2 34.46 1 11402 AEV 2_3_RA2_01_1224.d 0 1 1 298 306 O-Diethylphosphorylation
K.V(+42.01)TNVFSK(+42.01).K Y 15.16 877.4545 7 -6.4 439.7318 2 36.31 3 17132 AEV_3_3_RA3_01_1233.d 5.76E4 1 1 54 60 Acetylation (N-term); Acetylation (K)
K.QEDPRPQ(+.98)E(+43.99)AVLDSSR.N Y 15.03 1770.8020 15 -50.4 591.2449 3 84.49 1 45373 AEV 2_3_RA2_01_1224.d 0 1 1 397 411 Deamidation (NQ); Carboxylation (E)
total 60 peptides
C1GHV2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.RVNQAIALLTIGAR.E Y 122.75 1494.8994 14 -13.1 499.3005 3 76.91 2 38138 AEV_1_3_RA2_01_1232.d 1.1E6 6 6 156 169
K.SIAEC(+57.02)LAEELINAAK.G Y 115.32 1630.8236 15 1.0 816.4199 2 89.94 2 47211 AEV_1_3_RA2_01_1232.d 2.31E6 12 12 178 192 Carbamidomethylation
R.DMSLTDYIQIR.Q Y 113.63 1353.6598 11 2.9 677.8391 2 83.30 2 43096 AEV_1_3_RA2_01_1232.d 2.57E5 3 3 44 54
R.Q(-17.03)PVYISHSAGR.Y Y 100.98 1196.5938 11 2.4 599.3056 2 56.94 2 24131 AEV_1_3_RA2_01_1232.d 3.51E6 9 9 55 65 Pyro-glu from Q
R.VNQAIALLTIGAR.E Y 99.01 1338.7983 13 -2.8 670.4046 2 80.57 2 41036 AEV_1_3_RA2_01_1232.d 2.47E6 8 8 157 169
K.EVAAEIGAIKLFNK.W Y 93.71 1501.8503 14 4.4 501.6263 3 77.27 3 45912 AEV_3_3_RA3_01_1233.d 6.43E4 1 1 21 34
R.NVKSIAEC(+57.02)LAEELINAAK.G Y 91.22 1972.0299 18 -4.0 658.3480 3 90.22 3 54818 AEV_3_3_RA3_01_1233.d 4.39E5 3 3 175 192 Carbamidomethylation
R.NVKSIAEC(+57.02)LAEELINAAKGSSNSYAIK.K Y 84.93 2879.4697 27 4.1 720.8777 4 89.68 3 54543 AEV_3_3_RA3_01_1233.d 6.48E4 1 1 175 201 Carbamidomethylation
R.IGYPVLPK.E Y 82.00 885.5323 8 3.1 443.7748 2 67.80 2 31250 AEV_1_3_RA2_01_1232.d 3.16E6 6 6 13 20
R.LTNSLM(+15.99)MNGR.N Y 79.64 1151.5427 10 -19.4 576.7675 2 47.05 3 23844 AEV_3_3_RA3_01_1233.d 0 2 2 82 91 Oxidation (M)
R.QPVYISHSAGR.Y Y 76.19 1213.6204 11 1.1 607.8181 2 31.17 2 11280 AEV_1_3_RA2_01_1232.d 1.46E6 10 10 55 65
R.RQAVDVSPLRR.V Y 72.09 1295.7422 11 0.8 432.9217 3 38.78 3 18717 AEV_3_3_RA3_01_1233.d 8.23E5 6 6 146 156
R.Q(-17.03)PVYISHSAGR(+14.02).Y Y 71.06 1210.6095 11 -2.3 606.3106 2 58.11 3 31023 AEV_3_3_RA3_01_1233.d 3.74E5 4 4 55 65 Pyro-glu from Q; Methylation(KR)
R.RQAVDVSPLR.R Y 70.52 1139.6411 10 3.2 380.8889 3 48.94 2 19913 AEV_1_3_RA2_01_1232.d 1.34E6 5 5 146 155
R.VNQAIALLTIGAR(+14.02).E Y 70.33 1352.8140 13 -39.8 677.3873 2 81.40 3 49136 AEV_3_3_RA3_01_1233.d 0 1 1 157 169 Methylation(KR)
K.GSSNSYAIK.K Y 70.02 925.4505 9 -1.1 463.7320 2 22.08 3 8934 AEV_3_3_RA3_01_1233.d 5.98E5 6 6 193 201
R.KAQC(+57.02)PIIER.L Y 69.07 1113.5964 9 1.3 557.8062 2 28.79 3 12689 AEV_3_3_RA3_01_1233.d 1.48E6 6 6 73 81 Carbamidomethylation
R.Q(-17.03)AVDVSPLRR.V Y 68.66 1122.6145 10 -3.8 562.3124 2 63.64 3 35261 AEV_3_3_RA3_01_1233.d 2.55E6 5 5 147 156 Pyro-glu from Q
K.GSSNSYAIKKKDELER.V Y 68.02 1823.9376 16 -0.8 456.9913 4 27.96 3 12226 AEV_3_3_RA3_01_1233.d 3.85E5 3 3 193 208
R.IVAHTFEIIHIMTDQNPIQVAVDAIVNC(+57.02)GPR.E Y 67.46 3470.7803 31 18.6 868.7185 4 93.87 3 56728 AEV_3_3_RA3_01_1233.d 2.21E5 4 4 102 132 Carbamidomethylation
R.VNQ(+.98)AIALLTIGAR.E Y 67.41 1339.7823 13 -6.8 670.8939 2 82.00 3 49588 AEV_3_3_RA3_01_1233.d 1.26E5 2 2 157 169 Deamidation (NQ)
K.SIAE(+14.02)C(+57.02)LAEELINAAK.G Y 67.35 1644.8392 15 -1.7 823.4255 2 90.21 3 54812 AEV_3_3_RA3_01_1233.d 2.21E5 1 1 178 192 Methylation(others); Carbamidomethylation
K.GSSNSYAIKK.K Y 65.15 1053.5454 10 4.0 527.7821 2 14.77 3 4996 AEV_3_3_RA3_01_1233.d 4.68E4 2 2 193 202
K.AQC(+57.02)PIIER.L Y 65.08 985.5015 8 3.2 493.7596 2 41.85 2 16382 AEV_1_3_RA2_01_1232.d 3.94E6 10 10 74 81 Carbamidomethylation
K.SIAEC(+57.02)LAEELINAAK(+14.02).G Y 62.93 1644.8392 15 1.1 823.4278 2 91.37 3 55463 AEV_3_3_RA3_01_1233.d 4.52E5 4 4 178 192 Carbamidomethylation; Methylation(KR)
K.SIAEC(+57.02)LAEE(+14.02)LINAAK.G Y 62.59 1644.8392 15 0.5 823.4273 2 92.38 3 55988 AEV_3_3_RA3_01_1233.d 4.75E5 5 5 178 192 Carbamidomethylation; Methylation(others)
K.EVAAEIGAIK.L Y 61.88 999.5600 10 -2.0 500.7863 2 60.87 3 33078 AEV_3_3_RA3_01_1233.d 1.13E6 5 5 21 30
R.QAVDVSPLR.R Y 61.22 983.5400 9 -0.2 492.7772 2 56.63 3 30012 AEV_3_3_RA3_01_1233.d 9.43E5 6 6 147 155
K.WSYEDIEIR.D Y 58.75 1209.5665 9 3.0 605.7924 2 77.39 3 46016 AEV_3_3_RA3_01_1233.d 4.51E4 1 1 35 43
K.SIAEC(+57.02)LAEELIN(+.98)AAK.G Y 58.72 1631.8076 15 14.2 816.9227 2 90.30 2 47372 AEV_1_3_RA2_01_1232.d 3.14E5 1 1 178 192 Carbamidomethylation; Deamidation (NQ)
R.FRKAQC(+57.02)PIIER.L Y 55.78 1416.7660 11 -0.5 355.1986 4 40.73 3 19829 AEV_3_3_RA3_01_1233.d 2.46E5 2 2 71 81 Carbamidomethylation
R.LTNSLMM(+15.99)NGR.N Y 54.10 1151.5427 10 -21.4 576.7663 2 47.26 3 23978 AEV_3_3_RA3_01_1233.d 1.13E5 2 2 82 91 Oxidation (M)
K.SIAEC(+57.02)LAEELINAAKGSSNSYAIK.K Y 53.81 2538.2634 24 -6.5 847.0896 3 89.23 3 54291 AEV_3_3_RA3_01_1233.d 3.58E5 3 3 178 201 Carbamidomethylation
K.GSSNSYAIK(+14.02).K Y 50.84 939.4661 9 3.2 470.7418 2 36.22 3 17080 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 193 201 Methylation(KR)
K.S(+14.02)IAEC(+57.02)LAEELINAAK.G Y 47.59 1644.8392 15 23.5 549.2999 3 90.23 3 54825 AEV_3_3_RA3_01_1233.d 0 1 1 178 192 Methylation(others); Carbamidomethylation
R.LTNSLM(+15.99)M(+15.99)NGR.N Y 46.61 1167.5376 10 4.1 584.7784 2 30.26 3 13532 AEV_3_3_RA3_01_1233.d 1.92E5 3 3 82 91 Oxidation (M)
K.SIAEC(+57.02)LAE(+28.03)ELINAAK.G Y 46.57 1658.8549 15 2.6 830.4369 2 92.92 2 48557 AEV_1_3_RA2_01_1232.d 2.78E5 2 2 178 192 Carbamidomethylation; Ethylation
K.SIAEC(+57.02)LAE(+14.02)ELINAAK.G Y 44.85 1644.8392 15 0.0 823.4269 2 90.40 2 47422 AEV_1_3_RA2_01_1232.d 4.61E5 5 5 178 192 Carbamidomethylation; Methylation(others)
R.QAVDVSPLRR.V Y 44.70 1139.6411 10 -7.5 570.8235 2 48.59 2 19743 AEV_1_3_RA2_01_1232.d 1.04E6 4 4 147 156
R.IGSAGTVR.R Y 43.82 759.4239 8 1.0 380.7196 2 17.42 3 6428 AEV_3_3_RA3_01_1233.d 1E6 6 6 138 145
K.EVAAE(+14.02)IGAIK.L Y 43.12 1013.5757 10 7.5 507.7989 2 66.48 2 30289 AEV_1_3_RA2_01_1232.d 1.83E5 2 2 21 30 Methylation(others)
R.LTNSLM(+15.99)M(+15.99)N(+.98)GR.N Y 42.79 1168.5216 10 19.8 585.2797 2 34.19 3 15831 AEV_3_3_RA3_01_1233.d 0 1 1 82 91 Oxidation (M); Deamidation (NQ)
R.Q(-17.03)AVDVSPLR(+14.02)R.V Y 41.46 1136.6301 10 -1.5 569.3215 2 64.75 3 36082 AEV_3_3_RA3_01_1233.d 2.8E5 2 2 147 156 Pyro-glu from Q; Methylation(KR)
R.NVKSIAEC(+57.02)LAEE(+14.02)LINAAK.G Y 41.12 1986.0455 18 -7.7 663.0173 3 92.55 3 56076 AEV_3_3_RA3_01_1233.d 2.66E5 2 2 175 192 Carbamidomethylation; Methylation(others)
K.AQC(+57.02)PIIER(+14.02).L Y 40.74 999.5172 8 -1.1 500.7653 2 48.63 3 24847 AEV_3_3_RA3_01_1233.d 7.82E5 4 4 74 81 Carbamidomethylation; Methylation(KR)
R.IGYPVLPK(+14.02).E Y 40.68 899.5480 8 -0.2 450.7812 2 70.96 3 40978 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 13 20 Methylation(KR)
M.S(+42.01)DTGGVEVESR.I Y 39.15 1176.5259 11 20.3 589.2822 2 48.97 3 25108 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 2 12 Acetylation (Protein N-term)
R.IGSAGTVRR.Q Y 36.99 915.5250 9 -2.0 458.7688 2 14.47 3 4812 AEV_3_3_RA3_01_1233.d 4.16E5 2 2 138 146
K.AQ(+.98)C(+57.02)PIIER.L Y 35.82 986.4855 8 -69.2 494.2159 2 54.71 1 22990 AEV 2_3_RA2_01_1224.d 4.12E5 3 3 74 81 Deamidation (NQ); Carbamidomethylation
MS(+121.04)DTGGVEVESR.I Y 34.63 1386.5908 12 50.1 694.3374 2 39.82 3 19294 AEV_3_3_RA3_01_1233.d 5.85E4 1 1 1 12 Phosphorylation to pyridyl thiol
R.Q(+.98)AVDVSPLR.R Y 34.10 984.5240 9 1.6 493.2701 2 59.35 3 31924 AEV_3_3_RA3_01_1233.d 2.36E5 2 2 147 155 Deamidation (NQ)
R.KAQC(+57.02)PIIER(+14.02).L Y 33.02 1127.6121 9 6.4 376.8804 3 36.18 3 17055 AEV_3_3_RA3_01_1233.d 2.87E5 2 2 73 81 Carbamidomethylation; Methylation(KR)
K.EVAAEIGAIK(+42.01).L Y 31.24 1041.5706 10 -50.8 1042.5249 1 109.42 1 58596 AEV 2_3_RA2_01_1224.d 0 1 1 21 30 Acetylation (K)
M(+71.04)SDTGGVEVESR.I Y 29.20 1336.5929 12 -103.1 669.2348 2 46.01 1 17871 AEV 2_3_RA2_01_1224.d 8.61E4 1 1 1 12 Propionamide (K, X@N-term)
R.LTNSLM(+15.99)MN(+.98)GR.N Y 27.89 1152.5267 10 14.8 577.2792 2 52.64 3 27476 AEV_3_3_RA3_01_1233.d 3.11E5 2 2 82 91 Oxidation (M); Deamidation (NQ)
K.RFRKAQC(+57.02)PIIER.L Y 27.33 1572.8671 12 -21.4 394.2156 4 21.76 2 7117 AEV_1_3_RA2_01_1232.d 0 1 1 70 81 Carbamidomethylation
K.EVAAEIGAIK(+43.99).L Y 26.54 1043.5498 10 -21.7 1044.5344 1 97.59 3 58241 AEV_3_3_RA3_01_1233.d 1.12E4 1 1 21 30 Carboxylation (DKW)
R.RVNQ(+.98)AIALLTIGAR.E Y 26.08 1495.8834 14 -49.4 499.6105 3 75.94 3 44868 AEV_3_3_RA3_01_1233.d 0 1 1 156 169 Deamidation (NQ)
M.S(+42.01)DT(+79.97)GGVEVESR.I Y 25.44 1256.4922 11 73.0 629.2993 2 57.88 2 24570 AEV_1_3_RA2_01_1232.d 0 2 2 2 12 Acetylation (Protein N-term); Phosphorylation (STY)
K.KKDELER.V Y 25.16 916.4977 7 7.3 306.5088 3 9.64 2 2357 AEV_1_3_RA2_01_1232.d 2.44E5 4 4 202 208
R.IVAHTFEIIHIMTDQNPIQ(+.98)VAVDAIVNC(+57.02)GPR.E Y 24.46 3471.7642 31 -0.7 868.9477 4 94.11 3 56838 AEV_3_3_RA3_01_1233.d 0 1 1 102 132 Deamidation (NQ); Carbamidomethylation
R.QPVYISHSAGRYAVK(+43.99)R(+14.02).F Y 24.37 1888.9907 16 0.9 473.2554 4 66.90 3 37775 AEV_3_3_RA3_01_1233.d 0 1 1 55 70 Carboxylation (DKW); Methylation(KR)
K.GSSN(+.98)SYAIK.K Y 22.24 926.4345 9 -83.2 464.1860 2 34.34 1 11350 AEV 2_3_RA2_01_1224.d 6.27E4 1 1 193 201 Deamidation (NQ)
K.EVAAEIGAIK(+42.01)LFNK(+43.01).W Y 22.16 1586.8667 14 4.2 529.9651 3 81.54 2 41794 AEV_1_3_RA2_01_1232.d 9.73E4 1 1 21 34 Acetylation (K); Carbamylation
R.IGS(+79.97)AGT(-18.01)VR.R Y 22.02 821.3796 8 19.2 822.4026 1 90.89 2 47663 AEV_1_3_RA2_01_1232.d 8.45E3 1 1 138 145 Phosphorylation (STY); Dehydration
R.Q(+.98)AVDVSPLRR.V Y 21.89 1140.6251 10 0.0 571.3198 2 49.63 3 25506 AEV_3_3_RA3_01_1233.d 6.66E4 1 1 147 156 Deamidation (NQ)
R.QPVYISHSAGRYAVK(+58.01).R Y 21.84 1732.8896 15 -6.2 434.2270 4 57.40 3 30513 AEV_3_3_RA3_01_1233.d 0 1 1 55 69 Carboxymethyl (KW, X@N-term)
R.I(+42.01)GSAGTVRR.Q Y 21.63 957.5355 9 -20.1 320.1794 3 14.56 3 4858 AEV_3_3_RA3_01_1233.d 9.83E4 1 1 138 146 Acetylation (N-term)
R.IGSAGTVR(+28.03).R Y 21.53 787.4552 8 22.2 394.7436 2 46.59 2 18718 AEV_1_3_RA2_01_1232.d 6.74E5 1 1 138 145 Dimethylation(KR)
R.QAVDVSPLR(+14.02).R Y 20.41 997.5556 9 -38.3 499.7660 2 62.84 2 27772 AEV_1_3_RA2_01_1232.d 2.51E4 1 1 147 155 Methylation(KR)
R.LTNSLM(+15.99)MNGR(+14.02)NNGK.K Y 20.20 1578.7606 14 25.6 527.2743 3 96.42 1 54043 AEV 2_3_RA2_01_1224.d 2.53E4 1 1 82 95 Oxidation (M); Methylation(KR)
R.IGSAGTVR(+14.02).R Y 19.62 773.4395 8 -14.7 387.7213 2 30.67 2 11008 AEV_1_3_RA2_01_1232.d 1.71E6 1 1 138 145 Methylation(KR)
R.LTNS(+79.97)LMMN(+.98)GR.N Y 19.59 1216.4982 10 -45.9 609.2285 2 28.34 1 8121 AEV 2_3_RA2_01_1224.d 1.14E5 2 2 82 91 Phosphorylation (STY); Deamidation (NQ)
K.AQC(+57.02)PIIERLTNSLM(+15.99)M(+15.99)NGRNNGKK.L Y 19.53 2676.3257 23 4.3 670.0916 4 51.83 2 21376 AEV_1_3_RA2_01_1232.d 4.33E4 1 1 74 96 Carbamidomethylation; Oxidation (M)
R.YAVKR.F Y 19.32 635.3755 5 -97.3 318.6641 2 23.49 1 5918 AEV 2_3_RA2_01_1224.d 4.91E4 1 1 66 70
R.IGS(-18.01)AGTVRR.Q Y 19.16 897.5144 9 -24.8 449.7534 2 28.20 3 12372 AEV_3_3_RA3_01_1233.d 3.21E5 1 1 138 146 Dehydration
K.SIAEC(+57.02)LAEELINAAKGSSN(+.98)SYAIK.K Y 19.11 2539.2476 24 1.3 847.4243 3 89.94 2 47203 AEV_1_3_RA2_01_1232.d 0 1 1 178 201 Carbamidomethylation; Deamidation (NQ)
K.EVAAEIGAIKLFNK(+43.99).W Y 19.06 1545.8402 14 -34.8 773.9005 2 80.14 3 48176 AEV_3_3_RA3_01_1233.d 6.25E4 1 1 21 34 Carboxylation (DKW)
R.NVKS(-2.02)IAEC(+57.02)LAEELINAAKGSSNSYAIK.K Y 17.94 2877.4541 27 -1.5 720.3697 4 89.80 3 54609 AEV_3_3_RA3_01_1233.d 5.42E4 1 1 175 201 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
R.EDSTRIGS(-18.01)AGTVRR.Q Y 17.57 1485.7648 14 -8.6 496.2579 3 69.74 3 40037 AEV_3_3_RA3_01_1233.d 6.91E4 1 1 133 146 Dehydration
R.LTNSLM(+15.99)MNGRNNGK(+14.02).K Y 17.32 1578.7606 14 -41.0 527.2393 3 73.38 1 36585 AEV 2_3_RA2_01_1224.d 1.55E5 1 1 82 95 Oxidation (M); Methylation(KR)
R.EAAFR(+28.03)NVK(+42.01).S Y 17.30 1003.5450 8 -9.6 335.5191 3 48.39 3 24691 AEV_3_3_RA3_01_1233.d 4.3E4 1 1 170 177 Dimethylation(KR); Acetylation (K)
K.LM(+15.99)AVR.I Y 16.82 604.3367 5 10.9 303.1789 2 16.40 2 4919 AEV_1_3_RA2_01_1232.d 2.44E5 1 1 97 101 Oxidation (M)
R.LT(+79.97)NSLMMNGR.N Y 16.79 1215.5142 10 -25.1 608.7491 2 40.76 1 14855 AEV 2_3_RA2_01_1224.d 1.49E5 1 1 82 91 Phosphorylation (STY)
R.IGS(-18.01)AGTVR.R Y 16.49 741.4133 8 -33.9 742.3954 1 98.92 3 58705 AEV_3_3_RA3_01_1233.d 1.04E4 1 1 138 145 Dehydration
R.EAAFR.N Y 16.39 592.2969 5 -160.1 593.2094 1 40.38 1 14624 AEV 2_3_RA2_01_1224.d 0 1 1 170 174
K.S(+380.15)IAEC(+57.02)LAEELINAAK.G Y 16.31 2010.9707 15 -6.2 671.3267 3 97.18 3 58069 AEV_3_3_RA3_01_1233.d 0 1 1 178 192 Nucleophilic addition to cytopiloyne+H2O; Carbamidomethylation
K.DELERVAK(+43.99).S Y 16.14 1002.4982 8 3.0 502.2579 2 41.29 3 20187 AEV_3_3_RA3_01_1233.d 2.31E4 1 1 204 211 Carboxylation (DKW)
K.E(+71.04)VAAEIGAIK.L Y 15.82 1070.5972 10 -54.6 536.2766 2 60.55 2 26240 AEV_1_3_RA2_01_1232.d 1.17E5 1 1 21 30 Propionamide (K, X@N-term)
R.IGS(+79.97)AGTVR.R Y 15.57 839.3902 8 100.0 840.4814 1 101.53 1 56220 AEV 2_3_RA2_01_1224.d 1.33E5 1 1 138 145 Phosphorylation (STY)
R.QPVYIS(+14.02)HSAGR.Y Y 15.52 1227.6360 11 10.5 410.2236 3 36.15 2 13614 AEV_1_3_RA2_01_1232.d 2.05E5 1 1 55 65 Methylation(others)
R.LTNSLMM(+15.99)N(+.98)GR.N Y 15.28 1152.5267 10 27.9 577.2867 2 51.91 3 26995 AEV_3_3_RA3_01_1233.d 0 1 1 82 91 Oxidation (M); Deamidation (NQ)
R.LT(+14.02)NSLMMNGR.N Y 15.06 1149.5635 10 -45.5 384.1777 3 46.91 1 18422 AEV 2_3_RA2_01_1224.d 0 1 1 82 91 Methylation(others)
total 93 peptides
C1FZ57
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.TYAAEIGHAVSSGK.R Y 147.93 1389.6888 14 2.0 695.8531 2 58.35 2 24846 AEV_1_3_RA2_01_1232.d 3.65E6 13 13 168 181
K.VFLVQNPKDVELLLMHNR.T Y 135.66 2164.1826 18 3.0 542.0546 4 81.60 2 41813 AEV_1_3_RA2_01_1232.d 7.39E5 4 4 150 167
R.HLTPSGHK.V Y 97.70 875.4613 8 7.4 438.7412 2 9.75 2 2398 AEV_1_3_RA2_01_1232.d 6.28E4 2 2 142 149
R.TYAAEIGHAVSSGK(+14.02).R Y 93.29 1403.7045 14 1.0 702.8602 2 62.33 3 34218 AEV_3_3_RA3_01_1233.d 6.99E5 3 3 168 181 Methylation(KR)
R.TYAAEIGHAVSSGKR.I Y 92.58 1545.7899 15 0.3 516.2708 3 50.26 3 25896 AEV_3_3_RA3_01_1233.d 1.85E6 7 7 168 182
R.TYAAE(+14.02)IGHAVSSGK.R Y 90.45 1403.7045 14 -1.3 702.8586 2 60.42 3 32727 AEV_3_3_RA3_01_1233.d 4.99E5 3 3 168 181 Methylation(others)
R.HLTPSGHKVFLVQNPK.D Y 86.11 1800.9999 16 -2.1 451.2563 4 55.69 3 29340 AEV_3_3_RA3_01_1233.d 4.76E5 2 2 142 157
K.DVELLLMHNR.T Y 86.02 1238.6442 10 -5.4 620.3260 2 72.54 3 42216 AEV_3_3_RA3_01_1233.d 5.72E5 6 6 158 167
R.FSGQASM(+15.99)PK.I Y 83.22 967.4433 9 8.7 484.7331 2 17.75 3 6659 AEV_3_3_RA3_01_1233.d 2.01E6 17 17 123 131 Oxidation (M)
K.ALGVKVTNPK.G Y 72.52 1025.6233 10 -4.0 513.8169 2 35.40 3 16578 AEV_3_3_RA3_01_1233.d 6.62E5 3 3 191 200
K.VFLVQNPK.D Y 72.00 943.5491 8 -1.2 472.7812 2 59.80 3 32305 AEV_3_3_RA3_01_1233.d 8.99E5 2 2 150 157
K.VFLVQNPKDVELLLM(+15.99)HNR.T Y 71.57 2180.1775 18 -9.2 727.7264 3 79.37 3 47581 AEV_3_3_RA3_01_1233.d 3.14E4 1 1 150 167 Oxidation (M)
R.FSGQASMPK.I Y 68.77 951.4484 9 9.1 476.7358 2 39.38 2 15206 AEV_1_3_RA2_01_1232.d 2.06E6 8 8 123 131
R.FSGQASMPK(+14.02).I Y 62.09 965.4641 9 2.6 483.7406 2 50.76 3 26193 AEV_3_3_RA3_01_1233.d 3.85E5 3 3 123 131 Methylation(KR)
K.HITIVKK.H Y 60.40 837.5436 7 -5.5 419.7768 2 17.20 3 6325 AEV_3_3_RA3_01_1233.d 5.21E5 5 5 83 89
R.T(+87.05)YAAEIGHAVSSGKR.I Y 57.85 1632.8406 15 -0.9 409.2170 4 50.51 3 26048 AEV_3_3_RA3_01_1233.d 4.07E5 1 1 168 182 Phosphorylation to amine thiol
R.TYAAE(+14.02)IGHAVSSGKR.I Y 55.44 1559.8055 15 -8.6 390.9553 4 55.83 3 29425 AEV_3_3_RA3_01_1233.d 4.47E5 2 2 168 182 Methylation(others)
K.IGYGSNKK.T Y 52.85 865.4658 8 5.0 433.7423 2 11.37 2 2984 AEV_1_3_RA2_01_1232.d 3.81E5 3 3 132 139
K.VFLVQN(+.98)PKDVELLLMHNR.T Y 51.96 2165.1667 18 2.7 542.3004 4 81.13 3 48937 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 150 167 Deamidation (NQ)
R.RFSGQASMPK.I Y 49.66 1107.5494 10 4.7 370.1922 3 33.81 2 12500 AEV_1_3_RA2_01_1232.d 8.14E5 5 5 122 131
R.FNRHQSDRYK.C Y 49.65 1349.6588 10 6.1 450.8963 3 12.95 3 4013 AEV_3_3_RA3_01_1233.d 9.43E5 4 4 94 103
K.C(+57.02)VDPSWR.K Y 48.95 918.4018 7 -76.9 460.1729 2 58.73 1 25583 AEV 2_3_RA2_01_1224.d 7.6E5 5 5 104 110 Carbamidomethylation
R.FSGQASM(-48.00)PK.I Y 47.69 903.4450 9 2.7 452.7310 2 10.37 3 2713 AEV_3_3_RA3_01_1233.d 4.23E5 4 4 123 131 Dethiomethyl
R.RFSGQASM(+15.99)PK.I Y 45.49 1123.5444 10 -12.2 562.7726 2 14.97 3 5142 AEV_3_3_RA3_01_1233.d 1.91E5 5 5 122 131 Oxidation (M)
K.C(+57.02)VDPSWRKPK.G Y 44.85 1271.6444 10 -0.1 424.8887 3 28.04 3 12272 AEV_3_3_RA3_01_1233.d 9.45E5 3 3 104 113 Carbamidomethylation
K.HITIVK.K Y 44.80 709.4487 6 -3.2 710.4537 1 25.04 3 10602 AEV_3_3_RA3_01_1233.d 2.55E5 2 2 83 88
K.C(+58.01)VDPSWR.K Y 44.02 919.3858 7 8.9 460.7043 2 53.16 3 27809 AEV_3_3_RA3_01_1233.d 4.91E5 2 2 104 110 Carboxymethyl
R.RRFSGQASMPK.I Y 42.89 1263.6506 11 0.6 422.2244 3 28.04 3 12271 AEV_3_3_RA3_01_1233.d 1.95E5 1 1 121 131
R.TY(+44.99)AAEIGHAVSSGK.R Y 42.73 1434.6738 14 49.0 479.2553 3 58.33 2 24838 AEV_1_3_RA2_01_1232.d 0 1 1 168 181 Oxidation to nitro
K.VFLVQNPKDVE(+14.02)LLLMHNR.T Y 41.54 2178.1982 18 3.2 545.5586 4 83.28 3 50513 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 150 167 Methylation(others)
K.TRHLTPSGHK.V Y 41.48 1132.6101 10 -9.4 567.3070 2 11.04 3 3023 AEV_3_3_RA3_01_1233.d 1.11E4 1 1 140 149
R.HLT(-18.01)PSGHK.V Y 39.97 857.4507 8 2.4 429.7337 2 9.90 3 2507 AEV_3_3_RA3_01_1233.d 4.22E4 1 1 142 149 Dehydration
K.IGYGSNK(+14.02)K.T Y 39.87 879.4814 8 0.4 440.7481 2 15.01 3 5130 AEV_3_3_RA3_01_1233.d 6.92E4 1 1 132 139 Methylation(KR)
K.KHITIVKK.H Y 38.95 965.6385 8 3.7 483.8283 2 14.36 3 4760 AEV_3_3_RA3_01_1233.d 7.49E4 1 1 82 89
K.VFLVQ(+.98)N(+.98)PKDVELLLMHNR.T Y 36.84 2166.1506 18 10.1 723.0648 3 81.69 2 41882 AEV_1_3_RA2_01_1232.d 5.86E4 1 1 150 167 Deamidation (NQ)
R.FNRHQSDR.Y Y 36.36 1058.5006 8 2.2 353.8416 3 9.42 3 2314 AEV_3_3_RA3_01_1233.d 5.65E4 2 2 94 101
K.RIDIIAK.A Y 35.30 827.5228 7 -7.6 414.7655 2 39.53 3 19112 AEV_3_3_RA3_01_1233.d 7.37E5 2 2 182 188
R.FSGQASM(+15.99)PK(+14.02).I Y 34.08 981.4589 9 8.6 491.7409 2 27.74 2 9697 AEV_1_3_RA2_01_1232.d 1.63E5 2 2 123 131 Oxidation (M); Methylation(KR)
R.HLTPS(-18.01)GHK.V Y 33.32 857.4507 8 6.5 429.7354 2 9.82 2 2419 AEV_1_3_RA2_01_1232.d 1.76E4 1 1 142 149 Dehydration
K.IGY(+125.90)GSNKK.T Y 31.10 991.3624 8 7.9 496.6924 2 21.05 3 8428 AEV_3_3_RA3_01_1233.d 8.45E4 1 1 132 139 Iodination
R.IDIIAK.A N 28.50 671.4218 6 5.8 336.7201 2 49.49 2 20183 AEV_1_3_RA2_01_1232.d 1.47E6 4 4 183 188
K.AK(+43.99)ALGVK(+14.02)VTNPKGR.L Y 27.85 1495.8834 14 -97.6 300.1548 5 28.90 1 8412 AEV 2_3_RA2_01_1224.d 0 1 1 189 202 Carboxylation (DKW); Methylation(KR)
R.LTTES Y 27.73 549.2646 5 -14.9 550.2637 1 11.42 2 3003 AEV_1_3_RA2_01_1232.d 1.23E5 2 2 203 207
R.FSGQASMPK(+27.99).I Y 27.63 979.4433 9 -70.2 490.6945 2 35.75 1 12064 AEV 2_3_RA2_01_1224.d 2.64E5 2 2 123 131 Formylation
K.GIDNRVR.R Y 26.56 828.4565 7 1.1 415.2360 2 14.93 3 5106 AEV_3_3_RA3_01_1233.d 4.55E5 2 2 114 120
K.D(+14.02)VELLLMHNR.T Y 25.76 1252.6598 10 3.1 418.5618 3 75.25 3 44318 AEV_3_3_RA3_01_1233.d 7.59E4 1 1 158 167 Methylation(others)
R.L(+27.99)TTES Y 25.71 577.2595 5 42.2 578.2911 1 34.71 2 12940 AEV_1_3_RA2_01_1232.d 0 1 1 203 207 Formylation
K.GRLTTES Y 24.75 762.3871 7 2.4 382.2018 2 14.05 3 4609 AEV_3_3_RA3_01_1233.d 4.93E4 1 1 201 207
K.V(+42.01)T(+79.96)NPK.G Y 24.23 679.2847 5 48.1 680.3246 1 73.49 2 35488 AEV_1_3_RA2_01_1232.d 0 1 1 196 200 Acetylation (N-term); Sulfation
K.IGYGSNK(+226.08).K Y 23.73 963.4484 7 -33.4 322.1460 3 41.12 1 15061 AEV 2_3_RA2_01_1224.d 7.34E4 1 1 132 138 Biotinylation
K.IGYGSNKK(+14.02).T Y 23.67 879.4814 8 4.8 440.7501 2 16.43 2 4921 AEV_1_3_RA2_01_1232.d 3.57E4 1 1 132 139 Methylation(KR)
R.FSGQ(+.98)ASMPK.I Y 23.21 952.4324 9 2.8 477.2248 2 42.41 3 20901 AEV_3_3_RA3_01_1233.d 2.26E5 2 2 123 131 Deamidation (NQ)
R.FSGQASMPK(+26.02).I Y 23.03 977.4641 9 -42.2 489.7187 2 44.24 1 16883 AEV 2_3_RA2_01_1224.d 9.07E4 1 1 123 131 Acetaldehyde +26
K.MVAAK(+21.98).K Y 22.96 540.2706 5 -31.7 541.2607 1 13.89 3 4514 AEV_3_3_RA3_01_1233.d 0 1 1 77 81 Sodium adduct
K.V(+42.01)TN(+.98)PK.G Y 22.75 600.3119 5 -35.5 601.2979 1 47.49 1 18785 AEV 2_3_RA2_01_1224.d 9.69E4 3 3 196 200 Acetylation (N-term); Deamidation (NQ)
K.IGYGS(+79.97)NK.K Y 22.74 817.3371 7 10.4 818.3528 1 87.61 1 47810 AEV 2_3_RA2_01_1224.d 3.26E4 1 1 132 138 Phosphorylation (STY)
R.TYAAEIGHAVSS(-18.01)GK(+14.02).R Y 22.23 1385.6938 14 -3.4 693.8519 2 58.58 2 24983 AEV_1_3_RA2_01_1232.d 0 1 1 168 181 Dehydration; Methylation(KR)
K.AKALGVK(+43.01)VTNPK.G Y 21.91 1267.7612 12 1.2 634.8887 2 85.59 2 44714 AEV_1_3_RA2_01_1232.d 6.38E4 1 1 189 200 Carbamylation
K.M(+15.99)VAAK(+21.98).K Y 21.69 556.2655 5 -89.2 557.2231 1 56.52 1 24133 AEV 2_3_RA2_01_1224.d 0 3 3 77 81 Oxidation (M); Sodium adduct
K.VFLVQN(+.98)PK(+14.02).D Y 21.06 958.5488 8 -109.3 320.4886 3 53.35 1 22159 AEV 2_3_RA2_01_1224.d 2.02E5 1 1 150 157 Deamidation (NQ); Methylation(KR)
R.RN(+.98)ST(+79.97)LAGK.F Y 21.02 926.4222 8 -29.8 309.8055 3 24.59 1 6372 AEV 2_3_RA2_01_1224.d 7.59E4 1 1 36 43 Deamidation (NQ); Phosphorylation (STY)
M(+15.99)AN(+.98)ITT(+79.97)IGGPAAK.L Y 20.23 1340.6047 13 -19.2 447.8669 3 52.80 1 21844 AEV 2_3_RA2_01_1224.d 8.18E5 1 1 1 13 Oxidation (M); Deamidation (NQ); Phosphorylation (STY)
K.MVAAK(+43.01).K Y 20.03 561.2944 5 -60.4 562.2678 1 58.24 3 31120 AEV_3_3_RA3_01_1233.d 0 1 1 77 81 Carbamylation
K.IGYGSNKKTR.H Y 19.83 1122.6145 10 -4.4 562.3121 2 11.56 3 3276 AEV_3_3_RA3_01_1233.d 4.5E3 1 1 132 141
R.LTTES(+14.02) Y 19.37 563.2803 5 -90.1 564.2368 1 80.54 1 42266 AEV 2_3_RA2_01_1224.d 1.61E4 1 1 203 207 Methylation(others)
R.R(+42.01)FSGQASMPK(+226.08).I Y 19.24 1375.6377 10 15.3 688.8367 2 69.98 3 40213 AEV_3_3_RA3_01_1233.d 5.81E4 1 1 122 131 Acetylation (N-term); Biotinylation
K.ALGVK(+42.01).V N 19.21 528.3271 5 -16.4 529.3257 1 24.44 3 10254 AEV_3_3_RA3_01_1233.d 0 1 1 191 195 Acetylation (K)
R.HLTPSGHKVFLVQN(+.98)PK(+14.02).D Y 18.99 1815.9995 16 7.4 455.0105 4 59.12 3 31759 AEV_3_3_RA3_01_1233.d 2.32E5 1 1 142 157 Deamidation (NQ); Methylation(KR)
M(+15.99)ANITTIGGPAAK(+43.01).L Y 18.38 1302.6602 13 3.3 435.2288 3 38.06 3 18237 AEV_3_3_RA3_01_1233.d 8.44E4 1 1 1 13 Oxidation (M); Carbamylation
M.AN(+.98)IT(+79.97)TIGGPAAK(+14.02).L Y 18.29 1207.5850 12 69.6 302.9245 4 10.65 3 2862 AEV_3_3_RA3_01_1233.d 8.56E5 1 1 2 13 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
K.G(+42.01)IDNR.V Y 18.24 615.2976 5 -143.9 616.2164 1 25.70 1 6859 AEV 2_3_RA2_01_1224.d 1.72E4 1 1 114 118 Acetylation (N-term)
R.LT(+79.97)TE(+43.99)S Y 17.73 673.2208 5 -44.6 674.1980 1 1.96 2 454 AEV_1_3_RA2_01_1232.d 1.57E3 1 1 203 207 Phosphorylation (STY); Carboxylation (E)
R.RFSGQASMPK(+43.01).I Y 17.54 1150.5553 10 7.8 576.2894 2 35.61 2 13351 AEV_1_3_RA2_01_1232.d 0 1 1 122 131 Carbamylation
K.VT(-18.01)N(+.98)PK.G Y 17.17 540.2908 5 -2.1 541.2969 1 25.97 3 11126 AEV_3_3_RA3_01_1233.d 0 1 1 196 200 Dehydration; Deamidation (NQ)
K.K(+14.02)TRHLTPSGHK.V Y 17.11 1274.7207 11 -15.6 425.9075 3 69.34 2 32357 AEV_1_3_RA2_01_1232.d 0 1 1 139 149 Methylation(KR)
K.MVAAK(-1.03).K Y 17.11 517.2570 5 -95.5 518.2149 1 89.08 1 48936 AEV 2_3_RA2_01_1224.d 4.89E3 1 1 77 81 Lysine oxidation to aminoadipic semialdehyde
K.VTNPK(+21.98).G Y 17.01 579.2993 5 -121.1 580.2364 1 25.97 1 6971 AEV 2_3_RA2_01_1224.d 0 1 1 196 200 Sodium adduct
R.LTT(-18.01)ES Y 17.00 531.2540 5 53.2 532.2896 1 83.86 3 50919 AEV_3_3_RA3_01_1233.d 4.32E4 1 1 203 207 Dehydration
R.RFSGQASMPK(+42.01).I Y 16.86 1149.5601 10 -65.4 384.1689 3 45.01 1 17301 AEV 2_3_RA2_01_1224.d 2.89E4 1 1 122 131 Acetylation (K)
K.K(+42.01)HITIVK(+42.01).K Y 16.82 921.5648 7 -34.7 308.1849 3 39.72 2 15329 AEV_1_3_RA2_01_1232.d 0 1 1 82 88 Acetylation (N-term); Acetylation (K)
K.C(+44.03)VDPSWRKPK.G Y 16.57 1258.6492 10 -4.0 315.6683 4 31.60 1 9865 AEV 2_3_RA2_01_1224.d 0 1 1 104 113 Ethanolation (C)
R.NS(+79.97)TLAGKFK(+42.01)DK(+42.01).R Y 16.54 1371.6436 11 14.5 686.8390 2 60.36 3 32686 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 37 47 Phosphorylation (STY); Acetylation (K)
K.G(+43.01)IDNR.V Y 16.44 616.2928 5 -62.7 617.2615 1 42.39 1 15805 AEV 2_3_RA2_01_1224.d 0 1 1 114 118 Carbamylation
K.A(+43.01)KALGVK.V Y 16.25 728.4545 7 -7.2 365.2319 2 64.71 2 29056 AEV_1_3_RA2_01_1232.d 2.32E4 1 1 189 195 Carbamylation
R.N(+.98)STLAGK(+42.01).F Y 16.23 732.3654 7 -29.5 367.1791 2 67.29 1 31869 AEV 2_3_RA2_01_1224.d 2.83E4 1 1 37 43 Deamidation (NQ); Acetylation (K)
R.FSGQ(+.98)ASMP(+31.99)K.I Y 15.92 984.4222 9 -38.5 493.1995 2 36.67 1 12537 AEV 2_3_RA2_01_1224.d 0 1 1 123 131 Deamidation (NQ); Dihydroxy
K.ALGVK(+42.01)VTNPKGR(+14.02).L Y 15.82 1294.7721 12 -10.2 324.6970 4 64.14 3 35608 AEV_3_3_RA3_01_1233.d 4.4E5 1 1 191 202 Acetylation (K); Methylation(KR)
R.H(+87.03)LTPSGHK.V Y 15.66 962.4933 8 8.7 963.5090 1 95.25 2 49424 AEV_1_3_RA2_01_1232.d 3.68E4 1 1 142 149 Glycidamide adduct
R.FSGQAS(+79.97)MPKIGYGS(+79.97)NK.K Y 15.50 1830.7412 16 30.4 458.7065 4 87.71 1 47886 AEV 2_3_RA2_01_1224.d 8.62E4 1 1 123 138 Phosphorylation (STY)
total 89 peptides
C1GII4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.VPFAVVGANSEVTSSEGGKVR.G Y 129.75 2089.0803 21 3.0 697.3695 3 68.45 2 31697 AEV_1_3_RA2_01_1232.d 2.29E5 2 2 346 366
R.SNPMGQGAAQTVTSKNPK.A Y 121.30 1814.8945 18 3.8 605.9744 3 43.25 2 17077 AEV_1_3_RA2_01_1232.d 4.84E5 5 5 91 108
K.VPFAVVGANSEVTSSEGGK.V Y 113.11 1833.9108 19 -0.3 917.9623 2 71.03 2 33616 AEV_1_3_RA2_01_1232.d 5.28E5 4 4 346 364
K.STLVNTLFNTSLYPPKER.K Y 105.50 2079.1001 18 5.5 694.0444 3 81.50 2 41735 AEV_1_3_RA2_01_1232.d 3.35E5 4 4 162 179
K.ADTLTDEEIALFKQR.I Y 103.03 1748.8944 15 1.8 583.9731 3 77.75 2 38770 AEV_1_3_RA2_01_1232.d 4.45E5 4 4 296 310
R.SNPM(+15.99)GQGAAQTVTSKNPK.A Y 103.00 1830.8894 18 4.1 611.3063 3 27.64 3 12038 AEV_3_3_RA3_01_1233.d 3.1E5 4 4 91 108 Oxidation (M)
K.VNLIPVIAK.A Y 98.52 965.6273 9 -2.3 483.8198 2 76.26 2 37592 AEV_1_3_RA2_01_1232.d 1.03E6 4 4 287 295
R.SNPMGQGAAQTVTSK.N Y 96.26 1475.7039 15 0.3 738.8594 2 43.48 3 21592 AEV_3_3_RA3_01_1233.d 2.2E5 5 5 91 105
K.LKQSEDELYAR.H Y 91.40 1350.6779 11 1.8 676.3474 2 41.81 2 16364 AEV_1_3_RA2_01_1232.d 3.01E5 4 4 471 481
R.SNPM(+15.99)GQGAAQTVTSK.N Y 85.56 1491.6987 15 2.4 746.8584 2 26.07 3 11183 AEV_3_3_RA3_01_1233.d 2.33E5 4 4 91 105 Oxidation (M)
K.ADTLTDEEIALFK.Q Y 82.05 1464.7347 13 3.1 733.3770 2 81.63 2 41838 AEV_1_3_RA2_01_1232.d 4.19E5 2 2 296 308
R.KGFNFNVMVVGESGLGK.S Y 77.84 1781.9135 17 0.2 594.9785 3 79.65 2 40283 AEV_1_3_RA2_01_1232.d 6.85E4 1 1 145 161
K.VPFAVVGANSE(+14.02)VTSSEGGK.V Y 73.88 1847.9265 19 -1.1 924.9695 2 73.73 3 43143 AEV_3_3_RA3_01_1233.d 9.09E4 2 2 346 364 Methylation(others)
K.TVAIESISADIEENGVR.L Y 72.38 1801.9058 17 0.0 901.9601 2 78.83 3 47160 AEV_3_3_RA3_01_1233.d 1.49E5 4 4 190 206
K.EVNPAVKQEEER.T Y 71.87 1426.7052 12 7.9 714.3655 2 25.75 3 11001 AEV_3_3_RA3_01_1233.d 2.94E5 3 3 431 442
K.LTGYVGFANLPNQWHR.K Y 64.82 1871.9431 16 12.9 624.9963 3 78.03 3 46525 AEV_3_3_RA3_01_1233.d 1.5E5 2 2 125 140
R.SNPMGQ(+.98)GAAQTVTSKNPK.A Y 64.30 1815.8785 18 -3.1 606.2982 3 46.76 2 18833 AEV_1_3_RA2_01_1232.d 8E4 1 1 91 108 Deamidation (NQ)
K.AAAQAASDMR.N Y 57.17 990.4553 10 32.0 496.2508 2 18.64 3 7209 AEV_3_3_RA3_01_1233.d 4.17E5 4 4 109 118
K.ADTLTDEE(+14.02)IALFKQR.I Y 55.56 1762.9100 15 3.7 588.6461 3 83.41 2 43182 AEV_1_3_RA2_01_1232.d 1.8E5 2 2 296 310 Methylation(others)
R.KGPSLDIIPK.T Y 55.00 1066.6385 10 -88.5 356.5220 3 74.31 1 37319 AEV 2_3_RA2_01_1224.d 4.73E5 2 2 180 189
R.KLTGYVGFANLPNQWHR.K Y 53.12 2000.0381 17 59.8 501.0467 4 75.94 2 37346 AEV_1_3_RA2_01_1232.d 0 1 1 124 140
R.SNPM(-48.00)GQGAAQTVTSK.N Y 52.76 1427.7004 15 4.7 476.9097 3 16.48 2 4944 AEV_1_3_RA2_01_1232.d 2.45E5 3 3 91 105 Dethiomethyl
R.SNPM(-48.00)GQGAAQTVTSKNPK.A Y 51.87 1766.8911 18 3.2 589.9728 3 18.36 3 6949 AEV_3_3_RA3_01_1233.d 3.12E5 3 3 91 108 Dethiomethyl
K.STLVNTLFNTSLYPPK.E Y 49.77 1793.9563 16 -11.6 897.9750 2 84.63 2 44064 AEV_1_3_RA2_01_1232.d 3.76E5 3 3 162 177
K.LTQMGVAQDPSVFK.E Y 48.53 1519.7704 14 1.6 760.8937 2 71.56 2 34017 AEV_1_3_RA2_01_1232.d 2.48E4 1 1 417 430
R.S(+13.03)NPMGQGAAQTVTSKNPK.A Y 47.22 1827.9261 18 20.1 610.3282 3 27.63 3 12032 AEV_3_3_RA3_01_1233.d 0 1 1 91 108 Michael addition with methylamine
K.ADT(-2.02)LTDEEIALFKQR.I Y 47.02 1746.8788 15 1.1 583.3008 3 77.85 2 38849 AEV_1_3_RA2_01_1232.d 0 1 1 296 310 2-amino-3-oxo-butanoic_acid
R.S(-18.01)NPM(+15.99)GQGAAQTVTSKNPK.A Y 41.64 1812.8788 18 1.8 605.3013 3 43.39 2 17150 AEV_1_3_RA2_01_1232.d 3.35E4 1 1 91 108 Dehydration; Oxidation (M)
K.ADTLTDEE(+14.02)IALFK.Q Y 40.10 1478.7504 13 -2.0 740.3810 2 87.02 3 53000 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 296 308 Methylation(others)
R.HREM(+15.99)KDQLER.Q Y 37.65 1356.6569 10 6.0 340.1735 4 11.65 3 3328 AEV_3_3_RA3_01_1233.d 9.78E4 1 1 482 491 Oxidation (M)
R.Q(-17.03)RAELEEKKSR.L Y 37.59 1355.7157 11 0.1 339.9362 4 17.10 3 6263 AEV_3_3_RA3_01_1233.d 1.15E5 1 1 492 502 Pyro-glu from Q
K.AAAQAASDMRNVVR.R Y 37.32 1458.7361 14 5.5 487.2553 3 51.65 2 21282 AEV_1_3_RA2_01_1232.d 5.72E4 2 2 109 122
R.LESGRPLEDK.I Y 36.32 1142.5931 10 -22.2 572.2911 2 24.66 3 10381 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 503 512
K.LKQSE(+14.02)DELYAR.H Y 36.19 1364.6936 11 1.4 455.9058 3 50.90 3 26299 AEV_3_3_RA3_01_1233.d 2.09E5 1 1 471 481 Methylation(others)
K.ADTLTDE(+14.02)EIALFK.Q Y 34.39 1478.7504 13 2.0 740.3840 2 87.08 2 45669 AEV_1_3_RA2_01_1232.d 1.84E5 1 1 296 308 Methylation(others)
K.A(+27.99)AAQ(+.98)AASDMR.N Y 31.17 1019.4342 10 -13.5 1020.4277 1 112.36 1 59468 AEV 2_3_RA2_01_1224.d 8.07E4 1 1 109 118 Formylation; Deamidation (NQ)
K.TVAIESISADIEENGVR(+14.02).L Y 29.74 1815.9214 17 31.4 606.3334 3 81.42 2 41681 AEV_1_3_RA2_01_1232.d 0 1 1 190 206 Methylation(KR)
R.LESGRPLEDKIKR.K Y 29.63 1539.8732 13 0.3 308.9820 5 36.70 3 17393 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 503 515
K.S(-2.02)TLVNTLFNTSLYPPK.E Y 28.97 1791.9407 16 2.0 896.9794 2 84.37 3 51280 AEV_3_3_RA3_01_1233.d 0 1 1 162 177 2-amino-3-oxo-butanoic_acid
K.AAAQAASDM(+15.99)R.N Y 27.04 1006.4502 10 -0.9 504.2319 2 14.01 2 3969 AEV_1_3_RA2_01_1232.d 1.14E5 3 3 109 118 Oxidation (M)
K.TVAIESISADIEENGVRLR.L Y 25.77 2071.0908 19 -6.0 691.3668 3 79.96 3 48041 AEV_3_3_RA3_01_1233.d 1.41E5 1 1 190 208
K.EVNPAVK.Q Y 25.71 755.4177 7 -61.9 756.3782 1 52.13 1 21440 AEV 2_3_RA2_01_1224.d 7.06E4 2 2 431 437
K.LTGY(+79.97)VGFANLPNQW(+43.99)HR.K Y 25.39 1995.8992 16 -31.9 666.2858 3 79.78 1 41669 AEV 2_3_RA2_01_1224.d 6.84E4 1 1 125 140 Phosphorylation (STY); Carboxylation (DKW)
R.RKLTGYVGFANLPNQWHR.K Y 25.15 2156.1392 18 3.8 432.2368 5 71.09 3 41085 AEV_3_3_RA3_01_1233.d 7.73E4 1 1 123 140
R.LESGRP(+31.99)LEDK.I Y 23.08 1174.5829 10 24.5 588.3131 2 57.94 3 30909 AEV_3_3_RA3_01_1233.d 0 1 1 503 512 Dihydroxy
K.LKQSEDELYAR(+14.02).H Y 20.50 1364.6936 11 12.6 455.9109 3 47.57 3 24179 AEV_3_3_RA3_01_1233.d 0 1 1 471 481 Methylation(KR)
K.MVFQ(+.98)Q(+.98)K(+14.02).V Y 20.35 795.3837 6 -6.2 796.3860 1 67.20 3 38017 AEV_3_3_RA3_01_1233.d 1.02E5 1 1 458 463 Deamidation (NQ); Methylation(KR)
K.LTQMGVAQDPSVFKEVNPAVK.Q Y 20.21 2257.1775 21 13.8 565.3094 4 67.61 2 31089 AEV_1_3_RA2_01_1232.d 6.12E4 1 1 417 437
K.DQLER.Q Y 19.54 659.3239 5 -12.9 660.3226 1 29.79 3 13264 AEV_3_3_RA3_01_1233.d 1.17E5 2 2 487 491
K.AAAQ(+15.00)AASDMR.N Y 19.37 1005.4549 10 -20.5 336.1520 3 62.91 1 28712 AEV 2_3_RA2_01_1224.d 1.4E5 1 1 109 118 Deamidation followed by a methylation
K.LTQMGVAQDPS(+79.97)VFK.E Y 19.36 1599.7368 14 12.0 800.8853 2 78.66 2 39493 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 417 430 Phosphorylation (STY)
R.LESGRPLEDK(+14.02).I Y 19.34 1156.6088 10 -47.8 1157.5608 1 102.73 1 56615 AEV 2_3_RA2_01_1224.d 1.8E5 2 2 503 512 Methylation(KR)
K.LTQM(+15.99)GVAQDPSVFK(+42.01).E Y 19.30 1577.7759 14 -44.0 316.5486 5 77.37 1 39753 AEV 2_3_RA2_01_1224.d 9.1E4 1 1 417 430 Oxidation (M); Acetylation (K)
R.Q(-17.03)RAELEEK.K Y 19.15 984.4876 8 7.4 493.2547 2 28.80 3 12694 AEV_3_3_RA3_01_1233.d 2.37E5 2 2 492 499 Pyro-glu from Q
R.SNPMGQ(+.98)GAAQT(+79.97)VTSK.N Y 18.91 1556.6542 15 1.4 390.1714 4 31.65 1 9959 AEV 2_3_RA2_01_1224.d 0 1 1 91 105 Deamidation (NQ); Phosphorylation (STY)
K.EVN(+.98)PAVK(+21.98).Q Y 18.77 778.3837 7 -58.6 779.3453 1 97.83 1 54888 AEV 2_3_RA2_01_1224.d 2.56E4 1 1 431 437 Deamidation (NQ); Sodium adduct
R.TLHEQK(+21.98).L Y 17.78 776.3793 6 -4.7 777.3829 1 78.70 2 39522 AEV_1_3_RA2_01_1232.d 6.74E4 1 1 443 448 Sodium adduct
K.ADT(-2.02)LTDEEIALFK.Q Y 17.64 1462.7191 13 25.2 732.3853 2 81.39 3 49126 AEV_3_3_RA3_01_1233.d 0 1 1 296 308 2-amino-3-oxo-butanoic_acid
K.EHTNNALYEN(+.98)YRSD(+21.98)K.L Y 17.18 1875.7999 15 4.8 626.2769 3 87.50 1 47725 AEV 2_3_RA2_01_1224.d 1.89E5 1 1 402 416 Deamidation (NQ); Sodium adduct
K.TVAIESISADIEEN(+.98)GVR(+28.03)LR.L Y 16.57 2100.1062 19 9.5 421.0325 5 37.79 2 14418 AEV_1_3_RA2_01_1232.d 0 1 1 190 208 Deamidation (NQ); Dimethylation(KR)
K.M(+27.99)VFQQ(+.98)K.V Y 16.33 808.3789 6 -22.8 405.1875 2 51.09 1 20822 AEV 2_3_RA2_01_1224.d 0 1 1 458 463 Formylation; Deamidation (NQ)
R.K(+42.01)(+42.01)GPSLDIIPK.T Y 16.08 1150.6597 10 10.5 384.5645 3 60.52 3 32808 AEV_3_3_RA3_01_1233.d 0 1 1 180 189 Acetylation (N-term); Acetylation (K)
R.LESGRPLEDK(+42.01).I Y 15.69 1184.6036 10 -69.9 395.8475 3 54.08 1 22607 AEV 2_3_RA2_01_1224.d 0 1 1 503 512 Acetylation (K)
R.MNIVDNR(+28.03).V Y 15.44 888.4487 7 -96.3 445.1888 2 62.83 1 28655 AEV 2_3_RA2_01_1224.d 0 1 1 251 257 Dimethylation(KR)
K.EVN(+.98)PAVK.Q Y 15.38 756.4017 7 -6.4 379.2057 2 14.19 3 4681 AEV_3_3_RA3_01_1233.d 0 1 1 431 437 Deamidation (NQ)
K.AAAQ(+.98)AASDMR(+14.02).N Y 15.19 1005.4549 10 -41.3 503.7140 2 47.84 1 18997 AEV 2_3_RA2_01_1224.d 0 1 1 109 118 Deamidation (NQ); Methylation(KR)
R.KGFSLR Y 15.06 706.4126 6 1.3 354.2140 2 31.91 2 11600 AEV_1_3_RA2_01_1232.d 6.28E4 1 1 516 521
K.VNRMNIVDNR(-.98).V Y 15.05 1228.6459 10 19.5 308.1747 4 21.78 3 8790 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 248 257 Amidation
total 68 peptides
C1GAT8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.TYDVSVPFVLMNSFNTDEDTQSIIK.K Y 121.89 2862.3633 25 4.0 955.1322 3 91.41 3 55486 AEV_3_3_RA3_01_1233.d 4.88E5 5 5 153 177
R.KGEADISIIQLETAVGAAIR.H Y 104.27 2054.1372 20 -2.6 685.7179 3 86.01 3 52378 AEV_3_3_RA3_01_1233.d 3.6E5 3 3 358 377
R.VVENNELEMEIIPNEK.S Y 102.86 1898.9294 16 -0.7 950.4713 2 77.00 3 45724 AEV_3_3_RA3_01_1233.d 2.61E5 3 3 336 351
K.HGQLVIDPNRFGGTPLIK.L Y 93.75 1961.0846 18 1.7 491.2792 4 75.54 2 37025 AEV_1_3_RA2_01_1232.d 8.21E5 6 6 413 430
K.RFEAEMDNFFSLFRR.Y Y 92.90 1963.9363 15 13.5 491.9980 4 84.69 3 51492 AEV_3_3_RA3_01_1233.d 9.52E4 2 2 53 67
R.VVENNELEM(+15.99)EIIPNEK.S Y 89.64 1914.9244 16 -1.1 958.4684 2 73.29 3 42814 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 336 351 Oxidation (M)
K.KRFEAEMDNFFSLFRR.Y Y 88.25 2092.0312 16 5.7 419.4159 5 81.99 3 49581 AEV_3_3_RA3_01_1233.d 3.32E4 1 1 52 67
K.FKYFNTNNIWMDLR.A Y 85.18 1860.8981 14 6.9 621.3109 3 82.57 3 50028 AEV_3_3_RA3_01_1233.d 7.86E4 2 2 318 331
R.ILELDHLTISGVVNLGR.G Y 83.98 1848.0469 17 7.4 617.0275 3 84.68 3 51480 AEV_3_3_RA3_01_1233.d 8.6E4 2 2 451 467
K.YEGHNIDILTFNQSR.Y Y 83.33 1805.8696 15 -5.0 602.9608 3 73.86 2 35832 AEV_1_3_RA2_01_1232.d 7.4E4 2 2 179 193
K.NAHGVNVPR.R Y 80.31 962.5046 9 -9.5 482.2550 2 20.86 3 8283 AEV_3_3_RA3_01_1233.d 1.23E6 8 8 381 389
K.GNVLSWDSIAPPQPGQVVEYSNLGNSASVNFLKK.L Y 77.02 3614.8369 34 0.3 1205.9532 3 86.24 3 52537 AEV_3_3_RA3_01_1233.d 6.11E4 1 1 75 108
K.GNVLSWDSIAPPQPGQVVEYSNLGNSASVNFLK.K Y 76.44 3486.7419 33 4.7 1163.2600 3 89.43 3 54399 AEV_3_3_RA3_01_1233.d 7.55E4 1 1 75 107
R.LLEIAQVPKEHVNEFK.S Y 75.89 1893.0359 16 -5.6 474.2636 4 69.47 3 39820 AEV_3_3_RA3_01_1233.d 3.98E5 2 2 298 313
R.ILRDSLLPAPK.T Y 75.72 1221.7445 11 -1.3 408.2549 3 65.26 3 36480 AEV_3_3_RA3_01_1233.d 1.48E6 7 7 197 207
K.GGTIIDYEGR.A Y 72.59 1079.5247 10 -1.3 540.7689 2 59.17 3 31797 AEV_3_3_RA3_01_1233.d 1.12E6 5 5 286 295
R.FGGTPLIK.L Y 72.34 831.4854 8 -2.5 416.7489 2 61.56 3 33624 AEV_3_3_RA3_01_1233.d 3.29E5 2 2 423 430
R.KGEADISIIQLE(+14.02)TAVGAAIR.H Y 72.20 2068.1528 20 1.5 690.3926 3 89.94 3 54695 AEV_3_3_RA3_01_1233.d 5.21E4 2 2 358 377 Methylation(others)
R.DGMSFLDLAVR.Q Y 71.19 1222.6016 11 2.7 612.3097 2 85.44 2 44608 AEV_1_3_RA2_01_1232.d 6.12E5 4 4 135 145
K.ADVKGGTIIDYEGR.A Y 68.84 1492.7521 14 1.4 498.5920 3 59.77 3 32244 AEV_3_3_RA3_01_1233.d 1.48E5 2 2 282 295
R.DGM(+15.99)SFLDLAVR.Q Y 64.46 1238.5964 11 6.0 620.3092 2 81.06 2 41402 AEV_1_3_RA2_01_1232.d 7.1E4 2 2 135 145 Oxidation (M)
K.KYEGHNIDILTFNQSRYPR.I Y 61.80 2350.1819 19 -0.2 471.0436 5 67.68 3 38397 AEV_3_3_RA3_01_1233.d 1.86E5 1 1 178 196
R.DSLLPAPK.T Y 58.48 839.4752 8 -1.3 420.7443 2 59.76 3 32240 AEV_3_3_RA3_01_1233.d 1.13E6 5 5 200 207
K.TC(+57.02)SDLMLVK.S Y 57.23 1065.5199 9 0.0 533.7672 2 64.31 3 35733 AEV_3_3_RA3_01_1233.d 2.34E5 2 2 397 405 Carbamidomethylation
R.LLEIAQVPK.E Y 54.39 1009.6171 9 -1.3 505.8152 2 69.60 3 39929 AEV_3_3_RA3_01_1233.d 2.11E5 2 2 298 306
K.SDLYTLK.H Y 52.09 838.4436 7 -14.1 839.4391 1 54.66 3 28788 AEV_3_3_RA3_01_1233.d 7.18E5 5 5 406 412
K.HGQLVIDPNR.F Y 47.62 1147.6097 10 -15.8 574.8031 2 45.96 2 18410 AEV_1_3_RA2_01_1232.d 1.15E5 3 3 413 422
K.KYEGHNIDILTFNQSR.Y Y 44.78 1933.9646 16 -81.9 484.4588 4 78.20 1 40408 AEV 2_3_RA2_01_1224.d 1.93E5 1 1 178 193
K.GGTIIDYEGR(+14.02).A Y 44.46 1093.5404 10 12.4 547.7842 2 66.84 2 30574 AEV_1_3_RA2_01_1232.d 2.19E5 3 3 286 295 Methylation(KR)
R.IPSIPR.I Y 43.62 681.4174 6 3.4 341.7171 2 54.77 2 22913 AEV_1_3_RA2_01_1232.d 1.04E6 5 5 445 450
K.EHVNEFK.S Y 42.92 901.4293 7 4.0 451.7237 2 16.41 3 5898 AEV_3_3_RA3_01_1233.d 0 1 1 307 313
K.RIPSIPR.I Y 41.93 837.5184 7 2.9 419.7677 2 47.05 2 18965 AEV_1_3_RA2_01_1232.d 6.37E5 3 3 444 450
R.KGEADISIIQLETAVGAAIR(-.98).H Y 35.81 2053.1531 20 4.4 685.3947 3 86.24 2 45135 AEV_1_3_RA2_01_1232.d 1.08E5 1 1 358 377 Amidation
K.GGTIIDYEGRAR.L Y 34.97 1306.6630 12 1.0 436.5620 3 51.60 3 26781 AEV_3_3_RA3_01_1233.d 1.92E5 1 1 286 297
K.G(+43.01)EADIS(+79.97)IIQLETAVGAAIR.H Y 34.12 2049.0144 19 59.3 684.0526 3 86.24 2 45136 AEV_1_3_RA2_01_1232.d 5.73E4 1 1 359 377 Carbamylation; Phosphorylation (STY)
K.LAVIK.L N 33.48 542.3792 5 5.6 543.3895 1 37.16 2 14105 AEV_1_3_RA2_01_1232.d 3.99E5 2 2 109 113
K.NKAEYIMELTDKTK.A Y 32.70 1682.8549 14 18.1 561.9691 3 65.54 2 29627 AEV_1_3_RA2_01_1232.d 0 1 1 268 281
K.NAHGVN(+.98)VPR.R Y 31.53 963.4886 9 7.9 322.1727 3 9.68 2 2376 AEV_1_3_RA2_01_1232.d 6.25E4 1 1 381 389 Deamidation (NQ)
K.YEGHN(+.98)IDILTFNQSR.Y Y 31.08 1806.8536 15 14.5 603.3005 3 72.89 3 42495 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 179 193 Deamidation (NQ)
R.GVEIVFLSNADNLGAVVDM(+15.99)R.I Y 29.31 2134.0728 20 14.3 712.3750 3 86.92 2 45570 AEV_1_3_RA2_01_1232.d 1.5E5 1 1 241 260 Oxidation (M)
K.AEY(+79.97)IMELT(+79.97)DK.T Y 28.45 1371.5071 10 82.6 458.2141 3 70.69 1 34493 AEV 2_3_RA2_01_1224.d 0 1 1 270 279 Phosphorylation (STY)
MAISIP(+31.99)GVR.N Y 24.87 974.5219 9 8.6 325.8507 3 15.65 3 5483 AEV_3_3_RA3_01_1233.d 3.01E5 1 1 1 9 Dihydroxy
K.SVIEVR(+14.02).D Y 24.31 715.4228 6 -87.4 358.6874 2 59.22 1 25922 AEV 2_3_RA2_01_1224.d 6.85E4 1 1 129 134 Methylation(KR)
K.SIPADRK(+14.02)GEADIS(-18.01)IIQLETAVGAAIR.H Y 24.23 2689.4761 26 4.9 673.3796 4 84.11 2 43690 AEV_1_3_RA2_01_1232.d 0 1 1 352 377 Methylation(KR); Dehydration
K.HGQLVIDPN(+.98)RFGGTPLIK(+14.02).L Y 24.05 1976.0844 18 2.6 495.0297 4 76.65 3 45415 AEV_3_3_RA3_01_1233.d 1.15E5 1 1 413 430 Deamidation (NQ); Methylation(KR)
R.Q(-17.03)IEYLNR.T Y 23.61 917.4606 7 -89.2 459.6967 2 76.67 1 39196 AEV 2_3_RA2_01_1224.d 1.88E5 1 1 146 152 Pyro-glu from Q
R.ILRDS(+79.96)LLPAPK.T Y 23.09 1301.7013 11 -20.5 434.8988 3 65.17 3 36410 AEV_3_3_RA3_01_1233.d 2.81E4 1 1 197 207 Sulfation
K.NAH(+40.03)GVNVPR.R Y 21.88 1002.5359 9 -118.5 335.1463 3 40.49 1 14690 AEV 2_3_RA2_01_1224.d 0 1 1 381 389 Propionaldehyde +40
K.EHVNEFK(-.98).S Y 21.75 900.4453 7 -104.9 451.1827 2 34.25 1 11326 AEV 2_3_RA2_01_1224.d 0 1 1 307 313 Amidation
R.QIEYLNR.T Y 21.42 934.4872 7 -89.7 468.2090 2 61.21 1 27430 AEV 2_3_RA2_01_1224.d 1.06E5 1 1 146 152
K.GEADISIIQ(+.98)LETAVGAAIR.H Y 20.99 1927.0261 19 4.7 643.3524 3 79.96 3 48032 AEV_3_3_RA3_01_1233.d 8.92E4 1 1 359 377 Deamidation (NQ)
K.GGTIIDYEGR(+28.03).A Y 20.92 1107.5560 10 -20.4 554.7740 2 66.06 2 29987 AEV_1_3_RA2_01_1232.d 5.7E4 1 1 286 295 Dimethylation(KR)
K.TKADVK.G Y 20.86 660.3806 6 -57.8 661.3497 1 68.40 2 31663 AEV_1_3_RA2_01_1232.d 0 1 1 280 285
K.T(+43.01)KADVKGGTIIDYEGR(+14.02).A Y 20.71 1778.9163 16 -15.3 445.7295 4 59.15 2 25324 AEV_1_3_RA2_01_1232.d 4.6E4 1 1 280 295 Carbamylation; Methylation(KR)
R.Y(+27.99)LNDK.A Y 20.66 679.3177 5 -41.4 680.2968 1 87.95 1 48071 AEV 2_3_RA2_01_1224.d 4.19E5 1 1 68 72 Formylation
M(+42.01)AISIPGVR.N Y 20.32 984.5426 9 -39.6 493.2591 2 74.20 2 36030 AEV_1_3_RA2_01_1232.d 8.85E4 2 2 1 9 Acetylation (Protein N-term)
R.LLE(+14.02)IAQVPKEHVNEFK.S Y 19.91 1907.0516 16 5.4 477.7727 4 71.15 2 33707 AEV_1_3_RA2_01_1232.d 5.02E4 1 1 298 313 Methylation(others)
R.ILRDSLLPAPK(+14.02).T Y 19.88 1235.7601 11 7.1 412.9302 3 67.31 3 38103 AEV_3_3_RA3_01_1233.d 7.11E4 1 1 197 207 Methylation(KR)
K.S(+43.01)IPADR.K Y 19.47 700.3503 6 -12.0 701.3492 1 51.06 3 26414 AEV_3_3_RA3_01_1233.d 0 1 1 352 357 Carbamylation
R.VVENNELEMEIIPNE(+21.98)KSIPADR.K Y 19.15 2560.2454 22 -9.8 641.0623 4 89.39 1 49172 AEV 2_3_RA2_01_1224.d 9.26E4 1 1 336 357 Sodium adduct
K.KLAVIK(-.98).L Y 19.11 669.4901 6 51.9 670.5321 1 101.68 2 51500 AEV_1_3_RA2_01_1232.d 3.08E5 1 1 108 113 Amidation
R.RYLNDK.A Y 18.87 807.4239 6 -122.8 808.3320 1 96.64 1 54174 AEV 2_3_RA2_01_1224.d 0 1 1 67 72
R.AR(+14.02)LLEIAQVPK.E Y 18.72 1250.7710 11 -4.5 417.9291 3 80.79 2 41187 AEV_1_3_RA2_01_1232.d 6.75E4 2 2 296 306 Methylation(KR)
K.NAHGVNVPR(+14.02).R Y 18.66 976.5203 9 3.1 326.5150 3 22.66 3 9244 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 381 389 Methylation(KR)
K.AEY(-18.01)IMELTDKT(+79.97)K.A Y 18.54 1502.6727 12 -4.4 752.3403 2 96.18 1 53884 AEV 2_3_RA2_01_1224.d 0 1 1 270 281 Dehydration; Phosphorylation (STY)
K.YFNTNNIWMDLR.A Y 18.25 1585.7347 12 5.5 793.8790 2 83.87 2 43523 AEV_1_3_RA2_01_1232.d 8.37E4 2 2 320 331
K.GNVLSWDS(-2.02)IAPPQPGQVVEYSNLGNSASVNFLK.K Y 18.24 3484.7263 33 -24.3 1162.5544 3 89.60 2 47036 AEV_1_3_RA2_01_1232.d 0 1 1 75 107 2-amino-3-oxo-butanoic_acid
K.KFKYFNTNNIWMDLR.A Y 17.82 1988.9930 15 -32.6 498.2393 4 93.09 1 51823 AEV 2_3_RA2_01_1224.d 6.54E4 1 1 317 331
K.LNGGLGT(+79.97)SMGC(+57.02)VGPK(+42.01).S Y 17.34 1568.6729 15 -37.6 523.8785 3 75.82 1 38518 AEV 2_3_RA2_01_1224.d 0 1 1 114 128 Phosphorylation (STY); Carbamidomethylation; Acetylation (K)
K.SIPADRKGEADISIIQLET(-18.01)AVGAAIR(+14.02).H Y 17.30 2689.4761 26 -5.0 673.3729 4 83.88 3 50932 AEV_3_3_RA3_01_1233.d 0 1 1 352 377 Dehydration; Methylation(KR)
R.DGM(-48.00)SFLDLAVR.Q Y 17.27 1174.5981 11 -91.0 392.5044 3 81.16 1 42759 AEV 2_3_RA2_01_1224.d 9.96E4 1 1 135 145 Dethiomethyl
K.V(+42.01)SDFQK.R Y 17.18 764.3704 6 -93.5 383.1567 2 26.15 1 7053 AEV 2_3_RA2_01_1224.d 0 1 1 438 443 Acetylation (N-term)
R.FLPVKT(+79.97)CSDLMLVK.S Y 16.58 1672.8333 14 17.5 419.2229 4 72.94 3 42538 AEV_3_3_RA3_01_1233.d 1.2E5 1 1 392 405 Phosphorylation (STY)
R.K(+14.02)GEADISIIQLETAVGAAIR.H Y 16.55 2068.1528 20 -97.9 517.9949 4 93.99 1 52473 AEV 2_3_RA2_01_1224.d 5.4E4 1 1 358 377 Methylation(KR)
K.RIP(+31.99)SIPR.I Y 15.96 869.5082 7 27.5 435.7733 2 58.77 3 31565 AEV_3_3_RA3_01_1233.d 9.03E6 2 2 444 450 Dihydroxy
R.ILEHMVK.N Y 15.78 868.4841 7 -15.6 435.2425 2 28.11 3 12313 AEV_3_3_RA3_01_1233.d 5.99E4 2 2 261 267
R.DGMSFLDLAVR(+14.02).Q Y 15.43 1236.6172 11 -70.0 619.2726 2 92.34 1 51344 AEV 2_3_RA2_01_1224.d 3.78E4 1 1 135 145 Methylation(KR)
MAISIPGVR.N Y 15.37 942.5320 9 -84.3 315.1581 3 40.46 1 14665 AEV 2_3_RA2_01_1224.d 0 1 1 1 9
K.N(+43.01)AHGVN(+.98)VPR.R Y 15.16 1006.4944 9 -1.5 504.2537 2 28.34 2 9973 AEV_1_3_RA2_01_1232.d 4.76E3 1 1 381 389 Carbamylation; Deamidation (NQ)
K.LGR(+14.02)DFK.K Y 15.10 748.4232 6 23.0 749.4476 1 62.38 2 27455 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 431 436 Methylation(KR)
total 80 peptides
C1GFG5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.KTPTAPAVVEPTKVLGK.T Y 134.36 1735.0243 17 4.0 434.7651 4 62.84 2 27766 AEV_1_3_RA2_01_1232.d 2.23E6 9 9 149 165
K.AAGSKPSGTATHASYR.D Y 131.42 1560.7644 16 4.8 521.2646 3 15.67 2 4623 AEV_1_3_RA2_01_1232.d 1.3E6 10 10 6 21
K.YVHNNNKITVTSQSAFDAQFNR.A Y 121.34 2553.2361 22 0.8 639.3168 4 65.26 3 36483 AEV_3_3_RA3_01_1233.d 7.89E5 8 8 45 66
K.EATKPAAKPAAK.K Y 90.99 1181.6768 12 4.7 591.8484 2 9.24 2 2235 AEV_1_3_RA2_01_1232.d 7.68E5 8 8 93 104
K.SGVEKGEFTQPKGPSGPLK.L Y 90.88 1942.0159 19 3.9 486.5131 4 55.63 3 29303 AEV_3_3_RA3_01_1233.d 2.6E5 1 1 70 88
R.KTPTAPAVVEPTK.V Y 89.05 1337.7554 13 0.2 446.9258 3 42.99 3 21276 AEV_3_3_RA3_01_1233.d 2.36E6 7 7 149 161
K.KEATKPAAKPAAK.K Y 87.94 1309.7717 13 4.2 655.8959 2 8.86 2 2111 AEV_1_3_RA2_01_1232.d 5.84E5 7 7 92 104
K.KAAGSKPSGTATHASYR.D Y 86.04 1688.8594 17 8.4 423.2256 4 13.57 2 3805 AEV_1_3_RA2_01_1232.d 1.52E5 3 3 5 21
K.YVHNNNKITVTSQSAFDAQFNR(+14.02).A Y 83.29 2567.2517 22 -3.1 642.8182 4 66.20 3 37225 AEV_3_3_RA3_01_1233.d 8.71E4 1 1 45 66 Methylation(KR)
K.ITVTSQSAFDAQFNR.A Y 83.23 1683.8217 15 7.1 562.2852 3 72.11 3 41903 AEV_3_3_RA3_01_1233.d 4.43E5 7 7 52 66
K.SGVEKGEFTQPK.G Y 78.26 1305.6565 12 1.8 653.8367 2 31.59 3 14353 AEV_3_3_RA3_01_1233.d 1.65E6 10 10 70 81
K.TPTAPAVVEPTK.V Y 71.08 1209.6605 12 -25.0 605.8224 2 53.81 3 28240 AEV_3_3_RA3_01_1233.d 1.85E5 3 3 150 161
K.EAT(-18.01)KPAAKPAAK.K Y 69.09 1163.6661 12 6.8 388.8986 3 9.21 2 2229 AEV_1_3_RA2_01_1232.d 1.6E5 2 2 93 104 Dehydration
K.KAAGSKPSGT(-18.01)ATHASYR.D Y 67.12 1670.8489 17 5.6 335.1789 5 12.64 3 3832 AEV_3_3_RA3_01_1233.d 1.77E5 1 1 5 21 Dehydration
K.E(-18.01)ATKPAAKPAAK.K Y 65.97 1163.6661 12 2.9 388.8971 3 9.51 3 2356 AEV_3_3_RA3_01_1233.d 4.47E4 1 1 93 104 Pyro-glu from E
R.DMIKDAIINLKER.N Y 64.99 1557.8549 13 2.2 390.4719 4 74.00 3 43349 AEV_3_3_RA3_01_1233.d 2E5 2 2 22 34
K.AAGS(-18.01)K(+14.02)PSGTATHASYR.D Y 60.71 1556.7695 16 32.8 390.2124 4 14.56 3 4856 AEV_3_3_RA3_01_1233.d 0 1 1 6 21 Dehydration; Methylation(KR)
R.DMIKDAIINLK.E Y 57.79 1272.7112 11 1.6 425.2450 3 76.83 3 45563 AEV_3_3_RA3_01_1233.d 1.25E5 2 2 22 32
K.GPSGPLK.L Y 52.11 654.3701 7 -87.2 328.1638 2 29.01 1 8465 AEV 2_3_RA2_01_1224.d 2.55E6 5 5 82 88
K.K(+14.02)AAGS(-18.01)KPSGTATHASYR.D Y 49.59 1684.8645 17 28.1 422.2352 4 12.59 3 3811 AEV_3_3_RA3_01_1233.d 0 1 1 5 21 Methylation(KR); Dehydration
R.AVKSGVEKGEFTQPK.G Y 47.12 1603.8569 15 0.4 535.6265 3 32.24 3 14718 AEV_3_3_RA3_01_1233.d 4.07E4 1 1 67 81
R.KTPTAPAVVE(+14.02)PTK.V Y 44.56 1351.7711 13 3.8 451.5994 3 51.43 3 26664 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 149 161 Methylation(others)
K.KEAT(-18.01)KPAAKPAAK.K Y 44.45 1291.7611 13 0.0 431.5943 3 9.10 3 2198 AEV_3_3_RA3_01_1233.d 7.93E3 1 1 92 104 Dehydration
K.T(+42.01)PT(+79.97)APAVVEPTK.V Y 42.89 1331.6373 12 67.4 444.9163 3 42.63 3 21055 AEV_3_3_RA3_01_1233.d 0 1 1 150 161 Acetylation (N-term); Phosphorylation (STY)
K.KEATKPAAKPAAKK.A Y 35.30 1437.8667 14 1.4 480.2968 3 8.77 3 2093 AEV_3_3_RA3_01_1233.d 6.61E3 1 1 92 105
K.SGVEKGEFTQPK(+14.02).G Y 34.93 1319.6721 12 -1.5 440.8973 3 43.07 2 16994 AEV_1_3_RA2_01_1232.d 2.67E5 2 2 70 81 Methylation(KR)
R.KTPTAPAVVEP(+13.98)TKVLGK.T Y 34.55 1749.0035 17 -70.5 438.2273 4 73.84 1 37042 AEV 2_3_RA2_01_1224.d 1.98E5 1 1 149 165 Proline oxidation to pyroglutamic acid
K.SGVE(+14.02)KGEFTQPK.G Y 33.71 1319.6721 12 0.9 440.8984 3 38.67 3 18608 AEV_3_3_RA3_01_1233.d 1.43E5 1 1 70 81 Methylation(others)
K.GEFTQPK.G Y 33.31 805.3970 7 4.5 403.7076 2 23.98 2 8049 AEV_1_3_RA2_01_1232.d 5.73E5 4 4 75 81
K.YVHNNNK(+14.02)IT(-18.01)VTSQSAFDAQFNR.A Y 32.19 2549.2412 22 28.1 638.3355 4 111.88 3 62493 AEV_3_3_RA3_01_1233.d 8.74E4 1 1 45 66 Methylation(KR); Dehydration
K.KTAAAKPK(+14.02).A Y 31.90 827.5228 8 0.4 414.7689 2 8.42 2 1988 AEV_1_3_RA2_01_1232.d 2.01E3 1 1 134 141 Methylation(KR)
K.K(+43.99)EATKPAAKPAAK(+42.01).K Y 29.10 1395.7721 13 -9.6 466.2602 3 68.16 3 38784 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 92 104 Carboxylation (DKW); Acetylation (K)
K.S(+42.01)GVEKGEFTQ(+.98)PK.G Y 27.04 1348.6510 12 36.4 338.1823 4 18.57 2 5810 AEV_1_3_RA2_01_1232.d 0 1 1 70 81 Acetylation (N-term); Deamidation (NQ)
K.SGVEK(+14.02)GEFTQPK.G Y 26.84 1319.6721 12 0.9 440.8984 3 40.47 3 19682 AEV_3_3_RA3_01_1233.d 4.25E5 1 1 70 81 Methylation(KR)
R.NGSSRQALK(+43.01).K Y 26.55 1002.5206 9 -14.5 502.2603 2 43.71 2 17301 AEV_1_3_RA2_01_1232.d 4.76E4 1 1 35 43 Carbamylation
K.AATTK(+21.98).K Y 25.79 512.2570 5 8.3 513.2686 1 44.98 3 22546 AEV_3_3_RA3_01_1233.d 1.17E4 2 2 124 128 Sodium adduct
K.EATKPAAKPAAK(+14.02).K Y 24.95 1195.6924 12 -4.7 399.5695 3 11.91 2 3187 AEV_1_3_RA2_01_1232.d 1.85E4 1 1 93 104 Methylation(KR)
K.SGVEK(+14.02).G Y 24.88 532.2856 5 -105.3 533.2369 1 87.61 1 47815 AEV 2_3_RA2_01_1224.d 5.12E4 2 2 70 74 Methylation(KR)
R.AVKS(+79.97)GVEKGEFTQPK.G Y 23.95 1683.8232 15 59.0 421.9879 4 13.88 2 3921 AEV_1_3_RA2_01_1232.d 0 1 1 67 81 Phosphorylation (STY)
K.K(+226.08)AAGSKPSGTATHASYR.D Y 23.81 1914.9370 17 14.6 639.3289 3 41.44 3 20311 AEV_3_3_RA3_01_1233.d 3.72E5 1 1 5 21 Biotinylation
K.S(-18.01)GVEK(+14.02)GEFTQPK.G Y 23.01 1301.6615 12 10.1 434.8988 3 33.45 2 12327 AEV_1_3_RA2_01_1232.d 5.3E4 1 1 70 81 Dehydration; Methylation(KR)
R.KTPTAPAVVEPTK(+21.98).V Y 22.74 1359.7374 13 -13.8 454.2468 3 62.84 2 27774 AEV_1_3_RA2_01_1232.d 4.03E4 1 1 149 161 Sodium adduct
R.K(+14.02)TP(+31.99)TAPAVVEPTK.V Y 22.20 1383.7609 13 -9.3 462.2566 3 63.37 2 28130 AEV_1_3_RA2_01_1232.d 1.53E5 1 1 149 161 Methylation(KR); Dihydroxy
R.AVK(+42.01)SGVEK(+27.99).G Y 21.45 886.4760 8 -8.8 444.2413 2 73.36 2 35389 AEV_1_3_RA2_01_1232.d 2.18E5 1 1 67 74 Acetylation (K); Formylation
K.KAAGSKPSGTAT(-18.01)HASYR.D Y 21.42 1670.8489 17 -89.5 335.1472 5 34.22 1 11311 AEV 2_3_RA2_01_1224.d 3.7E5 1 1 5 21 Dehydration
K.TPTAPAVVEPTKVLGKT(+79.97)K(-.98).S Y 20.93 1915.0543 18 -3.9 384.0167 5 56.53 3 29887 AEV_3_3_RA3_01_1233.d 1.87E5 1 1 150 167 Phosphorylation (STY); Amidation
K.GPSGPLK(+14.02).L Y 20.01 668.3857 7 -89.7 335.1701 2 43.16 1 16238 AEV 2_3_RA2_01_1224.d 2.33E5 2 2 82 88 Methylation(KR)
K.GEFTQ(+.98)PK.G Y 19.82 806.3810 7 15.3 404.2039 2 26.44 3 11388 AEV_3_3_RA3_01_1233.d 0 1 1 75 81 Deamidation (NQ)
K.AAPKQATT(+79.97)K.A Y 19.15 994.4849 9 -45.1 498.2273 2 85.61 1 46271 AEV 2_3_RA2_01_1224.d 1.13E5 1 1 115 123 Phosphorylation (STY)
K.AGATK.K Y 19.12 446.2489 5 -130.9 447.1978 1 29.24 1 8577 AEV 2_3_RA2_01_1224.d 0 1 1 183 187
K.AGATKK(+14.02)TT(+79.97)TTTK(+42.01)K.A Y 18.96 1471.7648 13 -33.7 491.5790 3 66.57 3 37514 AEV_3_3_RA3_01_1233.d 9.73E4 1 1 183 195 Methylation(KR); Phosphorylation (STY); Acetylation (K)
R.AVK(+43.99)SGVEK.G Y 18.60 860.4603 8 -5.0 431.2353 2 28.10 2 9858 AEV_1_3_RA2_01_1232.d 0 1 1 67 74 Carboxylation (DKW)
R.NGSSR(+14.02).Q N 18.48 533.2557 5 -104.1 534.2075 1 37.72 1 13125 AEV 2_3_RA2_01_1224.d 8.79E4 1 1 35 39 Methylation(KR)
K.KEAT(+79.96)KPAAKPAAK.K Y 18.22 1389.7285 13 10.0 348.4429 4 43.54 2 17220 AEV_1_3_RA2_01_1232.d 0 1 1 92 104 Sulfation
K.A(+42.01)APKQATTK(+43.99)AATTK.K Y 17.74 1472.7834 14 -5.5 369.2011 4 30.28 3 13552 AEV_3_3_RA3_01_1233.d 0 1 1 115 128 Acetylation (N-term); Carboxylation (DKW)
K.K(+42.01)(+14.02)AGATKK.T Y 17.55 758.4650 7 17.8 759.4858 1 99.71 2 50925 AEV_1_3_RA2_01_1232.d 0 1 1 182 188 Acetylation (N-term); Methylation(KR)
R.NGSSR(+31.99).Q N 17.46 551.2299 5 -81.1 552.1925 1 19.88 1 4744 AEV 2_3_RA2_01_1224.d 0 1 1 35 39 Dihydroxy
K.AAGS(+162.05)K(+14.02)PSGTATHASYR.D Y 17.25 1736.8329 16 -23.4 435.2054 4 81.32 1 42877 AEV 2_3_RA2_01_1224.d 1.34E4 1 1 6 21 Hexose (NSY); Methylation(KR)
R.KTPTAPAVVEPT(-18.01)K.V Y 17.19 1319.7449 13 -41.2 440.9041 3 59.72 2 25697 AEV_1_3_RA2_01_1232.d 7.71E4 1 1 149 161 Dehydration
K.GPSGPLK(+61.92).L Y 16.96 716.2918 7 30.1 717.3206 1 81.61 1 43090 AEV 2_3_RA2_01_1224.d 7.88E3 1 1 82 88 Replacement of proton by copper
K.AAGSK(+14.02)PSGTATHASYR(+14.02).D Y 16.93 1588.7958 16 18.1 795.4196 2 84.27 3 51210 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 6 21 Methylation(KR)
K.T(+27.99)TTTTK.K Y 16.75 679.3389 6 7.6 680.3513 1 76.96 3 45668 AEV_3_3_RA3_01_1233.d 0 1 1 189 194 Formylation
K.SSPKKAGATK(+226.08)K.T Y 16.73 1327.7281 11 -7.7 332.9368 4 34.59 2 12888 AEV_1_3_RA2_01_1232.d 2.35E4 1 1 178 188 Biotinylation
K.Q(+.98)ATTKAATTK(+21.98).K Y 16.52 1042.5271 10 -45.4 1043.4871 1 69.74 3 40032 AEV_3_3_RA3_01_1233.d 0 1 1 119 128 Deamidation (NQ); Sodium adduct
K.TTAKSSPKKAGAT(+79.97)K(+14.02).K Y 16.52 1468.7650 14 30.0 368.2095 4 64.77 3 36094 AEV_3_3_RA3_01_1233.d 0 1 1 174 187 Phosphorylation (STY); Methylation(KR)
K.S(+114.04)GVEK.G Y 16.43 632.3129 5 1.7 633.3213 1 28.10 3 12318 AEV_3_3_RA3_01_1233.d 0 1 1 70 74 Ubiquitin
K.KAAGS(+79.97)KPSGTATHAS(+79.97)Y(+79.97)RDMIK.D Y 16.39 2416.0049 21 17.1 484.2165 5 72.10 1 35583 AEV 2_3_RA2_01_1224.d 0 1 1 5 25 Phosphorylation (STY)
K.ANVAK(+226.08)PR.K Y 16.36 980.5225 7 -26.0 981.5043 1 89.99 2 47227 AEV_1_3_RA2_01_1232.d 5.4E3 1 1 142 148 Biotinylation
K.KEATKPAAKPAAK(-.98).K Y 16.25 1308.7877 13 3.2 328.2053 4 37.83 2 14442 AEV_1_3_RA2_01_1232.d 0 1 1 92 104 Amidation
K.KAAKPAATKK.A Y 16.03 1012.6393 10 -121.0 1013.5240 1 107.70 1 58094 AEV 2_3_RA2_01_1224.d 0 1 1 105 114
K.SSPK(+42.01)KAGAT(+79.97)K(+14.02).K Y 15.75 1109.5481 10 1.5 370.8572 3 20.41 2 6582 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 178 187 Acetylation (K); Phosphorylation (STY); Methylation(KR)
K.TTAKSS(+79.97)PKK.A Y 15.75 1026.5110 9 1.3 514.2634 2 36.62 3 17344 AEV_3_3_RA3_01_1233.d 0 1 1 174 182 Phosphorylation (STY)
K.AATTKK(+114.04).A Y 15.69 732.4130 6 5.6 733.4244 1 82.46 2 42469 AEV_1_3_RA2_01_1232.d 3.81E4 1 1 124 129 Ubiquitin
K.AAGSKPSGTAT(-18.01)HASYR.D Y 15.57 1542.7539 16 9.2 772.3913 2 84.24 2 43785 AEV_1_3_RA2_01_1232.d 1.08E5 1 1 6 21 Dehydration
K.GPS(+79.96)GPLK.L Y 15.50 734.3268 7 21.2 368.1785 2 59.34 1 26011 AEV 2_3_RA2_01_1224.d 0 1 1 82 88 Sulfation
K.Y(+27.99)VHNNNK(+42.01).I Y 15.48 957.4304 7 -31.5 320.1407 3 28.21 1 8050 AEV 2_3_RA2_01_1224.d 5.07E5 1 1 45 51 Formylation; Acetylation (K)
K.AAGSKPSGTATHAS(+79.97)YRD(-18.01)MIK.D Y 15.19 2109.9666 20 30.3 423.0134 5 24.51 3 10290 AEV_3_3_RA3_01_1233.d 7.87E5 1 1 6 25 Phosphorylation (STY); Dehydration
K.SGVEKGEFTQ(+.98)PK.G Y 15.12 1306.6405 12 -87.5 436.5160 3 52.65 1 21740 AEV 2_3_RA2_01_1224.d 2.89E5 1 1 70 81 Deamidation (NQ)
total 78 peptides
C1G8H6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.LYGSGAGGAPGGDDDEPSGHDEL Y 125.57 2171.8879 23 4.5 1086.9562 2 65.93 2 29928 AEV_1_3_RA2_01_1232.d 5.72E5 2 2 655 677
K.TVTNAVVTVPAYFNDNQR.Q Y 119.02 2008.0013 18 1.6 670.3421 3 77.70 2 38726 AEV_1_3_RA2_01_1232.d 1.02E6 7 7 184 201
R.VVNEPTAAAIAYGLDKTGDER.Q Y 106.58 2189.0964 21 0.1 730.7062 3 74.58 2 36335 AEV_1_3_RA2_01_1232.d 4.71E5 3 3 218 238
R.VVNEPTAAAIAYGLDK.T Y 92.41 1630.8566 16 -2.4 816.4336 2 75.92 3 44854 AEV_3_3_RA3_01_1233.d 9.58E4 2 2 218 233
R.NTLENYAFSLK.N Y 89.98 1298.6506 11 -0.9 650.3320 2 76.59 3 45435 AEV_3_3_RA3_01_1233.d 4.55E5 3 3 583 593
R.ITPSYVAFTDDERLVGDAAK.N Y 87.12 2167.0796 20 0.8 723.3677 3 77.34 3 45975 AEV_3_3_RA3_01_1233.d 8.4E4 2 2 83 102
K.DNNLLGKFELTGIPPAPR.G N 86.63 1951.0526 18 5.1 651.3615 3 82.96 2 42847 AEV_1_3_RA2_01_1232.d 8.17E5 10 10 495 512
K.LSNVAYPITSK.L Y 85.92 1191.6499 11 -2.1 596.8310 2 61.29 3 33416 AEV_3_3_RA3_01_1233.d 7.11E5 3 3 644 654
K.VQALLEEFFGGKK.A Y 77.85 1464.7976 13 -0.8 489.2728 3 80.94 2 41332 AEV_1_3_RA2_01_1232.d 2.65E5 2 2 391 403
K.SQIFSTAADNQ(+.98)PVVLIQVYEGERPLTK.D Y 73.98 3003.5552 27 9.8 751.9034 4 83.74 2 43467 AEV_1_3_RA2_01_1232.d 6.71E4 1 1 468 494 Deamidation (NQ)
K.SQIFSTAADNQPVVLIQVYEGERPLTK.D Y 73.92 3002.5713 27 1.5 751.6512 4 83.57 3 50721 AEV_3_3_RA3_01_1233.d 5.84E4 1 1 468 494
K.NQYAANPQR.T Y 73.31 1060.5050 9 -83.8 531.2153 2 27.24 1 7604 AEV 2_3_RA2_01_1224.d 4.56E5 6 6 103 111
K.DAGTIAGLNVLR.V Y 71.56 1198.6670 12 -4.3 600.3382 2 77.50 3 46098 AEV_3_3_RA3_01_1233.d 4.27E5 5 5 206 217
K.VQALLEEFFGGK.K Y 69.90 1336.7026 12 5.0 669.3619 2 86.02 2 44988 AEV_1_3_RA2_01_1232.d 1.76E5 1 1 391 402
K.MKEVAENYLGK.T Y 66.96 1280.6434 11 -4.2 641.3263 2 51.21 3 26517 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 173 183
K.ATTEDFEEQKEK.L Y 66.67 1453.6572 12 7.1 485.5631 3 26.61 2 9206 AEV_1_3_RA2_01_1232.d 2.64E5 2 2 632 643
R.ITPSYVAFTDDER.L Y 58.16 1512.7096 13 -9.9 757.3546 2 71.99 2 34341 AEV_1_3_RA2_01_1232.d 7.26E4 1 1 83 95
K.LYGSGAGGAPGGDDDE(+14.02)PSGHDEL Y 57.61 2185.9036 23 0.2 1093.9592 2 68.09 3 38724 AEV_3_3_RA3_01_1233.d 1.8E5 2 2 655 677 Methylation(others)
K.DKTFTPEEVSAMILGK.M Y 56.89 1764.8967 16 8.7 589.3113 3 83.34 3 50559 AEV_3_3_RA3_01_1233.d 3.32E4 1 1 157 172
R.QATKDAGTIAGLNVLR.V Y 54.16 1626.9053 16 -6.0 543.3058 3 68.72 3 39232 AEV_3_3_RA3_01_1233.d 7.92E4 2 2 202 217
R.IPKVQALLEEFFGGKK.A Y 48.94 1803.0294 16 -4.8 451.7625 4 86.73 2 45451 AEV_1_3_RA2_01_1232.d 1.08E5 2 2 388 403
K.LS(-2.02)NVAYPITSK.L Y 42.78 1189.6343 11 -9.4 595.8188 2 61.22 3 33362 AEV_3_3_RA3_01_1233.d 0 1 1 644 654 2-amino-3-oxo-butanoic_acid
R.VINHFVK.Q Y 38.44 855.4966 7 0.0 428.7556 2 29.67 3 13196 AEV_3_3_RA3_01_1233.d 7.13E4 1 1 282 288
R.LSQEEIDR(+14.02).M Y 37.95 1002.4982 8 -50.2 502.2312 2 38.93 1 13823 AEV 2_3_RA2_01_1224.d 8E5 4 4 553 560 Methylation(KR)
K.VTAGD(-18.01)K.G Y 34.16 571.2966 6 4.0 572.3062 1 73.44 3 42932 AEV_3_3_RA3_01_1233.d 0 2 2 531 536 Dehydration
K.VTAGDK.G Y 31.11 589.3071 6 -31.3 590.2960 1 62.79 3 34570 AEV_3_3_RA3_01_1233.d 4.02E3 2 2 531 536
R.NTVIPTRK.S Y 30.42 927.5502 8 -0.6 464.7821 2 21.14 3 8453 AEV_3_3_RA3_01_1233.d 4.79E4 2 2 460 467
R.VVNKDGKPQVK.V Y 29.80 1210.7034 11 -8.4 606.3539 2 12.01 3 3502 AEV_3_3_RA3_01_1233.d 7.02E3 1 1 140 150
R.LVGDAAK.N Y 29.59 672.3806 7 -24.8 673.3712 1 99.26 1 55424 AEV 2_3_RA2_01_1224.d 0 1 1 96 102
K.V(+42.01)EIFVNDQ(+.98)GNR.I Y 28.15 1332.6310 11 -69.8 667.2762 2 85.95 1 46525 AEV 2_3_RA2_01_1224.d 0 1 1 72 82 Acetylation (N-term); Deamidation (NQ)
R.NTVIPTR.K Y 26.69 799.4552 7 -90.3 800.3903 1 47.74 1 18937 AEV 2_3_RA2_01_1224.d 2.69E4 1 1 460 466
R.AKFEELNMDLFKK.T Y 24.74 1611.8330 13 16.8 538.2939 3 74.22 2 36044 AEV_1_3_RA2_01_1232.d 1.03E5 1 1 345 357
K.TGD(+43.99)ER.Q Y 24.51 620.2402 5 -4.7 621.2445 1 35.76 1 12068 AEV 2_3_RA2_01_1224.d 2.61E4 1 1 234 238 Carboxylation (DKW)
R.VVNEPTAAAIAYGLDK(+14.02)TGDER.Q Y 24.18 2203.1121 21 -1.7 735.3767 3 75.33 3 44388 AEV_3_3_RA3_01_1233.d 0 1 1 218 238 Methylation(KR)
K.VTAGDK(+27.99).G Y 23.57 617.3021 6 -64.7 618.2694 1 72.87 1 36192 AEV 2_3_RA2_01_1224.d 0 1 1 531 536 Formylation
K.NQYAANP(+13.98)QR.T Y 23.48 1074.4843 9 -48.6 538.2233 2 35.63 1 12007 AEV 2_3_RA2_01_1224.d 5.51E4 1 1 103 111 Proline oxidation to pyroglutamic acid
K.VT(+42.01)AGDK.G Y 23.41 631.3177 6 1.9 632.3262 1 81.89 2 42042 AEV_1_3_RA2_01_1232.d 0 1 1 531 536 Acetylation (TSCYH)
K.NQVQDEEGLGGK.I Y 22.97 1272.5946 12 -71.8 637.2589 2 58.49 1 25431 AEV 2_3_RA2_01_1224.d 1.43E5 2 2 594 605
R.L(+27.99)VGDAAK(+42.01).N Y 22.94 742.3861 7 -17.4 743.3804 1 112.54 3 62684 AEV_3_3_RA3_01_1233.d 0 1 1 96 102 Formylation; Acetylation (K)
K.GTGKAESITITNDK.G Y 22.65 1433.7362 14 4.2 478.9214 3 48.79 2 19840 AEV_1_3_RA2_01_1232.d 0 1 1 537 550
K.VEVNGK(-.98).D Y 22.60 643.3653 6 -52.6 644.3387 1 35.03 3 16352 AEV_3_3_RA3_01_1233.d 0 1 1 151 156 Amidation
R.NTLENYAF(+31.99)SLK.N Y 22.55 1330.6405 11 -37.3 666.3027 2 71.19 1 34868 AEV 2_3_RA2_01_1224.d 3.4E4 1 1 583 593 Dihydroxy
K.FELTGIPPAPR.G N 22.47 1196.6553 11 -21.4 599.3221 2 75.70 2 37221 AEV_1_3_RA2_01_1232.d 2.16E4 3 3 502 512
K.F(+42.01)ELT(-18.01)GIPPAPR.G N 21.80 1220.6553 11 1.7 611.3359 2 39.68 2 15317 AEV_1_3_RA2_01_1232.d 0 1 1 502 512 Acetylation (N-term); Dehydration
K.VEIFVN(+.98)DQGNR(-.98).I Y 21.62 1289.6364 11 -45.0 323.4019 4 66.94 1 31598 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 72 82 Deamidation (NQ); Amidation
K.DAGTIAGLN(+203.08)VLR.V Y 21.61 1401.7463 12 39.6 701.9082 2 56.11 3 29609 AEV_3_3_RA3_01_1233.d 2.87E4 1 1 206 217 HexNAcylation (N)
K.VTAGDK(+14.02)GTGK(+14.02).A Y 21.23 960.5240 10 -24.7 481.2574 2 60.57 2 26256 AEV_1_3_RA2_01_1232.d 0 1 1 531 540 Methylation(KR)
K.AESIT(-18.01)ITNDK(+42.01).G Y 21.12 1114.5507 10 16.4 372.5302 3 19.68 3 7668 AEV_3_3_RA3_01_1233.d 2.31E5 1 1 541 550 Dehydration; Acetylation (K)
K.M(+15.99)KEVAENYLGK.T Y 20.91 1296.6383 11 -85.7 433.1830 3 58.48 1 25420 AEV 2_3_RA2_01_1224.d 2.63E5 1 1 173 183 Oxidation (M)
K.V(+42.01)QALLEEFFGGK(+14.02).K Y 20.50 1392.7289 12 -18.1 465.2418 3 60.13 2 25967 AEV_1_3_RA2_01_1232.d 8.54E4 1 1 391 402 Acetylation (N-term); Methylation(KR)
R.Q(+.98)ATKDAGT(+79.97)IAGLN(+.98)VLR.V Y 20.49 1708.8396 16 5.2 428.2194 4 48.96 2 19926 AEV_1_3_RA2_01_1232.d 0 1 1 202 217 Deamidation (NQ); Phosphorylation (STY)
K.VTAGDK(+31.99).G Y 20.39 621.2969 6 23.9 622.3191 1 76.37 3 45201 AEV_3_3_RA3_01_1233.d 4.87E3 1 1 531 536 Dihydroxy
K.V(+27.99)TAGDK.G Y 20.30 617.3021 6 23.2 618.3237 1 79.69 2 40320 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 531 536 Formylation
K.RTLSSQM(+15.99)STRIEIEAFHDGK.D Y 20.27 2321.1433 20 26.4 465.2482 5 61.89 2 27116 AEV_1_3_RA2_01_1232.d 6.09E4 1 1 317 336 Oxidation (M)
K.TVTNAVVTVPAYFNDN(+.98)QR(+14.02)QATK.D Y 19.99 2451.2393 22 -8.7 491.2509 5 63.55 2 28260 AEV_1_3_RA2_01_1232.d 0 1 1 184 205 Deamidation (NQ); Methylation(KR)
R.LSQEEIDR(+21.98).M Y 19.35 1010.4645 8 -32.2 337.8179 3 38.99 1 13822 AEV 2_3_RA2_01_1224.d 6.05E5 1 1 553 560 Sodium adduct
K.ETILEAVK.E Y 19.16 901.5120 8 14.0 301.5155 3 33.37 2 12316 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 612 619
K.VTAGDK(+42.01).G Y 19.15 631.3177 6 -2.9 632.3231 1 79.79 3 47909 AEV_3_3_RA3_01_1233.d 4.2E4 1 1 531 536 Acetylation (K)
K.SEIHDIVLVGGSTR.I Y 19.03 1481.7838 14 -63.0 494.9041 3 75.18 1 38022 AEV 2_3_RA2_01_1224.d 0 1 1 374 387
K.ATTEDFEEQK(+14.02)EK.L Y 18.84 1467.6729 12 -0.3 734.8434 2 34.17 3 15813 AEV_3_3_RA3_01_1233.d 7.94E4 1 1 632 643 Methylation(KR)
K.VTAGDKGTGKAESITITNDKGR.L Y 18.75 2218.1553 22 1.5 444.6390 5 38.35 2 14684 AEV_1_3_RA2_01_1232.d 3.62E4 1 1 531 552
K.VEVN(+.98)GK(+14.02).D Y 18.55 659.3490 6 -80.4 660.3033 1 94.04 1 52502 AEV 2_3_RA2_01_1224.d 0 1 1 151 156 Deamidation (NQ); Methylation(KR)
R.MVAEAAEFAEEDK.A Y 18.30 1438.6285 13 -29.5 720.3003 2 48.31 1 19252 AEV 2_3_RA2_01_1224.d 3.45E4 1 1 561 573
R.QAT(+79.97)KDAGT(+79.97)IAGLNVLR.V Y 18.22 1786.8379 16 30.1 447.7302 4 64.69 3 36034 AEV_3_3_RA3_01_1233.d 1.64E5 1 1 202 217 Phosphorylation (STY)
K.FDDQ(+.98)DAQ(+.98)KDIK(+14.02)HFPFR.V Y 18.16 2021.9482 16 -9.8 674.9834 3 86.10 1 46644 AEV 2_3_RA2_01_1224.d 0 1 1 124 139 Deamidation (NQ); Methylation(KR)
R.Q(+43.01)ATKDAGTIAGLN(+.98)VLR.V Y 18.03 1670.8951 16 22.3 418.7404 4 56.66 3 29974 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 202 217 Carbamylation; Deamidation (NQ)
R.LSQEEIDR.M Y 17.89 988.4825 8 24.5 495.2607 2 32.35 3 14782 AEV_3_3_RA3_01_1233.d 4.42E4 1 1 553 560
R.KFDDQDAQKDIK.H Y 17.61 1449.7100 12 -80.1 484.2052 3 47.48 1 18779 AEV 2_3_RA2_01_1224.d 1.53E5 1 1 123 134
K.VT(+60.00)AGDK.G Y 17.50 649.3105 6 -70.7 650.2719 1 55.39 1 23409 AEV 2_3_RA2_01_1224.d 3.5E4 1 1 531 536 2-OH-ethyl thio-Ser
K.GTGKAESITITNDKGR(+14.02).L Y 17.50 1660.8744 16 3.7 416.2274 4 47.42 3 24075 AEV_3_3_RA3_01_1233.d 0 1 1 537 552 Methylation(KR)
R.LSQEEIDR(+28.03).M Y 17.35 1016.5138 8 10.8 509.2697 2 32.41 2 11837 AEV_1_3_RA2_01_1232.d 0 1 1 553 560 Dimethylation(KR)
K.EKLSNVAYPITSK(+31.99).L Y 16.93 1480.7772 13 -0.7 371.2013 4 40.97 2 15925 AEV_1_3_RA2_01_1232.d 0 1 1 642 654 Dihydroxy
R.VVNEPT(-18.01)AAAIAYGLDK.T Y 16.90 1612.8461 16 8.7 404.2223 4 63.23 2 28030 AEV_1_3_RA2_01_1232.d 0 1 1 218 233 Dehydration
K.V(+27.99)EVNGK.D Y 16.61 672.3442 6 25.9 673.3690 1 47.17 3 23916 AEV_3_3_RA3_01_1233.d 0 1 1 151 156 Formylation
K.ETTDWLEENAAK(+226.08).A Y 16.59 1631.7137 12 -21.2 544.9003 3 97.27 1 54545 AEV 2_3_RA2_01_1224.d 4.66E4 1 1 620 631 Biotinylation
K.T(+79.96)LRPVEQVLK(+14.02).D Y 16.58 1275.6857 10 -22.7 426.2262 3 52.24 3 27210 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 358 367 Sulfation; Methylation(KR)
K.DNNLLGK.F N 16.51 772.4079 7 -126.0 773.3179 1 103.58 1 56876 AEV 2_3_RA2_01_1224.d 0 1 1 495 501
R.V(+27.99)VNKDGKPQVK(+42.01).V Y 16.49 1280.7089 11 -4.8 641.3586 2 71.28 2 33835 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 140 150 Formylation; Acetylation (K)
K.RT(+79.97)LSSQ(+.98)MS(+79.97)TR.I Y 16.39 1326.5040 10 56.6 332.6520 4 55.84 1 23718 AEV 2_3_RA2_01_1224.d 3.9E4 1 1 317 326 Phosphorylation (STY); Deamidation (NQ)
K.NQYAANPQ(+.98)R(+14.02).T Y 16.07 1075.5046 9 17.6 538.7690 2 55.76 2 23454 AEV_1_3_RA2_01_1232.d 0 1 1 103 111 Deamidation (NQ); Methylation(KR)
K.V(+43.01)EIFVNDQGNR.I Y 15.89 1332.6422 11 39.9 334.1811 4 17.16 2 5226 AEV_1_3_RA2_01_1232.d 0 1 1 72 82 Carbamylation
K.HN(+162.05)VDITK.D Y 15.89 987.4872 7 -111.0 988.3849 1 97.76 1 54844 AEV 2_3_RA2_01_1224.d 8.11E3 1 1 294 300 Hexose (NSY)
K.TMGKLK(+21.98).R Y 15.80 698.3761 6 -7.1 350.1928 2 10.38 2 2619 AEV_1_3_RA2_01_1232.d 0 1 1 304 309 Sodium adduct
K.ATTEDFEEQK(+43.99).E Y 15.76 1240.5095 10 -46.2 621.2334 2 42.67 1 15960 AEV 2_3_RA2_01_1224.d 0 1 1 632 641 Carboxylation (DKW)
K.DGKPQVK(+28.03)VEVNGK(+42.01).D Y 15.70 1466.8092 13 8.0 489.9476 3 80.86 2 41240 AEV_1_3_RA2_01_1232.d 3.75E4 1 1 144 156 Dimethylation(KR); Acetylation (K)
R.IEIEAFHDGK(+71.04).D Y 15.60 1228.6088 10 -33.5 410.5298 3 60.83 1 27094 AEV 2_3_RA2_01_1224.d 2.31E5 1 1 327 336 Propionamide (K, X@N-term)
R.L(+42.01)VGDAAK(+14.02)NQYAANPQR.T Y 15.55 1770.9012 16 18.5 355.1941 5 44.04 3 21953 AEV_3_3_RA3_01_1233.d 5.27E4 1 1 96 111 Acetylation (N-term); Methylation(KR)
R.MVAEAAE(+43.99)FAEEDK.A Y 15.53 1482.6184 13 18.1 742.3299 2 94.66 1 52922 AEV 2_3_RA2_01_1224.d 8.49E4 1 1 561 573 Carboxylation (E)
K.NQ(+.98)YAANPQ(+.98)R.T Y 15.51 1062.4730 9 -15.3 355.1595 3 63.47 1 29147 AEV 2_3_RA2_01_1224.d 0 1 1 103 111 Deamidation (NQ)
R.LVGD(+43.99)AAKNQYAANPQR.T Y 15.48 1758.8649 16 -39.4 440.7062 4 72.76 1 36102 AEV 2_3_RA2_01_1224.d 0 1 1 96 111 Carboxylation (DKW)
R.MVAEAAEFAEEDKAMK(+164.06).A Y 15.32 1932.8613 16 67.4 484.2552 4 57.11 1 24490 AEV 2_3_RA2_01_1224.d 0 1 1 561 576 O-Diisopropylphosphorylation
K.L(+42.01)SN(+.98)VAYPITS(+79.97)K.L Y 15.28 1314.6108 11 -2.9 658.3108 2 58.48 3 31287 AEV_3_3_RA3_01_1233.d 0 1 1 644 654 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
K.TLRPVEQVLKDAK.V Y 15.24 1495.8722 13 -44.2 374.9588 4 62.93 3 34681 AEV_3_3_RA3_01_1233.d 0 1 1 358 370
total 93 peptides
C1FZT8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.IGINYQKPMRVPGGELAPVDR.S Y 134.73 2309.2314 21 -0.9 578.3146 4 72.02 2 34363 AEV_1_3_RA2_01_1232.d 1.17E5 2 2 354 374
R.IHYPLISYAPVVSSNR.S Y 115.23 1814.9679 16 11.5 606.0035 3 76.85 2 38056 AEV_1_3_RA2_01_1232.d 1.94E6 9 9 266 281
R.LNPEATDIGEAGSFETFFTETGSGK.Y Y 114.99 2604.1868 25 2.5 1303.1039 2 85.65 3 52132 AEV_3_3_RA3_01_1233.d 1.03E5 2 2 37 61
R.DC(+57.02)NAAVASLK.A Y 94.79 1047.5018 10 3.5 524.7600 2 45.97 2 18441 AEV_1_3_RA2_01_1232.d 1.75E6 8 8 328 337 Carbamidomethylation
R.LNPEATDIGEAGSFETFFTETGSGKYVPR.S Y 93.52 3119.4722 29 -1.9 1040.8293 3 84.44 3 51333 AEV_3_3_RA3_01_1233.d 1.24E5 1 1 37 65
R.SIFVDLDPSPIDEIR.T Y 92.10 1714.8777 15 -1.9 858.4445 2 85.47 2 44649 AEV_1_3_RA2_01_1232.d 4.93E5 3 3 66 80
R.VPGGELAPVDR.S Y 88.59 1108.5876 11 -5.2 555.2982 2 57.79 3 30832 AEV_3_3_RA3_01_1233.d 1.13E6 5 5 364 374
K.YMAVALLYR.G Y 85.72 1098.5896 9 3.0 550.3037 2 78.60 2 39446 AEV_1_3_RA2_01_1232.d 9.43E4 3 3 313 321
K.SKLEFAVYPAPR.V Y 74.53 1376.7451 12 -5.2 689.3762 2 68.11 3 38741 AEV_3_3_RA3_01_1233.d 2.1E6 7 7 166 177
R.SIFVDLDPSPIDEIRTGPYR.Q Y 73.59 2289.1641 20 -0.1 764.0619 3 83.64 3 50761 AEV_3_3_RA3_01_1233.d 3.31E5 2 2 66 85
R.GHYTIGKELVDSVIDR.I Y 73.21 1800.9370 16 1.9 451.2424 4 76.73 2 37966 AEV_1_3_RA2_01_1232.d 4.87E5 3 3 107 122
R.DC(+57.02)NAAVASLKAK.T Y 73.00 1246.6339 12 1.8 624.3254 2 38.93 3 18765 AEV_3_3_RA3_01_1233.d 1.1E5 3 3 328 339 Carbamidomethylation
R.Q(-17.03)LFHPEMLISGKEDAANNYAR.G Y 69.86 2386.1375 21 1.0 796.3872 3 80.13 3 48225 AEV_3_3_RA3_01_1233.d 1.24E5 2 2 86 106 Pyro-glu from Q
K.TSFNLVEWC(+57.02)PTGFK.I Y 63.47 1684.7919 14 21.6 843.4214 2 83.89 2 43537 AEV_1_3_RA2_01_1232.d 4.64E5 6 6 340 353 Carbamidomethylation
K.LEFAVYPAPR.V Y 55.11 1161.6182 10 2.3 581.8177 2 74.87 2 36523 AEV_1_3_RA2_01_1232.d 1.15E5 3 3 168 177
R.SSHESFKVHDLTFQC(+57.02)FEPNNQMVVC(+57.02)DPR.N Y 50.51 3407.5122 28 -1.6 682.5086 5 77.10 2 38257 AEV_1_3_RA2_01_1232.d 4.8E4 1 1 282 309 Carbamidomethylation
K.AKTSFNLVEWC(+57.02)PTGFK.I Y 49.55 1883.9240 16 16.9 628.9926 3 79.73 2 40346 AEV_1_3_RA2_01_1232.d 1.01E5 1 1 338 353 Carbamidomethylation
K.ELVDSVIDR.I Y 47.56 1044.5452 9 4.1 523.2820 2 67.49 2 31000 AEV_1_3_RA2_01_1232.d 1.35E5 2 2 114 122
R.GHYTIGKELVDSVIDRIR.R Y 46.55 2070.1221 18 2.8 415.0328 5 80.24 3 48256 AEV_3_3_RA3_01_1233.d 9.77E4 2 2 107 124
K.KSKLEFAVYPAPR.V Y 43.77 1504.8401 13 -2.1 377.2165 4 62.63 3 34452 AEV_3_3_RA3_01_1233.d 9.89E4 2 2 165 177
R.IHYPLISY(-2.02)APVVSSNR.S Y 43.73 1812.9523 16 -22.3 605.3112 3 76.94 2 38130 AEV_1_3_RA2_01_1232.d 7.22E4 1 1 266 281 2-amino-3-oxo-butanoic_acid
R.SVSMLSNTTAIAEAWSR.L Y 41.01 1822.8883 17 -2.3 912.4493 2 82.75 3 50132 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 375 391
K.ELVDSVIDRIR.R Y 40.15 1313.7302 11 -2.3 438.9164 3 76.40 2 37708 AEV_1_3_RA2_01_1232.d 9.99E4 1 1 114 124
R.NLDIPRPGYEHLNSLIAQVVSSITSSLR(-.98).F Y 36.05 3077.6621 28 6.1 770.4275 4 96.31 3 57773 AEV_3_3_RA3_01_1233.d 0 1 1 217 244 Amidation
K.TSFNLVE(+14.02)WC(+57.02)PTGFK.I Y 30.52 1698.8075 14 11.7 850.4210 2 84.81 3 51565 AEV_3_3_RA3_01_1233.d 2.25E4 1 1 340 353 Methylation(others); Carbamidomethylation
R.SVS(-18.01)M(+15.99)LSNTTAIAEAWSR.L Y 30.25 1820.8727 17 13.9 911.4562 2 82.83 2 42756 AEV_1_3_RA2_01_1232.d 9.86E4 1 1 375 391 Dehydration; Oxidation (M)
R.QLFHPEMLIS(-18.01)GK(+14.02)EDAANNYAR.G Y 29.77 2399.1692 21 11.1 600.8062 4 74.97 2 36594 AEV_1_3_RA2_01_1232.d 9.92E4 1 1 86 106 Dehydration; Methylation(KR)
R.FDGALNVDLNEFQTNLVPYPR.I Y 29.48 2421.1963 21 -86.2 808.0032 3 92.29 1 51266 AEV 2_3_RA2_01_1224.d 1.6E5 1 1 245 265
R.IHY(+162.05)PLISYAPVVSSNR.S Y 25.62 1977.0206 16 -2.6 495.2612 4 69.34 2 32354 AEV_1_3_RA2_01_1232.d 6.69E4 1 1 266 281 Hexose (NSY)
R.T(+71.04)GPYR.Q Y 23.13 663.3340 5 -6.7 664.3368 1 45.17 3 22659 AEV_3_3_RA3_01_1233.d 0 1 1 81 85 Propionamide (K, X@N-term)
R.DC(+57.02)N(+.98)AAVASLKAK.T Y 21.64 1247.6179 12 -1.1 624.8156 2 38.74 3 18662 AEV_3_3_RA3_01_1233.d 0 1 1 328 339 Carbamidomethylation; Deamidation (NQ)
K.IGIN(+.98)YQKPMR(+14.02).V Y 21.58 1233.6539 10 -44.7 309.4070 4 67.54 1 32058 AEV 2_3_RA2_01_1224.d 3.48E5 1 1 354 363 Deamidation (NQ); Methylation(KR)
K.YM(+15.99)AVALLYR.G Y 21.41 1114.5845 9 14.8 558.3077 2 72.42 3 42122 AEV_3_3_RA3_01_1233.d 0 1 1 313 321 Oxidation (M)
R.L(+42.01)STDYGK.K Y 20.93 824.3916 7 31.3 825.4247 1 95.38 2 49469 AEV_1_3_RA2_01_1232.d 0 1 1 158 164 Acetylation (N-term)
K.FDLMYSK(+28.03).R N 18.88 930.4521 7 52.1 311.1741 3 13.10 3 4088 AEV_3_3_RA3_01_1233.d 0 1 1 396 402 Dimethylation(KR)
K.SKLE(+21.98)FAVYPAPR.V Y 18.25 1398.7272 12 -12.8 467.2437 3 61.83 2 27081 AEV_1_3_RA2_01_1232.d 0 1 1 166 177 Sodium adduct
R.S(+42.01)VSMLSNTTAIAEAWS(+79.97)R.L Y 18.07 1944.8652 17 -30.2 649.2761 3 86.15 1 46681 AEV 2_3_RA2_01_1224.d 0 1 1 375 391 Acetylation (N-term); Phosphorylation (STY)
K.SKLEFAVY(+79.97)PAPR(+14.02).V Y 18.04 1470.7272 12 -121.2 368.6445 4 32.04 1 10104 AEV 2_3_RA2_01_1224.d 8.54E4 1 1 166 177 Phosphorylation (STY); Methylation(KR)
R.SVSMLSNTTAIAEAWSR(+14.02).L Y 17.87 1836.9039 17 33.2 460.2485 4 31.68 2 11496 AEV_1_3_RA2_01_1232.d 0 1 1 375 391 Methylation(KR)
R.I(+42.01)H(+15.99)YPLISYAPVVSSNR.S Y 17.77 1872.9734 16 -8.7 625.3263 3 80.24 2 40759 AEV_1_3_RA2_01_1232.d 0 1 1 266 281 Acetylation (N-term); Oxidation (HW)
R.LSTDYGKKSKL(+53.97)EFAVYPAPR.V Y 16.68 2323.1824 20 19.3 581.8141 4 74.25 3 43544 AEV_3_3_RA3_01_1233.d 5.23E4 1 1 158 177 Trifluoroleucine
R.G(+42.01)DVVPR.D Y 16.45 683.3602 6 22.6 684.3829 1 98.41 3 58520 AEV_3_3_RA3_01_1233.d 0 1 1 322 327 Acetylation (N-term)
R.LSTDYGKK.S Y 16.18 910.4760 8 -9.7 456.2408 2 39.24 2 15149 AEV_1_3_RA2_01_1232.d 0 1 1 158 165
R.EDLAALEK.D Y 16.01 887.4600 8 5.8 888.4724 1 95.45 2 49495 AEV_1_3_RA2_01_1232.d 1.94E4 1 1 424 431
K.E(+226.08)DAANNY(+79.97)AR.G Y 16.00 1328.4856 9 67.4 1329.5824 1 112.47 1 59476 AEV 2_3_RA2_01_1224.d 7.1E3 1 1 98 106 Biotinylation; Phosphorylation (STY)
R.G(+127.06)DVVPR.D Y 15.77 768.4130 6 -43.5 769.3868 1 80.23 3 48245 AEV_3_3_RA3_01_1233.d 3.73E4 1 1 322 327 N-Succinimidyl-2-morpholine acetate
R.G(+43.01)DVVPR.D Y 15.75 684.3555 6 -43.3 685.3331 1 51.10 1 20826 AEV 2_3_RA2_01_1224.d 4.13E4 1 1 322 327 Carbamylation
total 47 peptides
A0A0A0HWS3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.SNAIILAVTAANQDLANSDGLK.L Y 131.69 2198.1543 22 3.5 733.7279 3 86.36 2 45215 AEV_1_3_RA2_01_1232.d 3.36E5 3 3 199 220
R.IYSPNVLTLTLVDLPGLTK.V Y 124.03 2056.1819 19 -1.0 1029.0972 2 92.56 2 48407 AEV_1_3_RA2_01_1232.d 5.31E5 5 5 156 174
R.NAGISPVPINLR.I Y 105.19 1249.7142 12 1.3 625.8652 2 74.02 2 35891 AEV_1_3_RA2_01_1232.d 5.47E5 3 3 144 155
R.TVLDGNNQELSSVELSGGAR.I Y 98.29 2045.0024 20 -0.4 1023.5081 2 73.59 3 43040 AEV_3_3_RA3_01_1233.d 1.35E5 2 2 371 390
K.M(+15.99)AAM(+15.99)EPPPPTLK.A Y 95.41 1313.6359 12 1.9 657.8265 2 48.95 3 25048 AEV_3_3_RA3_01_1233.d 8.85E4 1 1 591 602 Oxidation (M)
K.TGKPLPPSAVPPR.S Y 89.66 1315.7611 13 1.4 439.5949 3 47.57 2 19227 AEV_1_3_RA2_01_1232.d 1.2E6 7 7 550 562
R.LGYVPVVNR.G Y 89.30 1015.5814 9 4.5 508.8003 2 65.79 2 29801 AEV_1_3_RA2_01_1232.d 5.23E5 3 3 261 269
K.SSVLENIVGRDFLPR.G N 83.90 1700.9209 15 3.5 567.9829 3 82.45 3 49920 AEV_3_3_RA3_01_1233.d 6.06E5 3 3 53 67
K.AVDPFDQVKDIDIR.T Y 83.87 1629.8362 14 2.1 544.2872 3 77.39 3 46014 AEV_3_3_RA3_01_1233.d 4.34E5 2 2 405 418
K.VDLMDTGTDVVDILAGR.I Y 83.62 1788.8927 17 1.1 895.4547 2 90.27 3 54856 AEV_3_3_RA3_01_1233.d 3.67E5 3 3 239 255
K.LLINSYYNIVKR.T Y 67.97 1494.8558 12 -1.1 499.2920 3 74.96 3 44087 AEV_3_3_RA3_01_1233.d 3.29E4 1 1 620 631
R.TIGVLTK(+188.03)VDLMDTGTDVVDILAGR.I Y 63.20 2689.3740 24 -16.8 897.4502 3 90.20 3 54809 AEV_3_3_RA3_01_1233.d 3.11E4 1 1 232 255 Lipoyl
K.M(+15.99)AAMEPPPPTLK.A Y 52.04 1297.6410 12 -0.7 649.8273 2 61.68 2 26974 AEV_1_3_RA2_01_1232.d 4E4 1 1 591 602 Oxidation (M)
R.EVDPEGQR.T Y 51.79 928.4250 8 -76.4 465.1843 2 24.86 1 6487 AEV 2_3_RA2_01_1224.d 2.73E5 6 6 224 231
K.SSYC(+57.02)GTPYLAR.K Y 51.60 1273.5760 11 1.5 637.7963 2 59.38 3 31946 AEV_3_3_RA3_01_1233.d 3.09E5 3 3 301 311 Carbamidomethylation
K.SSVLENIVGR.D N 48.60 1072.5876 10 1.2 537.3018 2 72.70 2 34890 AEV_1_3_RA2_01_1232.d 2.3E5 3 3 53 62
K.LQDVFTTVGVQNPIDLPQIVVVGSQSSGK.S Y 46.85 3024.6130 29 2.7 1009.2144 3 89.88 3 54649 AEV_3_3_RA3_01_1233.d 2.56E4 1 1 24 52
K.AVDPFDQ(+.98)VKDIDIR.T Y 42.98 1630.8202 14 15.4 544.6224 3 77.79 2 38803 AEV_1_3_RA2_01_1232.d 6.61E4 1 1 405 418 Deamidation (NQ)
K.AVDPFDQVK.D Y 33.88 1017.5131 9 -87.4 509.7194 2 71.03 1 34740 AEV 2_3_RA2_01_1224.d 6.88E4 1 1 405 413
K.A(+42.01)VMLNLVQHTK(+28.03).D Y 32.75 1322.7380 11 21.3 331.6988 4 12.16 2 3284 AEV_1_3_RA2_01_1232.d 0 1 1 640 650 Acetylation (N-term); Dimethylation(KR)
R.IIPLR.L Y 31.89 610.4166 5 -4.5 306.2142 2 47.91 2 19394 AEV_1_3_RA2_01_1232.d 1.6E5 3 3 256 260
R.HAASRPTQVDPK.T Y 31.50 1305.6790 12 5.8 436.2361 3 15.40 2 4497 AEV_1_3_RA2_01_1232.d 3.72E5 3 3 538 549
K.SNAIILAVTAANQDLANSDGLK(-.98).L Y 30.67 2197.1702 22 -14.3 733.3868 3 86.16 3 52484 AEV_3_3_RA3_01_1233.d 4.54E4 1 1 199 220 Amidation
K.AVM(+15.99)LNLVQHTK.D Y 27.95 1268.6910 11 8.9 318.1829 4 44.64 2 17761 AEV_1_3_RA2_01_1232.d 2.22E4 1 1 640 650 Oxidation (M)
R.RPLVLQLINRPSLVKPQANGVK.E Y 26.34 2439.4802 22 21.3 488.9137 5 73.97 3 43333 AEV_3_3_RA3_01_1233.d 0 1 1 75 96
R.DIE(+14.02)NK.R Y 24.82 631.3177 5 7.7 632.3298 1 72.36 2 34624 AEV_1_3_RA2_01_1232.d 1.91E4 1 1 273 277 Methylation(others)
R.ELLAQM(+15.99)YR.S Y 24.42 1038.5168 8 0.6 520.2660 2 56.20 3 29668 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 656 663 Oxidation (M)
R.IASS(+79.97)LQK.Y Y 23.20 825.3997 7 25.6 826.4281 1 96.93 2 49980 AEV_1_3_RA2_01_1232.d 6.19E4 1 1 332 338 Phosphorylation (STY)
K.AVMLNLVQHTK.D Y 22.26 1252.6962 11 22.4 314.1883 4 13.28 2 3701 AEV_1_3_RA2_01_1232.d 0 2 2 640 650
K.LAREVD(+15.99)PEGQR.T Y 21.83 1284.6422 11 -6.8 429.2184 3 9.14 2 2194 AEV_1_3_RA2_01_1232.d 2.27E4 1 1 221 231 Oxidation or Hydroxylation
K.LAREVDPEGQRT(+79.97)IGVLT(+79.97)K.V Y 21.55 2141.0283 18 3.7 536.2664 4 78.78 2 39587 AEV_1_3_RA2_01_1232.d 3.55E5 1 1 221 238 Phosphorylation (STY)
K.MAAM(+15.99)EPPPPTLKASGTLSER.E Y 21.25 2099.0391 20 -27.0 420.8038 5 119.83 1 61245 AEV 2_3_RA2_01_1224.d 0 1 1 591 610 Oxidation (M)
R.TIGVLTK(-1.03)VDLMDTGTDVVDILAGR.I Y 21.15 2500.3093 24 17.4 834.4583 3 90.83 2 47636 AEV_1_3_RA2_01_1232.d 0 1 1 232 255 Lysine oxidation to aminoadipic semialdehyde
K.EEKLETTDK(+14.02).E Y 21.11 1105.5503 9 -3.2 553.7806 2 54.78 3 28851 AEV_3_3_RA3_01_1233.d 2.43E5 1 1 97 105 Methylation(KR)
R.G(+43.01)QRDIENKRPISYALEHEK.N Y 20.95 2325.1824 19 14.2 776.0791 3 79.50 3 47686 AEV_3_3_RA3_01_1233.d 0 1 1 270 288 Carbamylation
K.A(+42.01)SGTLSERENSEVEVIK.L Y 20.87 1888.9377 17 5.3 473.2442 4 35.98 3 16918 AEV_3_3_RA3_01_1233.d 3.33E4 1 1 603 619 Acetylation (N-term)
R.D(-18.01)FLPRGSGIVTR.R N 20.59 1298.7095 12 0.6 325.6848 4 43.16 3 21393 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 63 74 Dehydration
K.TGK(-1.03)PLPPSAVPPR.S Y 20.47 1314.7295 13 -47.9 439.2294 3 46.27 2 18572 AEV_1_3_RA2_01_1232.d 2.24E5 1 1 550 562 Lysine oxidation to aminoadipic semialdehyde
R.T(+79.97)MIDMVPK.A Y 20.34 1013.4327 8 -55.1 507.6957 2 30.55 1 9260 AEV 2_3_RA2_01_1224.d 0 1 1 632 639 Phosphorylation (STY)
R.GSGIVTR.R N 19.89 688.3868 7 -34.8 345.1887 2 32.22 3 14703 AEV_3_3_RA3_01_1233.d 1.97E5 2 2 68 74
K.LETTDK.E Y 19.38 705.3545 6 9.1 706.3682 1 74.09 2 35947 AEV_1_3_RA2_01_1232.d 5.57E4 1 1 100 105
K.TGKP(+31.99)LPPS(+79.97)AVPPR.S Y 19.38 1427.7173 13 -7.0 714.8609 2 75.25 3 44323 AEV_3_3_RA3_01_1233.d 9.35E4 1 1 550 562 Dihydroxy; Phosphorylation (STY)
R.ASEIVSQVQ Y 19.29 959.4924 9 39.0 480.7722 2 36.78 3 17444 AEV_3_3_RA3_01_1233.d 5.2E4 1 1 694 702
R.HAASR(+14.02)PT(+79.97)QVDPK.T Y 19.24 1399.6609 12 79.0 350.9501 4 26.06 2 8972 AEV_1_3_RA2_01_1232.d 1.65E5 1 1 538 549 Methylation(KR); Phosphorylation (STY)
K.VPVGDQPK.D Y 19.09 838.4548 8 26.2 420.2457 2 19.39 2 6150 AEV_1_3_RA2_01_1232.d 0 1 1 175 182
K.SNAIILAVTAANQDLANS(+79.97)D(-18.01)GLK.L Y 19.07 2260.1101 22 -68.5 565.9961 4 79.96 1 41815 AEV 2_3_RA2_01_1224.d 3.88E5 1 1 199 220 Phosphorylation (STY); Dehydration
K.QAMDPTN(+.98)K.L Y 19.01 904.3960 8 -23.3 453.1947 2 25.64 1 6828 AEV 2_3_RA2_01_1224.d 8.57E4 2 2 497 504 Deamidation (NQ)
K.QTLPDIK.A Y 18.84 813.4596 7 5.3 814.4712 1 99.64 3 58966 AEV_3_3_RA3_01_1233.d 0 1 1 323 329
K.QT(-18.01)LPDIK.A Y 18.71 795.4490 7 -54.3 796.4131 1 91.99 2 48166 AEV_1_3_RA2_01_1232.d 5.14E4 1 1 323 329 Dehydration
R.TIGVLT(+79.97)K(+14.02).V Y 18.62 824.4409 7 -42.4 825.4131 1 91.80 3 55700 AEV_3_3_RA3_01_1233.d 0 1 1 232 238 Phosphorylation (STY); Methylation(KR)
K.VDLMDTGTDVVD(+14.02)ILAGR.I Y 18.58 1802.9084 17 10.1 451.7390 4 47.40 2 19145 AEV_1_3_RA2_01_1232.d 0 1 1 239 255 Methylation(others)
R.ELLAQMYRSEEFDDLLR.E Y 18.37 2127.0305 17 -51.0 426.3917 5 107.49 3 61291 AEV_3_3_RA3_01_1233.d 0 1 1 656 672
K.TGRNAGISPVPINLR.I Y 18.36 1563.8845 15 -20.7 313.7777 5 62.57 2 27584 AEV_1_3_RA2_01_1232.d 4.4E5 1 1 141 155
R.ELLAQMYR(-.98).S Y 18.29 1021.5378 8 13.2 341.5244 3 15.74 2 4638 AEV_1_3_RA2_01_1232.d 5.35E4 1 1 656 663 Amidation
R.KECQQM(+15.99)VESLTR.A Y 18.19 1466.6858 12 -51.5 367.6599 4 51.68 1 21153 AEV 2_3_RA2_01_1224.d 1.36E5 1 1 682 693 Oxidation (M)
R.TMIDMVP(+31.99)K(+42.01).A Y 17.97 1007.4667 8 -43.8 1008.4299 1 93.96 1 52446 AEV 2_3_RA2_01_1224.d 1.4E5 2 2 632 639 Dihydroxy; Acetylation (K)
K.S(+42.01)SVLENIVGR(+14.02).D N 17.90 1128.6139 10 -14.4 565.3061 2 71.12 3 41104 AEV_3_3_RA3_01_1233.d 1.72E5 1 1 53 62 Acetylation (N-term); Methylation(KR)
K.ASGTLSER(-.98).E Y 17.76 818.4246 8 -89.3 410.1830 2 62.81 1 28640 AEV 2_3_RA2_01_1224.d 2.44E4 1 1 603 610 Amidation
R.KECQQMVESLTR(+14.02).A Y 17.58 1464.7064 12 -20.6 489.2327 3 45.62 2 18246 AEV_1_3_RA2_01_1232.d 0 1 1 682 693 Methylation(KR)
K.T(+79.97)GKPLPPSAVPPR.S Y 17.26 1395.7275 13 -3.9 466.2480 3 58.23 2 24774 AEV_1_3_RA2_01_1232.d 5.82E4 1 1 550 562 Phosphorylation (STY)
R.DFLPRGSGIVTR.R N 17.11 1316.7201 12 46.0 330.2025 4 56.98 2 24102 AEV_1_3_RA2_01_1232.d 3.65E4 1 1 63 74
K.LETTDK(+14.02).E Y 17.08 719.3701 6 -5.2 720.3737 1 75.18 3 44262 AEV_3_3_RA3_01_1233.d 3.18E4 1 1 100 105 Methylation(KR)
K.KMAAMEPPPPT(+79.97)LK(+14.02).A Y 17.05 1503.7230 13 46.5 502.2716 3 78.36 3 46785 AEV_3_3_RA3_01_1233.d 0 1 1 590 602 Phosphorylation (STY); Methylation(KR)
K.TGKPLP(+31.99)PSAVPPR(+14.02).S Y 16.92 1361.7666 13 -8.7 454.9255 3 69.75 2 32662 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 550 562 Dihydroxy; Methylation(KR)
K.RTMIDM(+15.99)VPK(+27.99).A Y 16.91 1133.5573 9 -105.4 378.8199 3 37.44 1 12962 AEV 2_3_RA2_01_1224.d 4.51E5 1 1 631 639 Oxidation (M); Formylation
R.E(+43.99)LLAQM(+15.99)YR.S Y 16.58 1082.5066 8 -4.6 542.2581 2 27.93 3 12205 AEV_3_3_RA3_01_1233.d 3.26E5 1 1 656 663 Carboxylation (E); Oxidation (M)
R.DIENK(+31.99).R Y 16.52 649.2919 5 17.4 650.3104 1 72.31 3 42037 AEV_3_3_RA3_01_1233.d 9.26E4 1 1 273 277 Dihydroxy
R.AMAIVNER(+14.02).H Y 16.32 916.4800 8 -9.5 459.2430 2 59.91 2 25823 AEV_1_3_RA2_01_1232.d 1.46E5 1 1 530 537 Methylation(KR)
K.Q(-17.03)TLPDIK.A Y 16.32 796.4330 7 -140.8 399.1677 2 55.52 1 23502 AEV 2_3_RA2_01_1224.d 0 1 1 323 329 Pyro-glu from Q
K.LLINSYYNIVK(+42.01).R Y 16.27 1380.7653 11 13.4 346.2032 4 56.29 3 29713 AEV_3_3_RA3_01_1233.d 0 1 1 620 630 Acetylation (K)
K.ASGTLSER(+39.99).E Y 16.15 859.4036 8 -62.2 430.6823 2 35.03 1 11696 AEV 2_3_RA2_01_1224.d 0 1 1 603 610 Glyoxal-derived hydroimiadazolone
R.E(+226.08)SEYT(+79.97)IR.R Y 16.09 1202.4679 7 -16.3 602.2314 2 44.89 1 17222 AEV 2_3_RA2_01_1224.d 2.58E5 1 1 673 679 Biotinylation; Phosphorylation (STY)
K.QTL(+53.97)PDIK.A Y 15.98 867.4313 7 -4.8 868.4344 1 95.58 2 49543 AEV_1_3_RA2_01_1232.d 2.79E5 1 1 323 329 Trifluoroleucine
R.G(+42.01)SGIVT(+79.97)R(+14.02).R N 15.86 824.3793 7 38.6 825.4185 1 89.97 3 54702 AEV_3_3_RA3_01_1233.d 8.65E4 1 1 68 74 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
K.T(+42.01)GKPLPPS(+79.97)AVPPR.S Y 15.86 1437.7380 13 36.0 360.4547 4 51.97 3 27037 AEV_3_3_RA3_01_1233.d 0 1 1 550 562 Acetylation (N-term); Phosphorylation (STY)
R.A(+42.01)MAIVNER.H Y 15.81 944.4749 8 -8.7 473.2406 2 32.80 2 12033 AEV_1_3_RA2_01_1232.d 7.8E3 1 1 530 537 Acetylation (N-term)
K.LAR(+31.99)EVDPEGQR(+14.02).T Y 15.76 1314.6527 11 -94.4 329.6394 4 63.46 1 29135 AEV 2_3_RA2_01_1224.d 1.03E5 1 1 221 231 Dihydroxy; Methylation(KR)
K.AVDPFDQVK(+42.01).D Y 15.63 1059.5237 9 -1.1 530.7686 2 19.88 3 7789 AEV_3_3_RA3_01_1233.d 3.41E4 1 1 405 413 Acetylation (K)
R.YPQLK.E Y 15.61 647.3643 5 44.0 324.7036 2 55.08 2 23050 AEV_1_3_RA2_01_1232.d 1.69E6 1 1 480 484
R.TM(+15.99)IDMVPKAVM(+15.99)LNLVQHTKDEM(+15.99)QRELLAQMYR.S Y 15.41 3879.9177 32 0.9 970.9875 4 3.32 1 782 AEV 2_3_RA2_01_1224.d 7.44E2 1 1 632 663 Oxidation (M)
R.ETEQK.T Y 15.11 633.2969 5 -102.1 634.2396 1 34.96 1 11672 AEV 2_3_RA2_01_1224.d 0 1 1 136 140
R.HAASRPTQVDPK(-.98).T Y 15.06 1304.6949 12 24.8 653.3709 2 14.03 3 4598 AEV_3_3_RA3_01_1233.d 6.05E3 1 1 538 549 Amidation
total 82 peptides
C1GJS2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.VETARPTEDAKPAETAAAPAPAPAPVEATAPAVVEKPAASALTTAATSTA Y 123.57 4737.4346 50 0.0 1185.3660 4 76.81 2 38054 AEV_1_3_RA2_01_1232.d 3.61E5 3 3 412 461
K.NPALSQFFEKLASILNK.T Y 107.94 1919.0516 17 2.3 640.6926 3 93.02 2 48601 AEV_1_3_RA2_01_1232.d 1.04E5 2 2 118 134
K.DEPAPAPAPAPAPAPETK.T Y 105.28 1725.8573 18 -2.8 863.9335 2 58.15 3 31053 AEV_3_3_RA3_01_1233.d 1.5E5 3 3 85 102
R.TVTLKEDTPAPTLAPPAAETNGTAAK.D Y 100.49 2564.3333 26 -1.9 855.7834 3 67.91 3 38583 AEV_3_3_RA3_01_1233.d 2.44E5 2 2 379 404
M.S(+42.01)EAEKPTQPVAAAAADAPVAAEATPEKPHEQQPADDKPSQNER.V Y 95.97 4518.1533 43 3.0 904.6407 5 63.94 3 35480 AEV_3_3_RA3_01_1233.d 2.16E5 1 1 2 44 Acetylation (Protein N-term)
K.DSDDVPTVNVLIK.F Y 93.57 1413.7351 13 -0.4 707.8746 2 77.96 3 46540 AEV_3_3_RA3_01_1233.d 5.41E5 4 4 147 159
R.ANEGNVKLAEEQLTK.A Y 91.66 1642.8525 15 0.5 548.6251 3 59.60 3 32114 AEV_3_3_RA3_01_1233.d 5.92E5 3 3 163 177
K.KDEPAPAPAPAPAPAPETK.T Y 88.14 1853.9523 19 6.1 618.9951 3 47.98 2 19432 AEV_1_3_RA2_01_1232.d 5.38E4 1 1 84 102
R.EFTFADELPKSYGGK.A Y 86.47 1687.8093 15 -0.8 563.6099 3 75.17 3 44251 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 355 369
K.NPALSQFFEK.L Y 78.13 1179.5924 10 -4.2 590.8010 2 75.32 3 44375 AEV_3_3_RA3_01_1233.d 4.85E5 2 2 118 127
R.TVTLKEDTPAPTLAPPAAETN(+.98)GTAAK.D Y 77.72 2565.3174 26 1.8 856.1146 3 69.41 2 32471 AEV_1_3_RA2_01_1232.d 5.36E5 3 3 379 404 Deamidation (NQ)
K.TPEAPIDNRPEYLSK.N Y 73.61 1728.8682 15 4.4 865.4452 2 61.16 3 33311 AEV_3_3_RA3_01_1233.d 1.49E6 4 4 103 117
K.TGHNEMWGVTLKDSDDVPTVNVLIK.F Y 72.31 2767.3850 25 11.0 692.8611 4 80.82 2 41213 AEV_1_3_RA2_01_1232.d 9.24E4 1 1 135 159
K.FQGLGYVANYKDPK.G Y 69.43 1598.8092 14 -13.8 533.9363 3 66.76 3 37677 AEV_3_3_RA3_01_1233.d 3.71E5 2 2 201 214
R.EFTFADELPK.S Y 68.95 1195.5760 10 -0.7 598.7949 2 77.94 3 46566 AEV_3_3_RA3_01_1233.d 1.13E6 4 4 355 364
K.LAEEQLTK.A Y 65.99 930.5022 8 -0.8 466.2580 2 34.92 3 16282 AEV_3_3_RA3_01_1233.d 1.04E6 6 6 170 177
K.SETPSTQTPAAAAPSVTPTAAAPAQSSGADAIEAQKKDEPAPAPAPAPAPAPETK.T Y 62.90 5215.5796 55 -2.8 1044.1202 5 70.05 2 32880 AEV_1_3_RA2_01_1232.d 3.47E5 2 2 48 102
K.Q(-17.03)TIEVFSTAYPELLKEK.F Y 62.33 1978.0299 17 -1.9 990.0204 2 85.42 3 51986 AEV_3_3_RA3_01_1233.d 2.35E5 3 3 299 315 Pyro-glu from Q
R.VALMELAVR.D Y 57.79 1000.5739 9 -1.0 501.2937 2 76.37 2 37680 AEV_1_3_RA2_01_1232.d 2.08E5 3 3 246 254
K.QTIEVFSTAYPELLK.E Y 57.79 1737.9188 15 -4.4 869.9629 2 83.34 3 50560 AEV_3_3_RA3_01_1233.d 2.04E4 1 1 299 313
R.TVTLKEDTPAPTLAPPAAETNGTAAKDATQTAK.V Y 56.79 3279.6833 33 -5.2 820.9238 4 66.55 3 37505 AEV_3_3_RA3_01_1233.d 4.12E4 1 1 379 411
R.EFTFADE(+14.02)LPK.S Y 53.15 1209.5917 10 7.8 605.8078 2 81.87 2 42057 AEV_1_3_RA2_01_1232.d 1.81E5 1 1 355 364 Methylation(others)
K.DATQTAKVETARPTEDAKPAETAAAPAPAPAPVEATAPAVVEKPAASALTTAATSTA Y 46.25 5452.7847 57 2.9 1091.5674 5 76.08 3 44980 AEV_3_3_RA3_01_1233.d 9.4E4 1 1 405 461
R.TVTLKEDTPAPTLAPPAAETN(+.98)GTAAKDATQTAK.V Y 45.13 3280.6675 33 -30.6 821.1490 4 68.27 2 31563 AEV_1_3_RA2_01_1232.d 0 1 1 379 411 Deamidation (NQ)
K.TPEAPID(-18.01)NRPEYLSK(+14.02)NPALSQFFEK.L Y 42.99 2886.4551 25 -5.9 722.6168 4 78.96 2 39739 AEV_1_3_RA2_01_1232.d 0 1 1 103 127 Dehydration; Methylation(KR)
K.AAELQESAR.T Y 42.00 973.4828 9 -85.7 487.7070 2 31.19 1 9622 AEV 2_3_RA2_01_1224.d 4.64E5 2 2 370 378
K.AAE(+14.02)LQESAR.T Y 37.28 987.4985 9 1.0 494.7570 2 28.16 3 12333 AEV_3_3_RA3_01_1233.d 3.38E5 3 3 370 378 Methylation(others)
K.SYGGK(-1.03)AAELQESAR.T Y 35.74 1464.6844 14 -12.5 489.2293 3 41.07 3 20045 AEV_3_3_RA3_01_1233.d 1.34E5 2 2 365 378 Lysine oxidation to aminoadipic semialdehyde
K.AAELQESAR(+14.02).T Y 34.03 987.4985 9 4.9 494.7589 2 34.01 2 12591 AEV_1_3_RA2_01_1232.d 6.18E5 6 6 370 378 Methylation(KR)
R.KFHPITN(+.98)GANLAR.E Y 32.27 1438.7681 13 3.0 360.7004 4 53.18 3 27831 AEV_3_3_RA3_01_1233.d 2.21E5 2 2 342 354 Deamidation (NQ)
K.KDEPAPAPAPAPAPAPETK(-2.02).T Y 29.83 1851.9365 19 -6.4 618.3155 3 46.29 3 23372 AEV_3_3_RA3_01_1233.d 0 1 1 84 102 2-amino-3-oxo-butanoic_acid
R.EFTFADELP(+13.98)K.S Y 29.47 1209.5553 10 -54.3 605.7521 2 85.78 1 46416 AEV 2_3_RA2_01_1224.d 7.01E4 1 1 355 364 Proline oxidation to pyroglutamic acid
K.FHPITNGAN(+.98)LAR.E Y 29.35 1310.6731 12 12.6 656.3521 2 61.56 2 26896 AEV_1_3_RA2_01_1232.d 2.26E4 1 1 343 354 Deamidation (NQ)
K.SYGGKAAELQESAR.T Y 27.87 1465.7161 14 -21.4 733.8496 2 41.12 3 20076 AEV_3_3_RA3_01_1233.d 0 1 1 365 378
K.ALEWR.K Y 27.32 673.3547 5 0.4 337.6848 2 45.72 3 23000 AEV_3_3_RA3_01_1233.d 2.46E5 1 1 178 182
R.TVTLKEDTPAPTLAPPAAETN(+.98)GTAAK(+14.02).D Y 26.79 2579.3330 26 6.4 860.7904 3 71.71 2 34125 AEV_1_3_RA2_01_1232.d 1.11E5 2 2 379 404 Deamidation (NQ); Methylation(KR)
K.AAELQE(+14.02)SAR.T Y 26.42 987.4985 9 5.9 494.7594 2 34.41 2 12787 AEV_1_3_RA2_01_1232.d 1.63E5 1 1 370 378 Methylation(others)
R.LNPTIR.A Y 25.67 712.4232 6 2.4 357.2197 2 32.13 2 11702 AEV_1_3_RA2_01_1232.d 1.57E6 2 2 289 294
K.ATYS(-18.01)ASK.F Y 25.33 708.3442 7 0.8 709.3521 1 60.87 2 26446 AEV_1_3_RA2_01_1232.d 0 1 1 194 200 Dehydration
K.DVN(+.98)NTFGDVDEFIKWR.V Y 25.16 1954.9060 16 15.2 652.6525 3 84.69 2 44108 AEV_1_3_RA2_01_1232.d 7.18E3 1 1 230 245 Deamidation (NQ)
K.AAELQES(-18.01)AR.T Y 24.01 955.4723 9 -60.6 319.4787 3 33.57 1 10957 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 370 378 Dehydration
K.AAELQ(+.98)ESAR.T Y 23.85 974.4669 9 37.1 488.2588 2 23.48 3 9698 AEV_3_3_RA3_01_1233.d 1.28E5 2 2 370 378 Deamidation (NQ)
R.ANEGNVK.L Y 23.84 730.3610 7 34.5 731.3934 1 76.23 3 45093 AEV_3_3_RA3_01_1233.d 6.04E4 2 2 163 169
R.E(+14.02)FTFADELPK.S Y 20.72 1209.5917 10 8.5 605.8082 2 78.89 3 47212 AEV_3_3_RA3_01_1233.d 6.39E4 1 1 355 364 Methylation(others)
R.VEKSETPSTQTPAAAAPSVTPTAAAPAQSSGADAIEAQKKDEPAPAPAPAPAPAPETK.T Y 20.39 5571.7856 58 8.7 1115.3741 5 68.29 2 31578 AEV_1_3_RA2_01_1232.d 8.22E4 1 1 45 102
K.MDPLALADK(-.98).A Y 20.24 971.5110 9 17.0 486.7710 2 57.15 3 30327 AEV_3_3_RA3_01_1233.d 5.55E5 1 1 185 193 Amidation
K.LAEE(+14.02)QLTK.A Y 20.21 944.5178 8 -29.6 473.2522 2 46.73 3 23639 AEV_3_3_RA3_01_1233.d 0 1 1 170 177 Methylation(others)
R.ANEGNVKLAEEQLTK(+14.02).A Y 19.15 1656.8682 15 -4.5 553.2942 3 65.04 3 36305 AEV_3_3_RA3_01_1233.d 0 1 1 163 177 Methylation(KR)
K.DATQ(+.98)TAK.V Y 18.81 734.3446 7 -68.7 368.1544 2 32.44 1 10327 AEV 2_3_RA2_01_1224.d 0 1 1 405 411 Deamidation (NQ)
K.NPALSQFF(+31.99)EK(+14.02).L Y 18.01 1225.5979 10 43.7 613.8330 2 70.88 2 33506 AEV_1_3_RA2_01_1232.d 0 1 1 118 127 Dihydroxy; Methylation(KR)
K.S(+79.97)Y(-18.01)GGK.A N 17.69 572.1996 5 -49.0 573.1788 1 113.28 1 59695 AEV 2_3_RA2_01_1224.d 4.33E4 1 1 365 369 Phosphorylation (STY); Dehydration
K.MDPLALADKATYSASK.F Y 17.59 1680.8392 16 -85.6 561.2391 3 79.44 1 41399 AEV 2_3_RA2_01_1224.d 7.44E4 1 1 185 200
K.AAELQES(-18.01)AR(+14.02).T Y 17.59 969.4879 9 -28.5 970.4676 1 82.72 2 42672 AEV_1_3_RA2_01_1232.d 7.16E4 1 1 370 378 Dehydration; Methylation(KR)
K.F(+42.01)QGLGYVAN(+.98)YKDPK.G Y 16.99 1641.8038 14 -1.1 548.2746 3 72.96 2 35089 AEV_1_3_RA2_01_1232.d 9.77E3 1 1 201 214 Acetylation (N-term); Deamidation (NQ)
K.FLRANEGNVK.L Y 16.76 1146.6145 10 -3.0 383.2110 3 30.79 3 13845 AEV_3_3_RA3_01_1233.d 1.87E5 1 1 160 169
K.KM(+15.99)D(+21.98)PLALADK.A Y 16.52 1138.5668 10 -13.9 570.2828 2 59.14 2 25322 AEV_1_3_RA2_01_1232.d 1.17E5 1 1 184 193 Oxidation (M); Sodium adduct
K.M(+15.99)DPLALADKATYSASK(+42.01).F Y 16.50 1738.8447 16 -111.2 435.6701 4 55.63 1 23585 AEV 2_3_RA2_01_1224.d 3.07E5 1 1 185 200 Oxidation (M); Acetylation (K)
K.ATYS(+79.97)ASKFQGLGYVANYK(+21.98).D Y 16.40 2068.9270 18 -30.1 518.2234 4 68.31 1 32673 AEV 2_3_RA2_01_1224.d 0 1 1 194 211 Phosphorylation (STY); Sodium adduct
K.AAELQ(+.98)ESAR(+14.02).T Y 16.04 988.4825 9 -3.7 495.2467 2 35.13 3 16411 AEV_3_3_RA3_01_1233.d 9.63E4 1 1 370 378 Deamidation (NQ); Methylation(KR)
R.KKMDPLALAD(-18.01)K.A Y 15.86 1210.6743 11 20.6 303.6821 4 11.93 3 3469 AEV_3_3_RA3_01_1233.d 9.15E4 1 1 183 193 Dehydration
K.VFLSK(-.98).N Y 15.66 591.3744 5 17.9 592.3923 1 100.35 3 59183 AEV_3_3_RA3_01_1233.d 0 1 1 333 337 Amidation
K.FHPITN(+.98)GANLAR.E Y 15.37 1310.6731 12 34.2 437.9132 3 59.16 2 25334 AEV_1_3_RA2_01_1232.d 4.39E4 1 1 343 354 Deamidation (NQ)
R.KKMDPLALADKATYSASK.F Y 15.29 1937.0292 18 -24.8 485.2526 4 64.69 3 36030 AEV_3_3_RA3_01_1233.d 0 1 1 183 200
K.SYGGK(+43.01).A N 15.14 553.2496 5 36.3 554.2770 1 54.47 2 22735 AEV_1_3_RA2_01_1232.d 1.28E5 1 1 365 369 Carbamylation
total 64 peptides
C1G4M5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.EGINIFLDGHIPTENLR.F Y 117.77 1937.0006 17 5.0 646.6774 3 81.84 2 42002 AEV_1_3_RA2_01_1232.d 4.75E5 4 4 310 326
K.KC(+57.02)PFGAIHIINLPTNLETQVTHR.Y Y 115.46 2658.4065 23 -9.6 532.6835 5 78.70 3 47085 AEV_3_3_RA3_01_1233.d 4.12E5 2 2 64 86 Carbamidomethylation
K.VLEDDLKAVVKPQYVDQIPR.A Y 103.08 2324.2739 20 2.6 582.0773 4 77.26 3 45910 AEV_3_3_RA3_01_1233.d 1.8E5 2 2 159 178
R.ANTPESLLTGC(+57.02)NK.F Y 97.86 1403.6715 13 -1.2 702.8422 2 64.61 3 35966 AEV_3_3_RA3_01_1233.d 5.13E5 5 5 548 560 Carbamidomethylation
K.AVVKPQYVDQIPR.A Y 95.66 1511.8459 13 25.3 504.9687 3 64.13 2 28647 AEV_1_3_RA2_01_1232.d 1.52E5 2 2 166 178
R.INKHQSQLDQEQK.L Y 94.88 1594.8063 13 3.2 532.6111 3 14.48 3 4818 AEV_3_3_RA3_01_1233.d 1.04E5 2 2 580 592
R.IAEAGDEFLVDKGR.A Y 91.29 1518.7677 14 -0.5 507.2629 3 63.79 3 35346 AEV_3_3_RA3_01_1233.d 1.43E6 6 6 336 349
R.TGKLC(+57.02)IEVTPESK.I Y 90.46 1460.7544 13 1.6 731.3856 2 57.69 3 30717 AEV_3_3_RA3_01_1233.d 2.39E5 2 2 34 46 Carbamidomethylation
R.ANTPESLLTGC(+57.02)NKFLK.N Y 85.44 1791.9189 16 -2.6 598.3120 3 74.05 3 43388 AEV_3_3_RA3_01_1233.d 7.34E5 4 4 548 563 Carbamidomethylation
K.LLAGAEKPDGR.T Y 80.43 1125.6141 11 -35.6 563.7943 2 30.37 3 13655 AEV_3_3_RA3_01_1233.d 8.44E5 9 9 394 404
R.YDNPPDWEEILKYFR.G Y 70.15 1983.9366 15 9.3 662.3256 3 88.94 2 46691 AEV_1_3_RA2_01_1232.d 1.28E5 2 2 134 148
K.LC(+57.02)IEVTPESK.I Y 66.20 1174.5903 10 -0.2 588.3023 2 63.39 3 35078 AEV_3_3_RA3_01_1233.d 6.19E5 3 3 37 46 Carbamidomethylation
R.FREESLTFR.I Y 65.20 1183.5985 9 4.1 395.5417 3 62.25 2 27367 AEV_1_3_RA2_01_1232.d 7.77E5 4 4 327 335
R.IAIVNSDKC(+57.02)KPK.K Y 63.97 1371.7544 12 -11.1 686.8769 2 26.88 3 11630 AEV_3_3_RA3_01_1233.d 1.84E5 3 3 8 19 Carbamidomethylation
R.IAE(+14.02)AGDEFLVDKGR.A Y 62.91 1532.7834 14 4.0 511.9371 3 67.44 3 38203 AEV_3_3_RA3_01_1233.d 2.01E5 1 1 336 349 Methylation(others)
R.VAIVLALGIPADIYLIDEPSAYLDSEQR.I Y 61.94 3043.6116 28 5.7 1015.5502 3 96.89 2 49967 AEV_1_3_RA2_01_1232.d 3.01E4 1 1 473 500
R.IAIVNSDK.C Y 53.77 858.4811 8 8.8 430.2516 2 35.23 3 16469 AEV_3_3_RA3_01_1233.d 5.85E5 4 4 8 15
R.AFSYPK.M Y 53.69 711.3591 6 -3.5 712.3639 1 40.13 3 19488 AEV_3_3_RA3_01_1233.d 6.37E5 4 4 350 355
R.AFSYPKM(+15.99)EK.T Y 52.69 1115.5321 9 27.1 558.7885 2 31.62 3 14341 AEV_3_3_RA3_01_1233.d 4.61E5 1 1 350 358 Oxidation (M)
R.ANTPE(+14.02)SLLTGC(+57.02)NK.F Y 50.02 1417.6871 13 -1.8 709.8495 2 69.28 3 39675 AEV_3_3_RA3_01_1233.d 5.12E5 2 2 548 560 Methylation(others); Carbamidomethylation
R.YDNPPDWEEILK.Y Y 49.45 1517.7037 12 5.8 759.8635 2 81.82 2 41990 AEV_1_3_RA2_01_1232.d 8.56E4 1 1 134 145
K.NLDVTFR.R Y 46.78 863.4501 7 6.1 432.7350 2 63.12 3 34863 AEV_3_3_RA3_01_1233.d 7.81E5 4 4 564 570
R.GSELQNYFTK.V Y 46.11 1185.5665 10 -89.3 593.7376 2 74.43 1 37446 AEV 2_3_RA2_01_1224.d 4.6E5 2 2 149 158
R.ANTPESLLTGC(+57.02)N(+.98)KFLK.N Y 42.84 1792.9030 16 10.2 598.6477 3 74.20 3 43504 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 548 563 Carbamidomethylation; Deamidation (NQ)
K.IAFISER.L Y 42.33 834.4599 7 2.5 418.2383 2 62.99 2 27871 AEV_1_3_RA2_01_1232.d 9.31E5 3 3 47 53
R.TGKLC(+57.02)IEVTPESK(+14.02).I Y 41.25 1474.7701 13 -12.0 492.5914 3 61.85 3 33870 AEV_3_3_RA3_01_1233.d 1.73E4 1 1 34 46 Carbamidomethylation; Methylation(KR)
K.IT(+79.97)PKFQGTVRQLFFKR.I Y 39.81 2045.0975 16 2.8 410.0279 5 71.49 3 41397 AEV_3_3_RA3_01_1233.d 9.06E4 1 1 419 434 Phosphorylation (STY)
K.DRDVGLLSGGELQR.F Y 37.31 1513.7848 14 -2.1 505.6012 3 66.59 3 37534 AEV_3_3_RA3_01_1233.d 1.98E5 2 2 214 227
K.VLEDDLK.A Y 36.70 830.4385 7 0.6 416.2268 2 42.93 3 21242 AEV_3_3_RA3_01_1233.d 5.28E6 2 2 159 165
R.EESLT(+79.97)FR(+14.02).I Y 34.00 974.4110 7 -27.3 488.1995 2 61.94 1 27956 AEV 2_3_RA2_01_1224.d 2.4E5 1 1 329 335 Phosphorylation (STY); Methylation(KR)
R.IAEAGDEFLVDKGR(+14.02).A Y 31.70 1532.7834 14 -1.3 511.9344 3 65.45 3 36633 AEV_3_3_RA3_01_1233.d 8.81E4 1 1 336 349 Methylation(KR)
R.FREESLTFR(+14.02).I Y 31.11 1197.6141 9 20.8 400.2203 3 65.03 3 36299 AEV_3_3_RA3_01_1233.d 4.75E4 2 2 327 335 Methylation(KR)
K.NLDVTFRR.D Y 31.08 1019.5512 8 -4.6 340.8561 3 53.59 3 28104 AEV_3_3_RA3_01_1233.d 3.02E5 2 2 564 571
R.Q(-17.03)LFFKR.I Y 31.04 820.4595 6 1.2 411.2375 2 72.26 2 34547 AEV_1_3_RA2_01_1232.d 4.48E5 2 2 429 434 Pyro-glu from Q
R.FR(+14.02)EESLTFR.I Y 30.42 1197.6141 9 13.5 400.2174 3 66.70 2 30437 AEV_1_3_RA2_01_1232.d 9.11E4 2 2 327 335 Methylation(KR)
R.DPNSYRPR.I Y 30.12 1003.4835 8 2.2 502.7502 2 19.20 3 7402 AEV_3_3_RA3_01_1233.d 2.01E5 2 2 572 579
K.LC(+57.02)IEVTPESK(+14.02).I Y 29.84 1188.6060 10 -8.5 595.3052 2 66.05 2 29983 AEV_1_3_RA2_01_1232.d 5.14E4 1 1 37 46 Carbamidomethylation; Methylation(KR)
R.AVKGPTK(+14.02)EVELLIK.A Y 29.78 1537.9442 14 3.9 385.4948 4 68.31 3 38927 AEV_3_3_RA3_01_1233.d 5.2E4 1 1 179 192 Methylation(KR)
K.HQSQLDQEQK.L Y 27.65 1239.5844 10 -58.8 414.1778 3 44.46 1 16982 AEV 2_3_RA2_01_1224.d 0 1 1 583 592
R.LC(+57.02)IGC(+57.02)GIC(+57.02)PK(+14.02).K Y 25.81 1190.5610 10 -2.9 596.2861 2 67.45 3 38213 AEV_3_3_RA3_01_1233.d 5.73E4 1 1 54 63 Carbamidomethylation; Methylation(KR)
R.YSANSFK.L Y 25.67 815.3813 7 -86.7 408.6626 2 42.89 1 16088 AEV 2_3_RA2_01_1224.d 2.22E5 2 2 87 93
R.D(-18.01)VGLLSGGELQR.F Y 25.41 1224.6462 12 19.4 409.2306 3 62.36 3 34241 AEV_3_3_RA3_01_1233.d 0 1 1 216 227 Dehydration
K.LC(+57.02)IE(+14.02)VTPESK.I Y 24.90 1188.6060 10 -1.6 595.3093 2 65.94 3 37017 AEV_3_3_RA3_01_1233.d 8.47E4 1 1 37 46 Carbamidomethylation; Methylation(others)
R.L(+42.01)SAAR(+31.99).I N 24.38 590.3024 5 -90.3 591.2563 1 81.55 1 43040 AEV 2_3_RA2_01_1224.d 3.44E5 1 1 256 260 Acetylation (N-term); Dihydroxy
R.LSAAR(-43.05).I N 23.58 473.2485 5 -77.0 474.2194 1 27.81 1 7840 AEV 2_3_RA2_01_1224.d 5.07E4 1 1 256 260 Arginine oxidation to glutamic semialdehyde
K.GAGGC(+57.02)K(+31.99).G Y 23.47 580.2275 6 -92.5 581.1811 1 19.72 1 4702 AEV 2_3_RA2_01_1224.d 0 1 1 639 644 Carbamidomethylation; Dihydroxy
R.TGK(+969.37)LC(+57.02)IEVTPESK.I Y 22.99 2430.1206 13 8.0 487.0353 5 57.61 3 30663 AEV_3_3_RA3_01_1233.d 5.44E5 1 1 34 46 Maleimide-3-saccharide; Carbamidomethylation
R.DVGLLS(-18.01)GGELQR.F Y 22.91 1224.6462 12 -13.4 307.1647 4 22.74 2 7558 AEV_1_3_RA2_01_1232.d 0 1 1 216 227 Dehydration
K.AAFLSPQFQTDVYKPLKLDDFIDQEVQNLSGGELQR.V Y 22.26 4109.0742 36 21.6 822.8398 5 91.28 2 47843 AEV_1_3_RA2_01_1232.d 0 1 1 437 472
R.DVGLLSGGELQR.F Y 21.98 1242.6567 12 -20.8 415.2176 3 26.80 3 11583 AEV_3_3_RA3_01_1233.d 4.37E5 5 5 216 227
R.LC(+57.02)IGCGIC(+57.02)PK(+14.02).K Y 21.96 1133.5396 10 -90.9 378.8194 3 37.14 1 12850 AEV 2_3_RA2_01_1224.d 4.51E5 1 1 54 63 Carbamidomethylation; Methylation(KR)
K.ILSGKLK(+14.02)PNLGR.Y Y 21.52 1308.8241 12 -39.1 328.2005 4 69.61 3 39934 AEV_3_3_RA3_01_1233.d 5.22E4 1 1 122 133 Methylation(KR)
R.AVKGPTKEVELLIK.A Y 21.40 1523.9286 14 1.4 381.9900 4 64.39 3 35789 AEV_3_3_RA3_01_1233.d 2.87E5 1 1 179 192
K.YFRGSELQNYFTK.V Y 21.00 1651.7994 13 19.0 551.6176 3 72.98 2 35103 AEV_1_3_RA2_01_1232.d 5.75E4 1 1 146 158
R.DVGLLSGGELQR(+31.99).F Y 20.99 1274.6466 12 -12.4 638.3227 2 66.67 3 37593 AEV_3_3_RA3_01_1233.d 5.38E5 1 1 216 227 Dihydroxy
K.GAGGC(+57.02)K(+42.02).G Y 20.40 590.2595 6 6.8 591.2708 1 21.88 3 8837 AEV_3_3_RA3_01_1233.d 0 1 1 639 644 Carbamidomethylation; Guanidination
K.L(+42.01)LAGAEK(+14.02)PDGR.T Y 20.03 1181.6404 11 -5.3 394.8853 3 43.53 2 17217 AEV_1_3_RA2_01_1232.d 1.5E4 1 1 394 404 Acetylation (N-term); Methylation(KR)
K.D(+42.01)R(+28.03)DVGLLSGGELQR.F Y 20.01 1583.8267 14 -39.6 396.9483 4 43.82 2 17355 AEV_1_3_RA2_01_1232.d 5.79E4 1 1 214 227 Acetylation (N-term); Dimethylation(KR)
R.TTVPPMNISMK(+27.99)PQ(+.98)K.I Y 19.72 1599.8000 14 -22.4 800.8894 2 85.37 3 51948 AEV_3_3_RA3_01_1233.d 8.18E4 1 1 405 418 Formylation; Deamidation (NQ)
R.YSANSFK(+14.02).L Y 19.70 829.3970 7 -84.4 415.6707 2 59.83 1 26361 AEV 2_3_RA2_01_1224.d 9.83E4 1 1 87 93 Methylation(KR)
R.LC(+57.02)IGCGIC(+57.02)PK(+42.01).K Y 19.63 1161.5344 10 -37.7 388.1708 3 37.60 1 13057 AEV 2_3_RA2_01_1224.d 0 1 1 54 63 Carbamidomethylation; Acetylation (K)
R.TTVPPMNISMK(+14.02)PQK.I Y 19.24 1584.8368 14 6.8 529.2898 3 38.16 3 18287 AEV_3_3_RA3_01_1233.d 0 1 1 405 418 Methylation(KR)
K.IAFISER(+44.03).L Y 19.08 878.4861 7 -13.2 879.4818 1 88.70 2 46567 AEV_1_3_RA2_01_1232.d 5.56E4 1 1 47 53 Ethanolation (KR)
K.LSGNYK.R Y 18.52 680.3493 6 -19.9 681.3430 1 65.97 3 37040 AEV_3_3_RA3_01_1233.d 0 1 1 593 598
R.YS(+79.97)ANSFK(+21.98).L Y 18.44 917.3296 7 55.1 918.3875 1 83.13 1 44292 AEV 2_3_RA2_01_1224.d 5.51E4 1 1 87 93 Phosphorylation (STY); Sodium adduct
R.DPNSYR(+14.02)PR.I Y 18.40 1017.4991 8 -47.9 1018.4576 1 111.88 1 59293 AEV 2_3_RA2_01_1224.d 0 1 1 572 579 Methylation(KR)
K.G(+27.99)AGGC(+57.02)K(+14.02).G Y 18.38 590.2482 6 44.3 591.2817 1 41.04 3 20031 AEV_3_3_RA3_01_1233.d 8.89E4 1 1 639 644 Formylation; Carbamidomethylation; Methylation(KR)
R.G(+43.01)SELQNYFT(+79.97)K.V Y 18.37 1308.5387 10 33.2 437.2013 3 61.08 1 27283 AEV 2_3_RA2_01_1224.d 0 1 1 149 158 Carbamylation; Phosphorylation (STY)
K.NLDVTFRRDPNSYRPR.I Y 18.26 2005.0242 16 -7.9 502.2593 4 61.30 3 33472 AEV_3_3_RA3_01_1233.d 0 1 1 564 579
K.YFRGSELQNYFT(+79.97)K(+42.01).V Y 18.17 1773.7764 13 30.0 592.2838 3 51.75 3 26888 AEV_3_3_RA3_01_1233.d 0 1 1 146 158 Phosphorylation (STY); Acetylation (K)
R.QEC(+57.02)KKS(+14.02)C(+57.02)PVVR.T Y 18.14 1403.7013 11 -4.4 468.9057 3 26.03 2 8957 AEV_1_3_RA2_01_1232.d 0 1 1 23 33 Carbamidomethylation; Methylation(others)
K.L(+42.01)SGN(+.98)YK.R Y 17.71 723.3439 6 -51.7 724.3137 1 93.52 1 52135 AEV 2_3_RA2_01_1224.d 9.25E4 1 1 593 598 Acetylation (N-term); Deamidation (NQ)
R.INKHQ(+.98)SQ(+.98)LDQEQK.L Y 17.43 1596.7743 13 -10.4 400.1967 4 83.41 1 44528 AEV 2_3_RA2_01_1224.d 1.97E5 1 1 580 592 Deamidation (NQ)
K.LKPNLGRYDNPPDWEEILKYFR.G Y 17.34 2762.4180 22 -2.7 553.4894 5 85.01 2 44327 AEV_1_3_RA2_01_1232.d 6.79E4 1 1 127 148
R.GSELQ(+.98)NYFTK(+31.99).V Y 17.29 1218.5404 10 8.0 407.1907 3 55.40 1 23415 AEV 2_3_RA2_01_1224.d 0 1 1 149 158 Deamidation (NQ); Dihydroxy
R.T(-2.02)GKLC(+57.02)IEVTPESK.I Y 16.82 1458.7388 13 26.0 487.2662 3 59.16 2 25336 AEV_1_3_RA2_01_1232.d 0 1 1 34 46 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
K.N(+.98)GVDVLAFSGVSK(+42.01).G Y 16.73 1334.6718 13 32.7 445.9124 3 49.66 2 20272 AEV_1_3_RA2_01_1232.d 3.73E5 1 1 626 638 Deamidation (NQ); Acetylation (K)
K.L(+88.00)LAGAEKPDGR.T Y 16.57 1213.6124 11 -36.1 405.5302 3 55.14 1 23256 AEV 2_3_RA2_01_1224.d 2.78E5 1 1 394 404 3-sulfanylpropanoyl
R.TTVPPMNIS(+79.97)MKPQKITPK(+43.99).F Y 16.53 2134.0566 18 5.0 712.3630 3 85.32 3 51920 AEV_3_3_RA3_01_1233.d 8.69E3 1 1 405 422 Phosphorylation (STY); Carboxylation (DKW)
K.G(+27.99)RAFSYPK.M Y 16.22 952.4766 8 7.1 477.2490 2 11.46 2 3019 AEV_1_3_RA2_01_1232.d 3.59E3 1 1 348 355 Formylation
R.IVAARVIK(+21.98).R Y 16.13 890.5677 8 42.8 891.6132 1 105.37 2 52530 AEV_1_3_RA2_01_1232.d 2E2 1 1 501 508 Sodium adduct
K.FQ(+.98)GTVR(+28.03).Q Y 16.12 735.3915 6 -68.2 736.3486 1 76.80 2 38021 AEV_1_3_RA2_01_1232.d 6.79E4 1 1 423 428 Deamidation (NQ); Dimethylation(KR)
R.AVKGPT(+79.97)K.E Y 16.08 779.3942 7 -84.6 780.3356 1 109.43 1 58599 AEV 2_3_RA2_01_1224.d 9.01E4 1 1 179 185 Phosphorylation (STY)
R.TGK(+14.02)LC(+57.02)IEVTPES(+79.97)K.I Y 16.07 1554.7365 13 25.4 519.2659 3 62.87 3 34635 AEV_3_3_RA3_01_1233.d 0 1 1 34 46 Methylation(KR); Carbamidomethylation; Phosphorylation (STY)
R.IC(+57.02)M(+15.99)LR.Y Y 16.05 707.3458 5 -67.3 354.6564 2 45.79 1 17732 AEV 2_3_RA2_01_1224.d 2.05E5 1 1 732 736 Carbamidomethylation; Oxidation (M)
R.IVAAR.V N 15.77 528.3384 5 -50.5 529.3190 1 102.30 1 56482 AEV 2_3_RA2_01_1224.d 1.09E6 1 1 501 505
R.INK(-1.03)HQSQLDQEQK.L Y 15.68 1593.7747 13 6.9 532.2692 3 15.92 2 4719 AEV_1_3_RA2_01_1232.d 1.27E4 1 1 580 592 Lysine oxidation to aminoadipic semialdehyde
K.VLEDD(-18.01)LK(+14.02).A Y 15.66 826.4436 7 -21.3 414.2203 2 11.80 2 3144 AEV_1_3_RA2_01_1232.d 0 1 1 159 165 Dehydration; Methylation(KR)
K.T(-18.01)TFC(+57.02)KLLAGAEK(+14.02)PDGR.T Y 15.61 1758.9087 16 3.4 587.3122 3 85.88 3 52286 AEV_3_3_RA3_01_1233.d 0 1 1 389 404 Dehydration; Carbamidomethylation; Methylation(KR)
K.L(+43.01)LAGAEK(+14.02)PDGR.T Y 15.61 1182.6356 11 2.1 395.2200 3 42.72 2 16819 AEV_1_3_RA2_01_1232.d 8.25E4 1 1 394 404 Carbamylation; Methylation(KR)
R.D(+43.99)VGLLSGGELQR.F Y 15.27 1286.6466 12 -5.0 429.8873 3 53.50 2 22245 AEV_1_3_RA2_01_1232.d 5.29E4 1 1 216 227 Carboxylation (DKW)
R.LS(-18.01)AAR.I N 15.25 498.2914 5 -180.9 499.2085 1 67.16 1 31766 AEV 2_3_RA2_01_1224.d 0 1 1 256 260 Dehydration
K.CPFGAIHIINLPT(+79.97)NLETQVTHR.Y Y 15.20 2553.2563 22 5.5 639.3249 4 84.26 2 43803 AEV_1_3_RA2_01_1232.d 3.5E4 1 1 65 86 Phosphorylation (STY)
K.N(+43.01)LDVT(+79.97)FR.R Y 15.16 986.4222 7 25.2 329.8230 3 41.92 1 15529 AEV 2_3_RA2_01_1224.d 0 1 1 564 570 Carbamylation; Phosphorylation (STY)
R.D(+42.01)VGLLSGGELQR.F Y 15.16 1284.6674 12 -2.3 429.2288 3 50.00 3 25734 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 216 227 Acetylation (N-term)
total 95 peptides
A0A0A0HT22
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.SVEPFIQTASPTSTTAALAGAVPLEITR.A Y 200.00 2827.4966 28 2.2 1414.7587 2 87.17 2 45740 AEV_1_3_RA2_01_1232.d 2.26E5 3 3 285 312
K.NTIASTATTDKAGYEK.D Y 87.00 1669.8159 16 3.5 835.9182 2 39.97 2 15448 AEV_1_3_RA2_01_1232.d 6.13E4 2 2 241 256
R.SVEPFIQTASPTSTTAALAGAVPLEITR(+14.02).A Y 84.67 2841.5122 28 4.0 1421.7690 2 88.30 3 53771 AEV_3_3_RA3_01_1233.d 5.13E4 1 1 285 312 Methylation(KR)
R.EVKHDDSAGEPAPVITAETSPTVPGGTPLAAK.E Y 80.23 3141.5830 32 0.9 786.4037 4 71.85 2 34235 AEV_1_3_RA2_01_1232.d 3.9E4 1 1 413 444
K.ESHKAPETDAAPSVPITSSAC(+57.02)PESTTANLAK.D Y 79.61 3166.5088 31 7.0 792.6400 4 65.97 3 37037 AEV_3_3_RA3_01_1233.d 4.68E4 1 1 153 183 Carbamidomethylation
R.S(+14.02)VEPFIQTASPTSTTAALAGAVPLEITR.A Y 75.91 2841.5122 28 1.9 1421.7661 2 88.39 2 46401 AEV_1_3_RA2_01_1232.d 5.77E4 1 1 285 312 Methylation(others)
K.EYQEQSISPK.S Y 72.81 1207.5720 10 2.5 604.7948 2 36.30 3 17122 AEV_3_3_RA3_01_1233.d 5.92E5 5 5 445 454
K.SREPAPAPAPADK.D Y 72.42 1305.6676 13 -11.3 653.8337 2 21.71 3 8753 AEV_3_3_RA3_01_1233.d 4.12E5 3 3 455 467
K.AHKEPEAAGDSGC(+57.02)VAEKAEVER.Q Y 69.62 2339.0811 22 1.4 468.8241 5 38.36 3 18416 AEV_3_3_RA3_01_1233.d 1.42E5 2 2 340 361 Carbamidomethylation
R.EVKHDDSAGEPAPVITAETSPTVPGGTPLAAKEYQEQSISPK.S Y 60.00 4331.1445 42 1.3 867.2373 5 74.14 2 35978 AEV_1_3_RA2_01_1232.d 1.3E5 1 1 413 454
K.APETDAAPSVPITSSAC(+57.02)PESTTANLAK.D Y 58.05 2685.2803 27 13.1 896.1124 3 72.82 2 34984 AEV_1_3_RA2_01_1232.d 5.85E4 1 1 157 183 Carbamidomethylation
R.Q(-17.03)LLESVHPTDASGGVPPMVRR.S Y 56.13 2228.1372 21 -4.8 743.7161 3 76.83 2 38060 AEV_1_3_RA2_01_1232.d 8.82E4 1 1 362 382 Pyro-glu from Q
R.ASAIFSK.L Y 52.46 722.3962 7 -15.3 723.3925 1 32.01 3 14574 AEV_3_3_RA3_01_1233.d 2.95E5 2 2 523 529
K.EYQEQ(+.98)SISPK.S Y 50.07 1208.5560 10 1.0 605.2859 2 40.30 3 19607 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 445 454 Deamidation (NQ)
K.NTIASTATTDK.A Y 33.26 1121.5564 11 -87.6 561.7363 2 35.31 1 11883 AEV 2_3_RA2_01_1224.d 4.34E4 1 1 241 251
R.Q(-17.03)LLESVHPTDASGGVPPMVR.R Y 32.08 2072.0361 20 4.6 1037.0302 2 80.59 2 41033 AEV_1_3_RA2_01_1232.d 4.51E4 1 1 362 381 Pyro-glu from Q
R.APN(+.98)GSVSKGPESSAK.E Y 31.19 1415.6892 15 -83.9 472.8641 3 29.40 1 8657 AEV 2_3_RA2_01_1224.d 1.82E5 1 1 313 327 Deamidation (NQ)
R.E(-18.01)PAPAPAPADK.D Y 28.74 1044.5239 11 -70.6 349.1573 3 42.09 1 15629 AEV 2_3_RA2_01_1224.d 2.69E6 1 1 457 467 Pyro-glu from E
K.EYQEQSISPK(+14.02).S Y 26.22 1221.5876 10 1.2 611.8018 2 45.03 3 22575 AEV_3_3_RA3_01_1233.d 6.22E4 1 1 445 454 Methylation(KR)
R.TEDGFR(+21.98).K Y 25.15 745.3007 6 -6.8 746.3029 1 88.92 1 48864 AEV 2_3_RA2_01_1224.d 1.48E5 1 1 57 62 Sodium adduct
K.NTIASTAT(+79.97)T(+79.97)DK.A Y 24.08 1281.4891 11 97.2 428.2119 3 52.22 1 21487 AEV 2_3_RA2_01_1224.d 0 2 2 241 251 Phosphorylation (STY)
K.FVVDGDWK(+72.02).I Y 23.92 1036.4866 8 2.6 519.2519 2 21.69 3 8743 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 78 85 Carboxyethyl
K.NTIASTATTD(+21.98)K.A Y 23.34 1143.5383 11 -62.0 572.7410 2 62.80 1 28629 AEV 2_3_RA2_01_1224.d 0 1 1 241 251 Sodium adduct
R.EPAPAPAPADK(+42.01).D Y 23.06 1104.5450 11 -60.0 369.1669 3 55.71 1 23636 AEV 2_3_RA2_01_1224.d 1.06E5 1 1 457 467 Acetylation (K)
R.EPAPAPAPADK.D Y 22.35 1062.5345 11 -6.7 532.2710 2 25.83 2 8862 AEV_1_3_RA2_01_1232.d 3.53E4 2 2 457 467
K.S(+79.97)REPAPAPAPADK(+42.01).D Y 22.00 1427.6445 13 -46.8 357.9017 4 64.52 1 29907 AEV 2_3_RA2_01_1224.d 2.98E5 1 1 455 467 Phosphorylation (STY); Acetylation (K)
R.EPAPAPAPAD(-18.01)K.D Y 21.92 1044.5239 11 -10.2 523.2639 2 16.24 3 5796 AEV_3_3_RA3_01_1233.d 2.88E4 1 1 457 467 Dehydration
R.KDVEVPAIS(+162.05)TK.M Y 21.08 1347.7133 11 -21.1 450.2355 3 14.84 2 4277 AEV_1_3_RA2_01_1232.d 5.31E4 1 1 63 73 Hexose (NSY)
K.QLPPPSK.D Y 20.27 765.4385 7 -57.5 766.4017 1 100.48 1 55863 AEV 2_3_RA2_01_1224.d 3.99E6 2 2 111 117
R.QLLESVHPTDASGGVPPMVR.R Y 20.11 2089.0625 20 11.2 697.3693 3 89.37 3 54365 AEV_3_3_RA3_01_1233.d 2.44E4 1 1 362 381
K.SNRPPS(+79.97)GATK(+226.08).T Y 20.01 1319.5693 10 -1.7 440.8630 3 66.84 1 31515 AEV 2_3_RA2_01_1224.d 3.32E5 1 1 12 21 Phosphorylation (STY); Biotinylation
K.ESM(-48.00)SK.A N 19.90 532.2493 5 10.1 533.2619 1 44.06 3 21963 AEV_3_3_RA3_01_1233.d 2.62E4 1 1 335 339 Dethiomethyl
K.KNR(+28.03)AS(+79.97)AIFSK.L Y 19.08 1228.6329 10 30.3 1229.6775 1 101.40 2 51418 AEV_1_3_RA2_01_1232.d 1.74E4 1 1 520 529 Dimethylation(KR); Phosphorylation (STY)
K.EEVERQLLR.E Y 18.93 1170.6356 9 -9.6 586.3195 2 70.07 3 40283 AEV_3_3_RA3_01_1233.d 5.52E4 1 1 404 412
K.SREPAPAP(+31.99)APADK.D Y 18.78 1337.6575 13 46.5 335.4372 4 72.80 1 36165 AEV 2_3_RA2_01_1224.d 4E5 1 1 455 467 Dihydroxy
K.N(+.98)TIASTATTD(+21.98)K.A Y 18.58 1144.5223 11 -46.7 573.2417 2 73.37 1 36582 AEV 2_3_RA2_01_1224.d 1.9E5 1 1 241 251 Deamidation (NQ); Sodium adduct
R.EPAPAPAPADK(+14.02).D Y 18.56 1076.5502 11 -40.0 359.8430 3 53.86 1 22517 AEV 2_3_RA2_01_1224.d 2.27E5 1 1 457 467 Methylation(KR)
K.EVPEVVK.E Y 18.46 798.4487 7 5.9 400.2339 2 21.41 3 8600 AEV_3_3_RA3_01_1233.d 3.07E4 1 1 328 334
K.N(+43.01)TIASTATTDK.A Y 18.43 1164.5623 11 -62.8 389.1703 3 27.71 1 7798 AEV 2_3_RA2_01_1224.d 3.68E4 1 1 241 251 Carbamylation
K.A(+42.01)ESTPGTFPVTPAK.E Y 18.20 1443.7245 14 28.1 482.2623 3 70.65 2 33339 AEV_1_3_RA2_01_1232.d 0 1 1 191 204 Acetylation (N-term)
R.A(+42.01)PNGS(+79.97)VSK(+42.01)GPESSAK.E Y 17.90 1578.6926 15 19.0 527.2482 3 41.42 3 20284 AEV_3_3_RA3_01_1233.d 9.58E4 1 1 313 327 Acetylation (N-term); Phosphorylation (STY); Acetylation (K)
R.KSN(+.98)RPPSGATK(+14.02).T Y 17.86 1156.6200 11 -40.1 579.2941 2 37.22 2 14129 AEV_1_3_RA2_01_1232.d 0 1 1 11 21 Deamidation (NQ); Methylation(KR)
R.K(+14.02)DVEVPAISTK(+27.99).M Y 17.81 1227.6710 11 -8.8 410.2274 3 55.99 2 23531 AEV_1_3_RA2_01_1232.d 1.15E4 1 1 63 73 Methylation(KR); Formylation
K.QLPPPS(+79.97)K(+27.99).D Y 17.33 873.3997 7 17.7 874.4225 1 92.83 3 56229 AEV_3_3_RA3_01_1233.d 0 1 1 111 117 Phosphorylation (STY); Formylation
K.NRASAIFSK(+27.99).L Y 17.28 1020.5352 9 -16.8 511.2663 2 53.64 2 22355 AEV_1_3_RA2_01_1232.d 1.66E5 1 1 521 529 Formylation
R.KSN(+.98)RPPSGAT(+79.97)K.T Y 16.99 1222.5707 11 -36.2 612.2705 2 82.22 1 43565 AEV 2_3_RA2_01_1224.d 4.18E4 1 1 11 21 Deamidation (NQ); Phosphorylation (STY)
R.APNGS(-18.01)VSK(+42.01).G Y 16.85 782.3923 8 -0.8 783.3989 1 88.59 2 46509 AEV_1_3_RA2_01_1232.d 0 1 1 313 320 Dehydration; Acetylation (K)
R.KAES(+79.97)T(-18.01)PGTFPVTPAK.E Y 16.82 1591.7646 15 26.2 531.6094 3 69.98 2 32835 AEV_1_3_RA2_01_1232.d 4.88E4 1 1 190 204 Phosphorylation (STY); Dehydration
K.DVEVPAISTK(+26.02).M Y 16.76 1083.5812 10 51.2 362.2195 3 51.74 2 21329 AEV_1_3_RA2_01_1232.d 0 1 1 64 73 Acetaldehyde +26
K.Q(+.98)LPPPSK.D Y 16.62 766.4225 7 -29.0 384.2074 2 34.99 2 13071 AEV_1_3_RA2_01_1232.d 0 1 1 111 117 Deamidation (NQ)
K.ESMSK(+27.99).A N 16.61 608.2476 5 -34.2 609.2340 1 67.40 1 31950 AEV 2_3_RA2_01_1224.d 2.26E5 1 1 335 339 Formylation
R.EPAPAPAPAD(+21.98)K(+42.01).D Y 16.55 1126.5270 11 9.4 564.2761 2 43.89 3 21848 AEV_3_3_RA3_01_1233.d 1.21E5 1 1 457 467 Sodium adduct; Acetylation (K)
R.SIDLAHADPEATAVPE(+21.98)AVVEK(+42.01).E Y 16.42 2225.0828 21 -0.2 742.7014 3 79.70 3 47917 AEV_3_3_RA3_01_1233.d 0 1 1 383 403 Sodium adduct; Acetylation (K)
R.ASAIFS(-18.01)K.L Y 16.36 704.3857 7 3.3 353.2013 2 29.74 3 13238 AEV_3_3_RA3_01_1233.d 0 1 1 523 529 Dehydration
K.N(+.98)TIASTATTDK.A Y 16.30 1122.5404 11 2.2 562.2787 2 41.00 3 20008 AEV_3_3_RA3_01_1233.d 8.19E4 1 1 241 251 Deamidation (NQ)
K.SN(+.98)RPPSGATK(+42.01).T Y 16.17 1056.5199 10 -41.0 353.1661 3 49.93 1 20219 AEV 2_3_RA2_01_1224.d 4.92E5 1 1 12 21 Deamidation (NQ); Acetylation (K)
K.AEVERQLLESVHPTDASGGVPPM(+15.99)VRR.S Y 16.09 2845.4504 26 13.5 712.3795 4 89.75 2 47100 AEV_1_3_RA2_01_1232.d 1.34E5 1 1 357 382 Oxidation (M)
R.APN(+.98)GSVSKGPESSAK(+27.99).E Y 16.01 1443.6841 15 -58.9 482.2070 3 69.36 1 33460 AEV 2_3_RA2_01_1224.d 0 1 1 313 327 Deamidation (NQ); Formylation
K.EYQ(+.98)EQSISPK.S Y 15.90 1208.5560 10 -92.1 605.2296 2 49.37 1 19881 AEV 2_3_RA2_01_1224.d 1.53E5 1 1 445 454 Deamidation (NQ)
K.DVE(+43.99)VPAISTK(+42.01).M Y 15.76 1143.5659 10 -0.1 572.7902 2 50.93 2 20912 AEV_1_3_RA2_01_1232.d 0 1 1 64 73 Carboxylation (E); Acetylation (K)
K.F(+42.01)VVDGDWK.I Y 15.58 1006.4760 8 -61.4 504.2144 2 28.97 1 8440 AEV 2_3_RA2_01_1224.d 0 1 1 78 85 Acetylation (N-term)
K.EYQE(+14.02)QSISPK.S Y 15.46 1221.5876 10 13.2 611.8091 2 49.88 3 25657 AEV_3_3_RA3_01_1233.d 6.72E4 1 1 445 454 Methylation(others)
K.EVPE(+43.99)VVK.E Y 15.24 842.4385 7 -69.9 422.1971 2 61.38 1 27509 AEV 2_3_RA2_01_1224.d 0 1 1 328 334 Carboxylation (E)
R.Q(+.98)LLESVHPTDASGGVPPMVR(+14.02)R.S Y 15.21 2260.1633 21 -6.7 754.3900 3 82.72 2 42668 AEV_1_3_RA2_01_1232.d 6.69E4 1 1 362 382 Deamidation (NQ); Methylation(KR)
total 64 peptides
C1GAF5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AILVTSPTDGGTYELIHIPR.D Y 129.29 2152.1528 20 1.0 718.3923 3 81.21 2 41519 AEV_1_3_RA2_01_1232.d 8.46E5 5 5 346 365
R.ERPASAVYQNQLFYITK.E Y 125.39 2027.0476 17 -6.3 676.6855 3 75.49 2 36986 AEV_1_3_RA2_01_1232.d 2.12E5 3 3 288 304
R.FAVFNQSTQQIDIKDLSNSTTK.T Y 87.52 2484.2495 22 2.2 829.0923 3 78.33 2 39234 AEV_1_3_RA2_01_1232.d 2.28E5 2 2 392 413
R.GVNWVSFHPTLPLIVSAGDDRLVK.L Y 85.26 2619.4172 24 0.5 655.8619 4 84.87 3 51604 AEV_3_3_RA3_01_1233.d 7.71E3 1 1 173 196
R.VSQVTEVGAPASGLR.L Y 82.14 1469.7838 15 -1.5 735.8981 2 62.44 3 34370 AEV_3_3_RA3_01_1233.d 3.49E5 5 5 1149 1163
R.LFDKLSFLYLATGDKEK.L Y 80.91 1987.0665 17 -4.0 497.7719 4 82.18 3 49719 AEV_3_3_RA3_01_1233.d 1.94E5 2 2 667 683
R.TVFFHHELPWIISSSDDQTIR.I Y 78.35 2527.2495 21 5.1 632.8229 4 82.09 2 42197 AEV_1_3_RA2_01_1232.d 1.99E5 2 2 59 79
K.TYLPATAGLPPLVNYVR.R Y 72.30 1844.0195 17 2.1 923.0190 2 85.13 2 44397 AEV_1_3_RA2_01_1232.d 6.97E4 1 1 913 929
R.GHGTSAVFVAR.N Y 71.00 1100.5726 11 -21.7 551.2817 2 35.75 3 16789 AEV_3_3_RA3_01_1233.d 3E5 3 3 379 389
R.ANANQADMFGNTDAVVK.F Y 63.44 1764.8101 17 -3.8 883.4089 2 67.95 3 38612 AEV_3_3_RA3_01_1233.d 3.77E4 1 1 148 164
R.VQMFKEIDLLPLAYLTAK.S Y 62.41 2092.1641 18 1.6 698.3964 3 89.85 2 47156 AEV_1_3_RA2_01_1232.d 5.86E4 1 1 714 731
R.Q(-17.03)VGAVNFEPLKPR.F Y 61.26 1436.7776 13 -6.5 719.3914 2 77.10 3 45789 AEV_3_3_RA3_01_1233.d 2.01E5 2 2 891 903 Pyro-glu from Q
R.TVSYNPAER.A Y 59.85 1035.4985 9 1.0 518.7571 2 36.04 3 16965 AEV_3_3_RA3_01_1233.d 1.38E6 6 6 337 345
R.SYDFSKNVESLPMLSLK.K Y 55.78 1956.9866 17 -22.0 653.3218 3 82.48 2 42486 AEV_1_3_RA2_01_1232.d 0 1 1 310 326
R.DSTGAMEPTNIKR.G Y 48.08 1418.6824 13 -0.6 710.3480 2 41.25 3 20160 AEV_3_3_RA3_01_1233.d 3.87E5 2 2 366 378
K.TSSLVGQSIISYLQK.K Y 46.86 1622.8879 15 -86.6 541.9231 3 88.11 1 48218 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 585 599
R.TLDSTVYLVR.V Y 44.11 1165.6343 10 -2.4 583.8230 2 70.47 3 40596 AEV_3_3_RA3_01_1233.d 1.89E5 2 2 531 540
R.DSTGAMEPTNIK.R Y 42.10 1262.5813 12 8.2 632.3031 2 50.33 3 25976 AEV_3_3_RA3_01_1233.d 1.49E5 2 2 366 377
R.VWDISGLR.K Y 40.19 944.5079 8 12.3 473.2670 2 74.27 2 36083 AEV_1_3_RA2_01_1232.d 1.74E5 3 3 122 129
R.NS(-2.02)PLAADHVAAGSFDTAMQLLNR.Q Y 39.60 2396.1543 23 9.9 799.7333 3 83.33 2 43120 AEV_1_3_RA2_01_1232.d 0 1 1 868 890 2-amino-3-oxo-butanoic_acid
R.TVSYNPAER(+.98).A Y 39.26 1036.4825 9 -71.5 519.2115 2 47.20 1 18605 AEV 2_3_RA2_01_1224.d 2.59E5 1 1 337 345 Deamidation (R)
K.VASHSSFER.A Y 38.09 1018.4832 9 1.1 510.2494 2 15.76 3 5534 AEV_3_3_RA3_01_1233.d 2.07E5 3 3 780 788
R.NVLPIIPR.D Y 37.97 920.5807 8 -106.8 461.2485 2 80.56 1 42280 AEV 2_3_RA2_01_1224.d 0 1 1 939 946
R.GVNWVSFHPTLPLIVS(+340.09)AGDDR.L Y 37.95 2619.2556 21 -18.2 655.8093 4 92.38 1 51326 AEV 2_3_RA2_01_1224.d 0 1 1 173 193 Phosphopantetheine
R.RTVEESDLR.N Y 37.36 1103.5571 9 -84.0 368.8287 3 40.76 1 14858 AEV 2_3_RA2_01_1224.d 3.87E5 1 1 930 938
K.TQPLFVSGGDDYK.I Y 35.77 1425.6776 13 20.4 713.8606 2 67.36 2 30907 AEV_1_3_RA2_01_1232.d 3.2E4 2 2 23 35
K.YSLLNGDN(+.98)GIVR.T Y 35.17 1320.6674 12 -7.6 661.3359 2 74.77 2 36449 AEV_1_3_RA2_01_1232.d 5.39E4 2 2 519 530 Deamidation (NQ)
R.GIDFHK.T Y 31.11 715.3653 6 -92.3 716.3065 1 41.74 1 15412 AEV 2_3_RA2_01_1224.d 3.86E4 1 1 17 22
K.HSAPTSSLSFEDQMAR.A Y 29.73 1762.7944 16 -56.6 588.5721 3 71.55 1 35139 AEV 2_3_RA2_01_1224.d 0 1 1 132 147
K.LALIK.R N 29.27 556.3948 5 3.4 557.4039 1 50.51 2 20700 AEV_1_3_RA2_01_1232.d 3.58E5 2 2 569 573
R.VWDLNKR.T Y 29.00 929.5083 7 -15.5 310.8386 3 26.07 3 11178 AEV_3_3_RA3_01_1233.d 2.44E6 3 3 241 247
R.FLEIYQATK.T Y 27.93 1111.5913 9 -89.9 556.7530 2 76.99 1 39444 AEV 2_3_RA2_01_1224.d 1.14E5 1 1 904 912
K.AWEVDTC(+57.02)R.G Y 27.60 1035.4443 8 -48.7 518.7042 2 36.86 1 12634 AEV 2_3_RA2_01_1224.d 0 1 1 205 212 Carbamidomethylation
R.TVSYNP(+13.98)AER.A Y 27.40 1049.4778 9 -78.1 525.7052 2 55.84 1 23728 AEV 2_3_RA2_01_1224.d 0 1 1 337 345 Proline oxidation to pyroglutamic acid
K.R(+14.02)TSVQSFK.R Y 26.92 965.5294 8 2.8 322.8513 3 21.17 3 8466 AEV_3_3_RA3_01_1233.d 2.38E5 1 1 247 254 Methylation(KR)
R.SLELSAYFTIPK.L Y 26.61 1367.7336 12 -19.5 342.9340 4 45.07 3 22602 AEV_3_3_RA3_01_1233.d 3.79E4 1 1 1030 1041
R.TVSYNPAER(+14.02).A Y 26.33 1049.5142 9 -11.1 525.7585 2 44.25 2 17563 AEV_1_3_RA2_01_1232.d 2.34E5 2 2 337 345 Methylation(KR)
K.FVLEGHDR.G Y 26.02 971.4824 8 -89.4 324.8058 3 58.07 1 25142 AEV 2_3_RA2_01_1224.d 1.2E5 1 1 165 172
R.TSVQSFKR.D Y 25.84 951.5137 8 -86.7 318.1510 3 37.62 1 13064 AEV 2_3_RA2_01_1224.d 3.97E5 2 2 248 255
R.M(+43.01)IANGGVAK(+42.01).F Y 25.70 944.4749 9 -41.2 473.2253 2 78.66 1 40768 AEV 2_3_RA2_01_1224.d 5.7E4 1 1 1074 1082 Carbamylation; Acetylation (K)
K.TLEHVST(+79.97)LHETIR.I Y 25.42 1614.7766 13 38.3 404.7169 4 58.81 3 31531 AEV_3_3_RA3_01_1233.d 0 1 1 485 497 Phosphorylation (STY)
R.LGTEALSHGNHQTLEMTYQK.Q Y 24.72 2257.0798 20 0.2 565.2773 4 62.55 3 34388 AEV_3_3_RA3_01_1233.d 2.02E5 2 2 645 664
K.LIRMAKISEHR.G Y 24.11 1352.7710 11 -48.6 339.1836 4 32.87 3 15073 AEV_3_3_RA3_01_1233.d 7.03E4 1 1 684 694
K.L(+43.01)ALIK.R N 23.18 599.4006 5 -5.4 600.4047 1 35.72 2 13425 AEV_1_3_RA2_01_1232.d 1.63E5 3 3 569 573 Carbamylation
K.QNFSS(+79.97)ALSFAN(+.98)R.M Y 22.50 1421.5977 12 43.0 474.8936 3 75.13 1 37975 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 1062 1073 Phosphorylation (STY); Deamidation (NQ)
R.A(+42.01)IGTDTPEK(+31.99).L Y 22.30 1004.4662 9 -53.0 503.2137 2 86.28 1 46784 AEV 2_3_RA2_01_1224.d 0 1 1 1018 1026 Acetylation (N-term); Dihydroxy
R.FEEHDGPVR.G Y 21.99 1084.4938 9 -57.9 543.2228 2 25.57 1 6796 AEV 2_3_RA2_01_1224.d 4.94E4 1 1 8 16
R.EYILAMSIELER(+14.02)R.A Y 21.53 1635.8654 13 -9.5 546.2905 3 75.28 3 44348 AEV_3_3_RA3_01_1233.d 9.62E4 1 1 1005 1017 Methylation(KR)
K.IKVWSYQTR.R Y 21.26 1179.6400 9 13.3 394.2259 3 12.11 2 3262 AEV_1_3_RA2_01_1232.d 3.33E4 1 1 36 44
K.EDLIVSASLDQSVR.V Y 21.20 1530.7889 14 5.8 511.2732 3 68.15 2 31472 AEV_1_3_RA2_01_1232.d 9.63E4 2 2 108 121
R.LF(+31.99)VSGKP Y 20.80 778.4225 7 -102.4 390.1786 2 55.48 1 23475 AEV 2_3_RA2_01_1224.d 9.64E4 1 1 1164 1170 Dihydroxy
R.SLELSAYFT(+79.97)IPK.L Y 20.63 1447.7000 12 -1.4 483.5732 3 42.61 3 21039 AEV_3_3_RA3_01_1233.d 0 1 1 1030 1041 Phosphorylation (STY)
K.HNVT(+79.97)IVTK(+21.98).T Y 20.30 1012.4719 8 73.0 1013.5530 1 110.68 1 58953 AEV 2_3_RA2_01_1224.d 2.25E5 1 1 477 484 Phosphorylation (STY); Sodium adduct
R.G(+43.01)IDFHK.T Y 19.96 758.3711 6 9.2 380.1963 2 9.40 2 2286 AEV_1_3_RA2_01_1232.d 8.22E3 1 1 17 22 Carbamylation
K.VFLFDIQ(+.98)Q(+.98)K.K Y 19.55 1138.5909 9 -35.8 570.2823 2 46.18 2 18522 AEV_1_3_RA2_01_1232.d 1.37E4 1 1 440 448 Deamidation (NQ)
R.LFVSGKP Y 19.46 746.4326 7 -3.3 374.2224 2 49.40 3 25352 AEV_3_3_RA3_01_1233.d 1.8E5 1 1 1164 1170
R.AIGTDTPEK.L Y 19.44 930.4658 9 -100.0 466.1937 2 68.62 1 32906 AEV 2_3_RA2_01_1224.d 2.02E5 2 2 1018 1026
K.HSAPTSSLSFEDQM(+15.99)AR.A Y 19.25 1778.7893 16 36.2 445.7207 4 74.18 1 37219 AEV 2_3_RA2_01_1224.d 0 1 1 132 147 Oxidation (M)
R.VRARNVYC(+57.02)LDRTAKPIILEIDPTEYR.F Y 19.22 3160.6814 26 4.1 791.1808 4 94.81 3 57136 AEV_3_3_RA3_01_1233.d 0 1 1 541 566 Carbamidomethylation
K.L(+314.19)GSPWVPPR.T Y 19.15 1321.7434 9 17.4 331.4489 4 56.64 3 29963 AEV_3_3_RA3_01_1233.d 2.95E4 1 1 328 336 Levuglandinyl-lysine anhydrolactam adduct
K.QRLFD(-18.01)KLSFLYLATGDK.E Y 19.07 1996.0781 17 -36.5 500.0086 4 70.21 3 40389 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 665 681 Dehydration
R.VWD(-18.01)LNK(+42.01).R Y 19.03 797.4072 6 3.5 399.7122 2 30.33 3 13576 AEV_3_3_RA3_01_1233.d 1.79E5 1 1 241 246 Dehydration; Acetylation (K)
R.R(+42.01)AIGTDT(+79.97)PEK.L Y 18.97 1208.5438 10 17.1 303.1484 4 28.19 1 8040 AEV 2_3_RA2_01_1224.d 0 1 1 1017 1026 Acetylation (N-term); Phosphorylation (STY)
K.HNVTIVTK(+14.02)TLEHVST(+79.97)LHETIR.I Y 18.94 2521.3054 21 5.1 631.3369 4 85.05 3 51730 AEV_3_3_RA3_01_1233.d 0 1 1 477 497 Methylation(KR); Phosphorylation (STY)
R.ANANQADM(+15.99)FGNTDAVVKFVLEGHDR.G Y 18.93 2734.2769 25 -20.5 684.5625 4 92.32 1 51287 AEV 2_3_RA2_01_1224.d 2.55E5 1 1 148 172 Oxidation (M)
R.SPQD(-18.01)K.I Y 18.77 555.2653 5 -88.3 556.2235 1 57.36 1 24654 AEV 2_3_RA2_01_1224.d 3.97E4 1 1 1097 1101 Dehydration
R.MIAN(+.98)GGVAK.F Y 18.43 860.4426 9 -67.7 431.1994 2 26.74 1 7340 AEV 2_3_RA2_01_1224.d 0 2 2 1074 1082 Deamidation (NQ)
K.Y(+31.99)SLLNGDNGIVR.T Y 18.40 1351.6732 12 6.2 338.9277 4 56.79 2 23994 AEV_1_3_RA2_01_1232.d 5.82E4 1 1 519 530 Dihydroxy
R.VSQVTEVGAPAS(+114.04)GLR.L Y 18.19 1583.8267 15 -51.2 396.9437 4 83.01 1 44196 AEV 2_3_RA2_01_1224.d 5.95E4 1 1 1149 1163 Ubiquitin
R.LFVS(+79.97)GK(+14.02)P Y 18.18 840.4146 7 -22.3 421.2052 2 80.68 1 42371 AEV 2_3_RA2_01_1224.d 3.25E4 1 1 1164 1170 Phosphorylation (STY); Methylation(KR)
R.SPQDK(+14.02).I Y 18.12 587.2914 5 -3.8 588.2965 1 19.34 3 7476 AEV_3_3_RA3_01_1233.d 3.93E4 1 1 1097 1101 Methylation(KR)
R.NVYC(+57.02)LDR.T Y 18.08 938.4280 7 -85.8 470.1810 2 59.12 1 25854 AEV 2_3_RA2_01_1224.d 1.47E5 1 1 545 551 Carbamidomethylation
K.VASHSSFER(+.98).A Y 18.06 1019.4672 9 -69.9 340.8059 3 28.90 1 8407 AEV 2_3_RA2_01_1224.d 2.16E5 1 1 780 788 Deamidation (R)
R.TVSYN(+.98)PAER.A Y 17.87 1036.4825 9 -69.2 519.2127 2 46.87 1 18392 AEV 2_3_RA2_01_1224.d 2.59E5 1 1 337 345 Deamidation (NQ)
K.RGHGTSAVFVAR(+21.98).N Y 17.65 1278.6558 12 -3.5 427.2244 3 36.82 3 17465 AEV_3_3_RA3_01_1233.d 0 1 1 378 389 Sodium adduct
R.AIGTDT(-18.01)PEK.L Y 17.64 912.4553 9 -64.4 457.2055 2 68.77 1 33026 AEV 2_3_RA2_01_1224.d 7.64E4 2 2 1018 1026 Dehydration
R.L(+42.01)FVSGK(+14.02)P Y 17.57 802.4589 7 -65.9 402.2103 2 60.01 3 32430 AEV_3_3_RA3_01_1233.d 0 1 1 1164 1170 Acetylation (N-term); Methylation(KR)
R.RAIGT(+42.01)DTPEK.L Y 17.52 1128.5775 10 6.6 377.2023 3 11.33 2 2969 AEV_1_3_RA2_01_1232.d 0 1 1 1017 1026 Acetylation (TSCYH)
R.E(+21.98)YILAMSIELER.R Y 17.49 1487.7306 12 -25.6 372.9304 4 70.99 2 33590 AEV_1_3_RA2_01_1232.d 3.52E4 1 1 1005 1016 Sodium adduct
R.FLEIYQAT(+27.05)K.T Y 17.48 1138.6385 9 22.2 380.5619 3 62.21 2 27340 AEV_1_3_RA2_01_1232.d 9.96E4 1 1 904 912 Ethyl amino
K.Y(+79.97)SLLNGDN(+.98)GIVR.T Y 17.29 1400.6337 12 -55.4 467.8593 3 44.05 1 16721 AEV 2_3_RA2_01_1224.d 0 1 1 519 530 Phosphorylation (STY); Deamidation (NQ)
R.TSVQSFK.R Y 17.23 795.4127 7 -15.1 398.7076 2 9.44 3 2325 AEV_3_3_RA3_01_1233.d 3.15E4 1 1 248 254
R.VQM(+15.99)FK.E Y 17.14 667.3363 5 -83.5 668.2878 1 94.55 1 52852 AEV 2_3_RA2_01_1224.d 1.07E5 1 1 714 718 Oxidation (M)
K.VWSYQ(+.98)TR(+14.02).R Y 17.14 953.4607 7 12.7 318.8315 3 8.28 2 1951 AEV_1_3_RA2_01_1232.d 0 1 1 38 44 Deamidation (NQ); Methylation(KR)
K.L(+42.01)S(+79.97)FLYLATGDK.E Y 17.08 1348.6316 11 -41.7 338.1511 4 68.95 1 33154 AEV 2_3_RA2_01_1224.d 0 1 1 671 681 Acetylation (N-term); Phosphorylation (STY)
R.SPQDK(-.98).I Y 16.78 572.2918 5 -71.3 573.2583 1 67.82 1 32290 AEV 2_3_RA2_01_1224.d 0 1 1 1097 1101 Amidation
K.YVVWSNDGLYAALLSK.H Y 16.72 1797.9301 16 -0.7 899.9717 2 86.74 2 45455 AEV_1_3_RA2_01_1232.d 2.78E4 1 1 461 476
R.NVYC(+57.02)LD(-18.01)R.T Y 16.68 920.4174 7 14.0 307.8174 3 44.40 1 16937 AEV 2_3_RA2_01_1224.d 8.69E4 1 1 545 551 Carbamidomethylation; Dehydration
R.FLEIYQAT(+79.97)K(+28.03).T Y 16.44 1219.5890 9 18.7 305.9102 4 15.30 3 5283 AEV_3_3_RA3_01_1233.d 0 1 1 904 912 Phosphorylation (STY); Dimethylation(KR)
R.FAVFN(+.98)QSTQQID(+21.98)IK.D Y 16.42 1660.8073 14 -47.4 416.1894 4 63.07 1 28831 AEV 2_3_RA2_01_1224.d 1.55E4 1 1 392 405 Deamidation (NQ); Sodium adduct
K.EDLIVSASLD(-18.01)QSVR.V Y 16.38 1512.7783 14 11.4 757.4050 2 80.58 2 41019 AEV_1_3_RA2_01_1232.d 0 1 1 108 121 Dehydration
K.AWEVDTC(+57.02)R(+31.99).G Y 16.33 1067.4342 8 8.6 534.7289 2 60.27 1 26689 AEV 2_3_RA2_01_1224.d 0 1 1 205 212 Carbamidomethylation; Dihydroxy
K.LQVAHR.Q Y 16.31 722.4188 6 3.9 723.4288 1 82.32 2 42360 AEV_1_3_RA2_01_1232.d 3.6E5 1 1 1042 1047
R.MIANGGVAK(-.98).F Y 16.24 858.4745 9 -135.0 430.1866 2 33.22 1 10759 AEV 2_3_RA2_01_1224.d 0 1 1 1074 1082 Amidation
K.KQ(+.98)LAELTVS(+79.97)GVK(+14.02).Y Y 16.15 1366.7108 12 -10.0 684.3558 2 83.37 3 50576 AEV_3_3_RA3_01_1233.d 9.93E3 1 1 449 460 Deamidation (NQ); Phosphorylation (STY); Methylation(KR)
K.RGHGTSAVFVAR.N Y 16.14 1256.6738 12 -103.0 315.1434 4 42.86 1 16074 AEV 2_3_RA2_01_1224.d 0 1 1 378 389
R.MIANGGVAK(+42.01).F Y 16.13 901.4691 9 -7.3 451.7385 2 51.27 3 26553 AEV_3_3_RA3_01_1233.d 0 1 1 1074 1082 Acetylation (K)
K.IITTAR.E Y 16.10 673.4122 6 -35.9 674.3953 1 99.47 2 50849 AEV_1_3_RA2_01_1232.d 2.11E4 1 1 999 1004
R.DSTGAMEPTNIK(+88.00).R Y 16.00 1350.5796 12 17.3 451.2083 3 59.41 1 26110 AEV 2_3_RA2_01_1224.d 0 1 1 366 377 3-sulfanylpropanoyl
K.IS(-18.01)EHR.G N 15.55 622.3187 5 -78.9 312.1421 2 59.72 1 26273 AEV 2_3_RA2_01_1224.d 1.66E5 1 1 690 694 Dehydration
K.L(+27.99)SFLYLATGDK.E Y 15.50 1254.6495 11 -36.9 419.2084 3 76.88 1 39363 AEV 2_3_RA2_01_1224.d 6.81E4 1 1 671 681 Formylation
K.TSSLVGQSIISY(+162.05)LQK.K Y 15.42 1784.9407 15 -2.0 595.9863 3 78.11 3 46585 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 585 599 Hexose (NSY)
K.TLEHVSTLHETIR.I Y 15.39 1534.8103 13 -16.6 768.3997 2 87.36 3 53249 AEV_3_3_RA3_01_1233.d 0 1 1 485 497
R.M(+43.01)IANGGVAKFLDEARK(+42.01).V Y 15.29 1803.9301 16 -16.1 602.3076 3 70.60 3 40740 AEV_3_3_RA3_01_1233.d 1.37E5 1 1 1074 1089 Carbamylation; Acetylation (K)
R.AAMKLAFAKQNFSSALSFANRM(+15.99)IANGGVAK.F Y 15.16 3129.6216 30 -32.0 626.9116 5 52.23 2 21587 AEV_1_3_RA2_01_1232.d 0 1 1 1053 1082 Oxidation (M)
K.TSSLVGQSIIS(+95.94)YLQKK.G Y 15.11 1846.9264 16 13.5 462.7451 4 45.81 3 23064 AEV_3_3_RA3_01_1233.d 0 1 1 585 600 Thiophosphorylation
K.H(+42.01)S(+79.97)APTSSLSFEDQMAR(+14.02).A Y 15.07 1898.7870 16 5.8 950.4062 2 64.78 1 30085 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 132 147 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
R.VSQVTE(+21.98)VGAPASGLR.L Y 15.06 1491.7657 15 31.8 498.2783 3 64.27 2 28745 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 1149 1163 Sodium adduct
total 108 peptides
C1G5V6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.TGEIVDVPVGPELLGR.V Y 110.19 1649.8988 16 1.7 825.9581 2 82.62 2 42592 AEV_1_3_RA2_01_1232.d 6.1E5 4 4 137 152
R.IRGVQEEAGLAETGR.V Y 109.60 1584.8219 15 7.4 529.2852 3 55.94 3 29509 AEV_3_3_RA3_01_1233.d 1.99E5 3 3 62 76
R.VVDALGNPIDGKGPIKTTEK.R Y 101.31 2051.1262 20 -2.5 513.7875 4 64.07 3 35555 AEV_3_3_RA3_01_1233.d 1.79E5 1 1 153 172
R.EAYPGDVFYLHSR.L Y 100.97 1552.7310 13 0.6 518.5846 3 72.21 2 34505 AEV_1_3_RA2_01_1232.d 1.09E6 4 4 338 350
K.GIRPAINVGLSVSR.V Y 100.16 1437.8416 14 -5.3 480.2852 3 68.59 3 39147 AEV_3_3_RA3_01_1233.d 3.03E5 4 4 406 419
K.AAPTEVSSILEQR.I Y 98.09 1399.7307 13 -3.3 700.8703 2 71.30 3 41248 AEV_3_3_RA3_01_1233.d 5.62E5 5 5 49 61
R.VVDALGNPIDGKGPIK.T Y 94.69 1591.8933 16 -5.5 531.6354 3 68.28 2 31570 AEV_1_3_RA2_01_1232.d 2.89E5 2 2 153 168
K.ILQWESDFLAHLK.S Y 84.74 1598.8456 13 10.8 533.9615 3 84.06 3 51058 AEV_3_3_RA3_01_1233.d 4.49E5 3 3 507 519
R.SVNQPVQTGLK.S Y 81.49 1169.6404 11 -5.0 585.8245 2 43.46 3 21614 AEV_3_3_RA3_01_1233.d 9.6E5 5 5 187 197
R.AQLKAPGILPR.R Y 80.94 1162.7186 11 -1.2 388.5797 3 62.35 3 34232 AEV_3_3_RA3_01_1233.d 5.84E5 2 2 175 185
R.GVQEEAGLAETGR.V Y 76.45 1315.6367 13 -0.1 658.8256 2 51.65 3 26821 AEV_3_3_RA3_01_1233.d 5.04E5 5 5 64 76
R.RSVNQPVQTGLK.S Y 76.37 1325.7416 12 -1.1 663.8773 2 34.71 3 16158 AEV_3_3_RA3_01_1233.d 1.96E6 9 9 186 197
K.SVDSM(+15.99)VPIGR.G Y 68.85 1075.5332 10 2.2 538.7751 2 52.19 3 27240 AEV_3_3_RA3_01_1233.d 8.68E5 6 6 198 207 Oxidation (M)
R.VLSVGDGIAR.V Y 66.57 985.5556 10 2.6 493.7864 2 61.99 2 27176 AEV_1_3_RA2_01_1232.d 7.71E5 6 6 77 86
R.HALIIYDDLSK.Q Y 66.57 1286.6870 11 -81.2 429.8681 3 78.39 1 40557 AEV 2_3_RA2_01_1224.d 4.38E5 3 3 309 319
K.SVDSMVPIGR.G Y 66.53 1059.5382 10 9.2 530.7812 2 65.79 3 36967 AEV_3_3_RA3_01_1233.d 2.77E5 3 3 198 207
R.TGEIVDVPVGPELLGR(+14.02).V Y 66.41 1663.9144 16 0.1 832.9646 2 83.15 3 50414 AEV_3_3_RA3_01_1233.d 7.18E4 2 2 137 152 Methylation(KR)
R.GVQEEAGLAETGRVLSVGDGIAR.V Y 63.89 2283.1819 23 12.6 762.0775 3 76.63 3 45400 AEV_3_3_RA3_01_1233.d 0 1 1 64 86
K.TAVALDAMLNQKR.W Y 58.59 1429.7711 13 -0.2 477.5975 3 67.30 3 38088 AEV_3_3_RA3_01_1233.d 2.04E5 1 1 222 234
K.TAVALDAM(+15.99)LNQKR.W Y 55.74 1445.7660 13 -2.9 482.9279 3 54.00 3 28356 AEV_3_3_RA3_01_1233.d 3.21E5 1 1 222 234 Oxidation (M)
R.RSVNQPVQ(+.98)TGLK.S Y 53.40 1326.7256 12 4.0 443.2509 3 36.64 3 17349 AEV_3_3_RA3_01_1233.d 1.24E5 2 2 186 197 Deamidation (NQ)
R.VGSAAQLK.A Y 51.90 772.4443 8 -11.4 387.2250 2 18.90 3 7268 AEV_3_3_RA3_01_1233.d 8.09E4 3 3 420 427
R.STVAQLVK.T Y 48.75 844.5018 8 -1.8 423.2574 2 45.74 3 23019 AEV_3_3_RA3_01_1233.d 1.22E6 6 6 257 264
R.GVQ(+.98)EEAGLAETGR.V Y 48.04 1316.6207 13 -2.4 659.3160 2 52.29 3 27245 AEV_3_3_RA3_01_1233.d 0 1 1 64 76 Deamidation (NQ)
R.GVQEEAGLAETGR(+14.02).V Y 46.72 1329.6525 13 -3.4 665.8312 2 60.05 3 32457 AEV_3_3_RA3_01_1233.d 3.92E4 1 1 64 76 Methylation(KR)
R.E(+14.02)AYPGDVFYLHSR.L Y 45.98 1566.7466 13 -1.1 523.2556 3 73.57 3 43057 AEV_3_3_RA3_01_1233.d 2.15E5 2 2 338 350 Methylation(others)
R.ELIIGDRQTGK.T Y 45.35 1228.6775 11 1.2 615.3467 2 42.75 3 21129 AEV_3_3_RA3_01_1233.d 8.98E5 5 5 211 221
R.GVQE(+14.02)EAGLAETGR.V Y 44.97 1329.6525 13 -2.0 665.8322 2 57.88 3 30867 AEV_3_3_RA3_01_1233.d 2.34E4 1 1 64 76 Methylation(others)
R.AQ(+.98)LKAPGILPR.R Y 41.24 1163.7026 11 12.6 388.9130 3 62.41 3 34280 AEV_3_3_RA3_01_1233.d 7.17E4 1 1 175 185 Deamidation (NQ)
R.RSVNQ(+.98)PVQTGLK.S Y 39.93 1326.7256 12 -29.0 443.2363 3 38.26 3 18351 AEV_3_3_RA3_01_1233.d 0 3 3 186 197 Deamidation (NQ)
R.LTELLK.Q Y 39.85 715.4480 6 -2.9 358.7303 2 52.72 3 27575 AEV_3_3_RA3_01_1233.d 8E5 5 5 470 475
R.ELIIGDR.Q Y 37.84 814.4548 7 -88.6 408.1986 2 64.99 1 30158 AEV 2_3_RA2_01_1224.d 6.61E5 4 4 211 217
R.VVDALGNPIDGK.G Y 37.38 1196.6400 12 -80.5 599.2791 2 65.20 3 36537 AEV_3_3_RA3_01_1233.d 8.1E4 3 3 153 164
K.APGILPR.R Y 37.15 722.4438 7 -127.3 362.1832 2 64.01 1 29616 AEV 2_3_RA2_01_1224.d 0 1 1 179 185
K.IEKEGQLSKDLEAQLKDVIVAFNK.S Y 35.51 2714.4854 24 17.6 543.9139 5 84.66 3 51467 AEV_3_3_RA3_01_1233.d 0 1 1 529 552
K.AAPTEVSS(+14.02)ILEQR.I Y 32.53 1413.7463 13 -5.1 472.2537 3 74.28 3 43568 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 49 61 Methylation(others)
K.SNEPEVLEK.I Y 31.59 1043.5134 9 0.7 522.7643 2 38.54 3 18528 AEV_3_3_RA3_01_1233.d 6.36E5 3 3 520 528
K.TAVALDAMLNQK.R Y 30.07 1273.6700 12 -86.8 319.3972 4 60.93 1 27169 AEV 2_3_RA2_01_1224.d 2.32E5 1 1 222 233
K.AAPTEVSSILEQR(+14.02).I Y 28.97 1413.7463 13 -2.1 472.2551 3 73.44 3 42933 AEV_3_3_RA3_01_1233.d 4.72E4 2 2 49 61 Methylation(KR)
R.GQRELIIGDRQTGK.T Y 28.73 1569.8586 14 -18.1 524.2840 3 37.27 3 17749 AEV_3_3_RA3_01_1233.d 3.02E5 1 1 208 221
R.LVKEGET(+79.96)VKR.T Y 28.43 1237.6335 10 1.7 413.5525 3 34.47 3 16016 AEV_3_3_RA3_01_1233.d 7.66E4 1 1 127 136 Sulfation
K.LFLAQYREVAAFAQFGSDLDASTK.Q Y 28.22 2647.3281 24 -5.0 883.4456 3 87.39 3 53230 AEV_3_3_RA3_01_1233.d 3.58E4 1 1 438 461
K.EGQLSKDLEAQLKDVIVAFNK.S Y 27.90 2344.2637 21 6.7 587.0771 4 87.32 2 45809 AEV_1_3_RA2_01_1232.d 8.05E4 1 1 532 552
R.EVAAFAQFGSDLDASTK(+226.08).Q Y 27.15 1981.9091 17 -16.8 496.4762 4 80.62 1 42322 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 445 461 Biotinylation
K.LFLAQYR.E Y 26.52 909.5072 7 1.2 455.7614 2 69.36 2 32392 AEV_1_3_RA2_01_1232.d 1.64E5 3 3 438 444
R.TYAAEAK.A Y 26.15 752.3704 7 24.1 753.3958 1 68.84 2 31982 AEV_1_3_RA2_01_1232.d 5.53E3 1 1 42 48
R.SVN(+.98)QPVQT(+79.97)GLK.S Y 25.74 1250.5908 11 -41.7 626.2766 2 62.93 1 28728 AEV 2_3_RA2_01_1224.d 2.05E5 2 2 187 197 Deamidation (NQ); Phosphorylation (STY)
R.SVTAVC(+57.02)AS(+79.97)GR(+14.02).I Y 25.38 1100.4685 10 43.6 367.8461 3 50.91 1 20721 AEV 2_3_RA2_01_1224.d 0 1 1 12 21 Carbamidomethylation; Phosphorylation (STY); Methylation(KR)
K.RSTVAQ(+.98)LVK(+42.01).T Y 25.21 1043.5975 9 -52.7 348.8548 3 34.12 3 15798 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 256 264 Deamidation (NQ); Acetylation (K)
R.E(+14.02)LIIGDRQTGK.T Y 24.93 1242.6931 11 -28.4 622.3362 2 50.12 3 25806 AEV_3_3_RA3_01_1233.d 0 1 1 211 221 Methylation(others)
K.DVIVAFNK(+21.98).S Y 24.77 926.4837 8 -1.3 927.4898 1 87.84 2 46109 AEV_1_3_RA2_01_1232.d 0 1 1 545 552 Sodium adduct
MFRNALRQSSR.S Y 24.24 1364.7095 11 12.6 683.3706 2 41.50 3 20359 AEV_3_3_RA3_01_1233.d 1.69E5 2 2 1 11
K.TAVALDAMLNQK(+27.99).R Y 23.97 1301.6649 12 17.3 326.4291 4 77.07 1 39504 AEV 2_3_RA2_01_1224.d 8.46E4 1 1 222 233 Formylation
R.N(+.98)ALRQSSR.S Y 23.88 931.4835 8 -4.1 932.4870 1 92.04 3 55811 AEV_3_3_RA3_01_1233.d 6.79E3 1 1 4 11 Deamidation (NQ)
K.TAVALDAMLNQ(+.98)K(+226.08).R Y 22.41 1500.7316 12 36.8 501.2696 3 35.65 2 13373 AEV_1_3_RA2_01_1232.d 0 1 1 222 233 Deamidation (NQ); Biotinylation
R.T(+79.97)GEIVDVPVGPELLGR(+14.02).V Y 22.29 1743.8807 16 41.8 582.3251 3 77.78 2 38795 AEV_1_3_RA2_01_1232.d 0 1 1 137 152 Phosphorylation (STY); Methylation(KR)
R.NALRQSSRS(+79.97)VTAVCASGR.I Y 21.26 1941.9204 18 17.9 648.3257 3 77.36 2 38461 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 4 21 Phosphorylation (STY)
K.L(+226.08)NDKHK.G Y 20.98 979.4909 6 10.6 980.5086 1 89.99 3 54749 AEV_3_3_RA3_01_1233.d 4.42E4 1 1 358 363 Biotinylation
R.VGSAAQ(+.98)LKAMK(+28.03).Q Y 20.73 1131.6322 11 -0.8 566.8229 2 78.33 2 39278 AEV_1_3_RA2_01_1232.d 8.39E4 1 1 420 430 Deamidation (NQ); Dimethylation(KR)
K.TLEENDAMK.Y Y 20.34 1049.4700 9 -58.6 525.7115 2 40.21 1 14529 AEV 2_3_RA2_01_1224.d 0 1 1 265 273
R.ELIIGDR(+14.02).Q Y 20.19 828.4705 7 -11.4 415.2378 2 52.74 3 27545 AEV_3_3_RA3_01_1233.d 0 1 1 211 217 Methylation(KR)
K.Q(+42.01)TLNR.G Y 20.04 672.3555 5 -86.5 337.1559 2 26.92 1 7427 AEV 2_3_RA2_01_1224.d 0 1 1 462 466 Acetylation (N-term)
R.L(+42.01)VKEGETVKR.T Y 19.95 1199.6874 10 -11.9 400.8983 3 63.27 3 34944 AEV_3_3_RA3_01_1233.d 0 1 1 127 136 Acetylation (N-term)
R.STVAQLVK(+28.03)TLEENDAM(+15.99)K.Y Y 19.91 1919.9873 17 -58.3 480.9761 4 82.86 1 44071 AEV 2_3_RA2_01_1224.d 0 1 1 257 273 Dimethylation(KR); Oxidation (M)
R.EAYPGDVFYLHSR(+14.02).L Y 19.73 1566.7466 13 8.6 523.2606 3 72.38 2 34641 AEV_1_3_RA2_01_1232.d 5.46E4 1 1 338 350 Methylation(KR)
R.L(+43.01)TELLK.Q Y 19.68 758.4538 6 -1.8 380.2335 2 55.39 2 23210 AEV_1_3_RA2_01_1232.d 0 1 1 470 475 Carbamylation
R.R(+42.01)SVNQPVQTGLK(+42.01)SVDSMVPIGRGQR.E Y 19.66 2792.4714 25 4.8 699.1285 4 81.25 2 41551 AEV_1_3_RA2_01_1232.d 1.37E5 1 1 186 210 Acetylation (N-term); Acetylation (K)
K.TAVALDAMLN(+.98)QK(+14.02).R Y 19.38 1288.6697 12 -55.2 645.3065 2 45.07 3 22606 AEV_3_3_RA3_01_1233.d 0 1 1 222 233 Deamidation (NQ); Methylation(KR)
R.WNDTGDETK(+27.99).K Y 19.32 1092.4359 9 -32.9 547.2073 2 38.46 1 13533 AEV 2_3_RA2_01_1224.d 5.15E4 1 1 235 243 Formylation
K.Q(+27.99)(+.98)AVAYR.Q Y 19.30 735.3551 6 46.2 736.3964 1 80.38 2 40866 AEV_1_3_RA2_01_1232.d 0 1 1 320 325 Formylation; Deamidation (NQ)
K.SNEPEVLEK(+43.01).I Y 19.23 1086.5193 9 -67.8 363.1558 3 38.02 1 13281 AEV 2_3_RA2_01_1224.d 0 1 1 520 528 Carbamylation
R.TGEIVDVPVGP(+13.98)ELLGR.V Y 19.19 1663.8781 16 -72.6 832.8859 2 88.31 1 48344 AEV 2_3_RA2_01_1224.d 1.23E5 1 1 137 152 Proline oxidation to pyroglutamic acid
K.SVDSM(-48.00)VPIGR.G Y 19.15 1011.5349 10 2.3 338.1863 3 35.48 3 16657 AEV_3_3_RA3_01_1233.d 4.95E5 1 1 198 207 Dethiomethyl
R.Q(+.98)MSLLLR.R Y 19.05 860.4789 7 -7.2 431.2437 2 69.20 3 39612 AEV_3_3_RA3_01_1233.d 0 1 1 326 332 Deamidation (NQ)
K.LNDK(+14.02)HK.G Y 19.02 767.4290 6 6.3 384.7242 2 62.56 1 28444 AEV 2_3_RA2_01_1224.d 0 1 1 358 363 Methylation(KR)
K.QTLN(-17.03)RGER.L Y 18.92 955.4835 8 1.1 478.7496 2 20.93 3 8322 AEV_3_3_RA3_01_1233.d 1.72E5 1 1 462 469 Ammonia-loss (N)
R.GVQEEAGLAET(+79.97)GR.V Y 18.82 1395.6031 13 -13.1 466.2022 3 39.27 1 13979 AEV 2_3_RA2_01_1224.d 0 1 1 64 76 Phosphorylation (STY)
R.VLSVGDGIAR(+14.02).V Y 18.69 999.5713 10 -33.0 334.1867 3 20.86 2 6769 AEV_1_3_RA2_01_1232.d 3.57E4 1 1 77 86 Methylation(KR)
K.TAVALDAM(+15.99)LNQK.R Y 18.63 1289.6649 12 1.3 645.8406 2 61.25 3 33389 AEV_3_3_RA3_01_1233.d 5.82E4 1 1 222 233 Oxidation (M)
K.TAVALDAMLN(+.98)QK.R Y 18.37 1274.6541 12 -6.6 638.3301 2 68.93 2 32099 AEV_1_3_RA2_01_1232.d 0 1 1 222 233 Deamidation (NQ)
R.VGSAAQLK(+14.02).A Y 18.25 786.4599 8 -188.9 787.3186 1 25.72 1 6865 AEV 2_3_RA2_01_1224.d 1.66E4 1 1 420 427 Methylation(KR)
K.TAVALDAMLNQK(+21.98).R Y 18.17 1295.6520 12 9.4 648.8394 2 75.89 3 44832 AEV_3_3_RA3_01_1233.d 2.54E4 1 1 222 233 Sodium adduct
R.H(+226.08)ALIIYDDLS(+79.97)K.Q Y 18.13 1592.7310 11 4.2 531.9198 3 64.69 2 29037 AEV_1_3_RA2_01_1232.d 7.03E4 1 1 309 319 Biotinylation; Phosphorylation (STY)
M(+15.99)FRNALR.Q Y 17.93 922.4807 7 6.5 462.2506 2 69.71 2 32631 AEV_1_3_RA2_01_1232.d 0 1 1 1 7 Oxidation (M)
K.KLYC(+57.02)VYVAVGQKR.S Y 17.91 1582.8654 13 -5.6 528.6261 3 78.70 3 47054 AEV_3_3_RA3_01_1233.d 4.06E4 1 1 244 256 Carbamidomethylation
R.V(+43.01)LSVGDGIAR.V Y 17.90 1028.5614 10 -98.8 515.2372 2 83.72 1 44767 AEV 2_3_RA2_01_1224.d 1.99E4 1 1 77 86 Carbamylation
R.WNDTGDETK.K Y 17.79 1064.4410 9 -57.4 533.1973 2 31.95 1 10059 AEV 2_3_RA2_01_1224.d 8.33E4 1 1 235 243
R.V(+27.99)VDALGNPIDGK(+14.02).G Y 17.75 1238.6506 12 -8.9 413.8871 3 41.63 3 20446 AEV_3_3_RA3_01_1233.d 1.21E5 1 1 153 164 Formylation; Methylation(KR)
R.VGS(+79.97)AAQ(+.98)LKAMK(+14.02).Q Y 17.24 1197.5829 11 8.2 300.4055 4 18.58 3 7106 AEV_3_3_RA3_01_1233.d 9.67E5 1 1 420 430 Phosphorylation (STY); Deamidation (NQ); Methylation(KR)
K.GPIK(+42.01)TTEK(+14.02).R Y 16.53 928.5229 8 -36.4 465.2519 2 55.33 3 29146 AEV_3_3_RA3_01_1233.d 0 1 1 165 172 Acetylation (K); Methylation(KR)
K.QTLNRGER(+14.02)LTELLK.Q Y 16.52 1683.9631 14 -52.8 562.2987 3 76.36 3 45188 AEV_3_3_RA3_01_1233.d 6.76E4 1 1 462 475 Methylation(KR)
R.S(+42.01)VTAVC(+57.02)ASGRIAGVR.G Y 16.47 1544.8093 15 -16.7 515.9351 3 41.27 3 20213 AEV_3_3_RA3_01_1233.d 5.68E5 1 1 12 26 Acetylation (Protein N-term); Carbamidomethylation
R.IRGVQ(+.98)E(+21.98)EAGLAETGR.V Y 16.45 1607.7878 15 6.7 402.9569 4 26.46 2 9142 AEV_1_3_RA2_01_1232.d 2.35E5 1 1 62 76 Deamidation (NQ); Sodium adduct
R.VLS(+79.97)VGDGIAR.V Y 16.43 1065.5220 10 -10.3 356.1776 3 46.22 1 18000 AEV 2_3_RA2_01_1224.d 6.31E5 1 1 77 86 Phosphorylation (STY)
R.Q(+.98)TGKT(+79.97)AVALDAMLNQKRWNDTGDET(+79.97)K.K Y 16.42 3051.3411 26 0.7 1018.1217 3 97.54 1 54703 AEV 2_3_RA2_01_1224.d 3.77E4 1 1 218 243 Deamidation (NQ); Phosphorylation (STY)
K.IEKE(+43.99)GQLSK.D Y 16.24 1074.5557 9 14.7 359.1978 3 11.43 2 3009 AEV_1_3_RA2_01_1232.d 2.49E4 1 1 529 537 Carboxylation (E)
K.A(+42.01)M(+15.99)KQVAGSLK.L Y 16.04 1089.5852 10 -22.1 364.1943 3 22.67 3 9256 AEV_3_3_RA3_01_1233.d 3.1E4 1 1 428 437 Acetylation (N-term); Oxidation (M)
R.QSSRSVTAVC(+57.02)ASGR(+31.99).I Y 15.95 1496.7002 14 -44.3 300.3340 5 63.97 1 29532 AEV 2_3_RA2_01_1224.d 1.98E5 1 1 8 21 Carbamidomethylation; Dihydroxy
R.HALIIYD(-18.01)DLSK(+42.01).Q Y 15.92 1310.6870 11 -5.3 328.6773 4 38.89 2 14935 AEV_1_3_RA2_01_1232.d 4.81E5 1 1 309 319 Dehydration; Acetylation (K)
R.VVDALGN(+.98)PIDGK.G Y 15.79 1197.6240 12 19.5 400.2231 3 59.72 2 25696 AEV_1_3_RA2_01_1232.d 7.36E4 1 1 153 164 Deamidation (NQ)
R.E(+43.01)VAAFAQFGSDLDASTK(+14.02).Q Y 15.73 1812.8529 17 -46.4 454.1995 4 80.31 1 42081 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 445 461 Carbamylation; Methylation(KR)
R.QTGKTAVALDAMLNQK(-.98)(+42.01).R Y 15.59 1728.9192 16 40.9 433.2548 4 64.19 3 35653 AEV_3_3_RA3_01_1233.d 0 1 1 218 233 Amidation; Acetylation (K)
K.TLEENDAM(+15.99)K.Y Y 15.48 1065.4648 9 -60.6 533.7074 2 21.02 1 5059 AEV 2_3_RA2_01_1224.d 7.87E3 1 1 265 273 Oxidation (M)
R.SVN(+.98)QPVQTGLK.S Y 15.45 1170.6244 11 -38.0 586.2972 2 48.03 3 24464 AEV_3_3_RA3_01_1233.d 2E5 1 1 187 197 Deamidation (NQ)
K.EGQLSK(+31.99).D Y 15.43 692.3340 6 -36.2 347.1618 2 50.91 1 20718 AEV 2_3_RA2_01_1224.d 6E4 1 1 532 537 Dihydroxy
R.S(+42.01)VTAVCASGR.I Y 15.33 991.4756 10 -114.8 496.6882 2 51.79 1 21229 AEV 2_3_RA2_01_1224.d 0 1 1 12 21 Acetylation (Protein N-term)
R.W(+42.01)N(+.98)DTGDETK.K Y 15.19 1107.4357 9 -26.5 1108.4136 1 96.16 1 53871 AEV 2_3_RA2_01_1224.d 2.12E4 1 1 235 243 Acetylation (N-term); Deamidation (NQ)
K.Q(+27.99)AVAYR.Q Y 15.03 734.3711 6 -20.6 735.3632 1 84.61 2 44045 AEV_1_3_RA2_01_1232.d 0 1 1 320 325 Formylation
total 108 peptides
C1GLM2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AANDLLNKDFYHTC(+57.02)AANLEVK.S Y 131.22 2406.1638 21 14.4 602.5569 4 74.50 2 36249 AEV_1_3_RA2_01_1232.d 1.3E6 3 3 13 33 Carbamidomethylation
R.SAHEGPISGSLESK.Y Y 119.93 1397.6786 14 5.2 466.9026 3 40.79 2 15857 AEV_1_3_RA2_01_1232.d 4.13E6 17 17 48 61
K.GLKAEILTQYLPSSQSK.G Y 112.67 1862.0149 17 1.5 621.6798 3 77.17 2 38310 AEV_1_3_RA2_01_1232.d 9.26E5 5 5 108 124
K.VGNTVGLEVSSK.Y Y 102.00 1188.6350 12 2.5 595.3263 2 54.59 2 22831 AEV_1_3_RA2_01_1232.d 1.81E6 8 8 228 239
R.GIAALAYNVLLRPGVTLGLGASFDTQK.L Y 97.27 2744.5225 27 -1.7 915.8466 3 91.40 3 55501 AEV_3_3_RA3_01_1233.d 1.24E5 2 2 256 282
K.AEILTQYLPSSQSK.G Y 78.71 1563.8145 14 -0.5 522.2785 3 75.22 2 36779 AEV_1_3_RA2_01_1232.d 4.44E5 5 5 111 124
K.LNLYFKQPNIHAR.A Y 78.39 1612.8838 13 -1.8 404.2275 4 66.02 3 37109 AEV_3_3_RA3_01_1233.d 1.27E6 4 4 128 140
K.GRSAHEGPISGSLESK.Y Y 74.25 1610.8011 16 3.2 537.9427 3 32.08 3 14624 AEV_3_3_RA3_01_1233.d 4.33E4 1 1 46 61
R.SAHEGPISGSLE(+14.02)SK.Y Y 71.17 1411.6943 14 0.5 706.8548 2 47.84 3 24350 AEV_3_3_RA3_01_1233.d 1.74E5 1 1 48 61 Methylation(others)
K.APNGVTFNVK.G Y 69.11 1045.5557 10 2.9 523.7866 2 59.41 2 25497 AEV_1_3_RA2_01_1232.d 8.22E5 4 4 36 45
K.SKAPN(+.98)GVTFNVK.G Y 69.10 1261.6666 12 -1.3 421.5623 3 49.12 3 25161 AEV_3_3_RA3_01_1233.d 1.29E6 10 10 34 45 Deamidation (NQ)
R.AFFDLLKGPTANIDAVLGHEGFLVGAEGGYDVQK.A Y 68.56 3547.7986 34 0.7 887.9576 4 91.37 3 55464 AEV_3_3_RA3_01_1233.d 5.01E5 2 2 141 174
R.VNAQVEAGAK.A Y 66.95 985.5192 10 -2.3 493.7657 2 21.35 2 6951 AEV_1_3_RA2_01_1232.d 4.35E5 5 5 212 221
K.GLK(+14.02)AEILTQYLPSSQSK.G Y 66.23 1876.0305 17 -7.3 626.3462 3 78.26 2 39172 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 108 124 Methylation(KR)
K.SKAPNGVTFNVK.G Y 63.53 1260.6826 12 -12.1 631.3409 2 46.96 3 23782 AEV_3_3_RA3_01_1233.d 6.91E5 4 4 34 45
M.PSPPAFSDIAK.A Y 61.57 1128.5814 11 0.4 565.2982 2 66.28 2 30179 AEV_1_3_RA2_01_1232.d 1.81E6 2 2 2 12
K.VGASFTFEG Y 61.09 913.4181 9 -75.7 914.3562 1 79.37 1 41340 AEV 2_3_RA2_01_1224.d 1.14E5 1 1 290 298
R.SAHE(+14.02)GPISGSLESK.Y Y 60.52 1411.6943 14 0.5 471.5723 3 47.64 3 24217 AEV_3_3_RA3_01_1233.d 8.45E5 4 4 48 61 Methylation(others)
K.APN(+.98)GVTFNVK.G Y 57.69 1046.5397 10 2.7 524.2785 2 61.16 2 26632 AEV_1_3_RA2_01_1232.d 1.14E6 4 4 36 45 Deamidation (NQ)
R.AFFDLLK.G Y 57.59 852.4745 7 1.5 427.2451 2 82.48 2 42506 AEV_1_3_RA2_01_1232.d 6.78E5 3 3 141 147
K.Q(-17.03)PNIHAR.A Y 57.40 817.4195 7 1.1 409.7175 2 28.28 3 12428 AEV_3_3_RA3_01_1233.d 1.1E6 7 7 134 140 Pyro-glu from Q
R.SAHEGPISGSLESK(+14.02).Y Y 56.58 1411.6943 14 3.4 471.5737 3 50.50 2 20688 AEV_1_3_RA2_01_1232.d 4.73E5 4 4 48 61 Methylation(KR)
K.VGNTVGLE(+14.02)VSSK.Y Y 51.40 1202.6506 12 -8.6 602.3274 2 59.93 2 25834 AEV_1_3_RA2_01_1232.d 8.16E4 2 2 228 239 Methylation(others)
K.AANDLLNKDFYHTC(+57.02)AANLEVK(+14.02).S Y 49.17 2420.1794 21 -6.5 606.0482 4 76.15 2 37509 AEV_1_3_RA2_01_1232.d 2.39E5 2 2 13 33 Carbamidomethylation; Methylation(KR)
R.LDPSSFAK.A Y 47.69 863.4388 8 0.0 432.7267 2 58.76 3 31544 AEV_3_3_RA3_01_1233.d 1.68E6 7 7 242 249
K.YRLDPSSFAK.A Y 44.70 1182.6033 10 -90.4 395.1727 3 72.41 1 35829 AEV 2_3_RA2_01_1224.d 6.59E5 2 2 240 249
K.GLKAEILTQYLPSSQ(+.98)SK.G Y 41.53 1862.9989 17 35.7 622.0291 3 77.57 2 38626 AEV_1_3_RA2_01_1232.d 0 1 1 108 124 Deamidation (NQ)
K.VGNTVGLEVSSK(+14.02).Y Y 40.48 1202.6506 12 -1.8 602.3315 2 60.17 2 25994 AEV_1_3_RA2_01_1232.d 2.83E5 2 2 228 239 Methylation(KR)
M.PSPPAFSDIAK(+14.02).A Y 39.15 1142.5972 11 4.9 572.3087 2 69.94 2 32806 AEV_1_3_RA2_01_1232.d 2.91E4 1 1 2 12 Methylation(KR)
K.LNLYFK.Q Y 38.75 796.4483 6 1.0 399.2318 2 69.77 2 32700 AEV_1_3_RA2_01_1232.d 7.97E5 3 3 128 133
R.VN(+.98)AQVEAGAK(+14.02).A Y 35.45 1000.5189 10 -12.7 501.2604 2 28.46 3 12564 AEV_3_3_RA3_01_1233.d 3.96E5 4 4 212 221 Deamidation (NQ); Methylation(KR)
K.GAKLNLYFKQPNIHAR.A Y 35.07 1869.0372 16 3.2 374.8159 5 63.37 3 35017 AEV_3_3_RA3_01_1233.d 1.44E5 1 1 125 140
R.SAHEGPIS(-2.02)GSLESK.Y Y 33.14 1395.6630 14 57.0 466.2548 3 38.23 3 18327 AEV_3_3_RA3_01_1233.d 0 1 1 48 61 2-amino-3-oxo-butanoic_acid
K.AANDLLNKDFY(-2.02)HTC(+57.02)AANLEVK.S Y 33.01 2404.1482 21 22.1 802.4077 3 74.01 3 43355 AEV_3_3_RA3_01_1233.d 0 1 1 13 33 2-amino-3-oxo-butanoic_acid; Carbamidomethylation
K.ASPDTPR.K Y 31.67 742.3610 7 -74.6 743.3129 1 50.24 1 20362 AEV 2_3_RA2_01_1224.d 0 1 1 70 76
K.LNLYFKQPNIHAR(+14.02).A Y 31.04 1626.8994 13 5.1 407.7342 4 68.40 2 31661 AEV_1_3_RA2_01_1232.d 6.7E4 1 1 128 140 Methylation(KR)
R.VN(+.98)AQVEAGAK.A Y 31.01 986.5032 10 0.5 494.2592 2 21.80 2 7135 AEV_1_3_RA2_01_1232.d 3.18E4 3 3 212 221 Deamidation (NQ)
R.LDPSSFAK(+14.02).A Y 29.02 877.4545 8 8.7 439.7383 2 65.17 2 29413 AEV_1_3_RA2_01_1232.d 2.02E5 2 2 242 249 Methylation(KR)
K.AAN(+.98)DLLN(+.98)KDFYHTC(+57.02)AANLEVK.S Y 28.82 2408.1318 21 0.3 603.0404 4 73.90 3 43269 AEV_3_3_RA3_01_1233.d 0 1 1 13 33 Deamidation (NQ); Carbamidomethylation
R.SAHEGPISGS(+14.02)LESK.Y Y 27.22 1411.6943 14 -4.7 471.5698 3 48.04 3 24470 AEV_3_3_RA3_01_1233.d 5.44E5 1 1 48 61 Methylation(others)
K.YVDMPTGK.A Y 26.67 909.4266 8 -4.8 455.7184 2 87.60 1 47803 AEV 2_3_RA2_01_1224.d 1.36E5 2 2 62 69
M(+15.99)PSPPAFSDIAK.A Y 26.58 1275.6168 12 15.1 426.2193 3 49.02 3 25101 AEV_3_3_RA3_01_1233.d 5.51E5 2 2 1 12 Oxidation (M)
R.SAHEGPIS(+44.01)GSLESK.Y Y 26.21 1441.6871 14 -64.1 481.5388 3 58.32 1 25308 AEV 2_3_RA2_01_1224.d 5.63E5 1 1 48 61 S-Ethylcystine from Serine
K.ATWDSK.V Y 25.54 706.3286 6 -74.6 707.2832 1 27.74 1 7808 AEV 2_3_RA2_01_1224.d 1.9E4 1 1 222 227
K.APNGVTF(+31.99)NVK.G Y 25.17 1077.5454 10 31.0 360.2002 3 24.23 2 8157 AEV_1_3_RA2_01_1232.d 0 1 1 36 45 Dihydroxy
R.SAHEGP(+13.98)ISGSLESK.Y Y 24.35 1411.6578 14 -59.9 706.7939 2 63.39 1 29081 AEV 2_3_RA2_01_1224.d 0 1 1 48 61 Proline oxidation to pyroglutamic acid
R.S(-2.02)AHEGPISGSLESK.Y Y 23.78 1395.6630 14 38.0 466.2459 3 39.36 3 19019 AEV_3_3_RA3_01_1233.d 0 1 1 48 61 2-amino-3-oxo-butanoic_acid
R.VNAQVE(+43.99)AGAK.A Y 23.75 1029.5090 10 -58.9 344.1567 3 49.46 1 19931 AEV 2_3_RA2_01_1224.d 1.06E6 2 2 212 221 Carboxylation (E)
M.PSPPAFSDIAKAANDLLNK.D Y 23.59 1968.0316 19 9.2 493.0197 4 45.84 2 18350 AEV_1_3_RA2_01_1232.d 0 1 1 2 20
K.VGN(+.98)TVGLEVSSK.Y Y 23.43 1189.6190 12 -96.3 595.7595 2 64.67 1 29984 AEV 2_3_RA2_01_1224.d 3.1E4 1 1 228 239 Deamidation (NQ)
R.VNAQ(+.98)VEAGAK.A Y 23.36 986.5032 10 3.1 494.2604 2 23.98 2 8052 AEV_1_3_RA2_01_1232.d 1.59E5 2 2 212 221 Deamidation (NQ)
R.VNAQVEAGAK(+14.02).A Y 23.20 999.5349 10 -17.1 500.7662 2 30.86 2 11112 AEV_1_3_RA2_01_1232.d 5.42E5 2 2 212 221 Methylation(KR)
K.ATWDSKVGNTVGLEVS(-18.01)SK(+14.02).Y Y 22.80 1872.9581 18 -4.3 469.2448 4 20.00 3 7829 AEV_3_3_RA3_01_1233.d 6.96E4 1 1 222 239 Dehydration; Methylation(KR)
K.APNGVTF(+31.99)N(+.98)VK.G Y 22.77 1078.5294 10 -2.1 540.2709 2 43.74 3 21747 AEV_3_3_RA3_01_1233.d 5.78E4 1 1 36 45 Dihydroxy; Deamidation (NQ)
K.S(+42.01)K(+14.02)APNGVTFNVK.G Y 22.35 1316.7089 12 -14.3 330.1798 4 41.98 2 16458 AEV_1_3_RA2_01_1232.d 3.92E4 1 1 34 45 Acetylation (N-term); Methylation(KR)
K.APN(+.98)GVT(-18.01)FNVK.G Y 21.95 1028.5291 10 -8.7 515.2673 2 31.26 3 14124 AEV_3_3_RA3_01_1233.d 0 1 1 36 45 Deamidation (NQ); Dehydration
R.S(+43.01)AHEGPISGSLESK.Y Y 21.63 1440.6844 14 5.8 481.2382 3 25.41 3 10802 AEV_3_3_RA3_01_1233.d 5.65E4 1 1 48 61 Carbamylation
R.VNAQ(+.98)VEAGAK(+14.02).A Y 21.21 1000.5189 10 -124.8 501.2043 2 47.94 1 19050 AEV 2_3_RA2_01_1224.d 0 1 1 212 221 Deamidation (NQ); Methylation(KR)
R.VNAQVE(+14.02)AGAK.A Y 20.86 999.5349 10 -89.1 500.7302 2 40.04 1 14416 AEV 2_3_RA2_01_1224.d 5.64E4 1 1 212 221 Methylation(others)
K.AAND(+43.99)LLNK.D Y 20.19 901.4505 8 -1.2 902.4567 1 88.39 2 46426 AEV_1_3_RA2_01_1232.d 1.94E3 1 1 13 20 Carboxylation (DKW)
K.GRSAHEGPISGSLES(+79.97)K(+14.02).Y Y 19.72 1704.7832 16 -39.3 569.2460 3 79.03 1 41075 AEV 2_3_RA2_01_1224.d 2.29E4 1 1 46 61 Phosphorylation (STY); Methylation(KR)
R.L(+43.01)DPSSFAK(+14.02).A Y 19.23 920.4603 8 -53.1 307.8111 3 27.93 1 7911 AEV 2_3_RA2_01_1224.d 0 1 1 242 249 Carbamylation; Methylation(KR)
R.AFFDLLK(+14.02).G Y 18.90 866.4902 7 -103.2 434.2076 2 91.12 1 50441 AEV 2_3_RA2_01_1224.d 4.52E4 1 1 141 147 Methylation(KR)
R.VN(+.98)AQVE(+43.99)AGAK.A Y 18.38 1030.4930 10 35.5 516.2721 2 20.89 3 8308 AEV_3_3_RA3_01_1233.d 7.78E4 1 1 212 221 Deamidation (NQ); Carboxylation (E)
K.V(+43.01)GNTVGLEVSSK.Y Y 18.03 1231.6409 12 51.8 308.9334 4 46.96 3 23781 AEV_3_3_RA3_01_1233.d 0 1 1 228 239 Carbamylation
K.A(+27.99)TWDSK.V Y 18.01 734.3235 6 -40.7 735.3008 1 111.94 1 59311 AEV 2_3_RA2_01_1224.d 5.65E4 1 1 222 227 Formylation
K.AEILTQYLPSSQSK(+43.01)GAK.L Y 17.25 1862.9738 17 -16.3 932.4789 2 93.30 3 56459 AEV_3_3_RA3_01_1233.d 0 1 1 111 127 Carbamylation
K.L(+42.01)HQ(+.98)S(+79.97)AHK.V Y 17.24 942.3961 7 102.2 315.1714 3 50.61 1 20543 AEV 2_3_RA2_01_1224.d 0 1 1 283 289 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
R.KPSPTR.L Y 17.18 684.3918 6 -36.1 343.1909 2 40.90 3 19941 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 77 82
R.SAHEGPISGSLESK(+70.04).Y Y 17.15 1467.7205 14 -25.2 367.9281 4 78.42 1 40584 AEV 2_3_RA2_01_1224.d 0 1 1 48 61 Crotonaldehyde
K.DFYHT(+238.23)C(+57.02)AANLEVK.S Y 17.09 1804.9434 13 10.5 452.2479 4 60.15 2 25986 AEV_1_3_RA2_01_1232.d 3.21E4 1 1 21 33 Palmitoylation; Carbamidomethylation
K.VGNTVGLEVSS(+79.97)K(+14.02).Y Y 17.05 1282.6169 12 -11.4 642.3084 2 47.64 2 19255 AEV_1_3_RA2_01_1232.d 0 1 1 228 239 Phosphorylation (STY); Methylation(KR)
R.SAHEGPISGSLES(-18.01)K.Y Y 17.04 1379.6681 14 -1.9 690.8400 2 59.30 3 31890 AEV_3_3_RA3_01_1233.d 2.85E4 1 1 48 61 Dehydration
R.SAHEGPIS(+79.97)GSLES(+79.97)K(+14.02).Y Y 17.04 1571.6270 14 -4.2 786.8174 2 88.35 1 48382 AEV 2_3_RA2_01_1224.d 4.34E4 1 1 48 61 Phosphorylation (STY); Methylation(KR)
K.S(+79.97)K(+226.08)APNGVTFNVK.G Y 17.04 1566.7266 12 29.1 523.2646 3 58.44 3 31253 AEV_3_3_RA3_01_1233.d 0 1 1 34 45 Phosphorylation (STY); Biotinylation
R.V(+43.01)NAQVEAGAK.A Y 16.74 1028.5250 10 47.4 515.2942 2 48.46 2 19676 AEV_1_3_RA2_01_1232.d 0 1 1 212 221 Carbamylation
R.KPSPTR(+123.01).L Y 16.67 807.4004 6 -4.2 808.4042 1 70.20 3 40382 AEV_3_3_RA3_01_1233.d 2.22E4 1 1 77 82 glycosylphosphatidylinositol
K.A(+42.01)S(+79.97)PDTPR.K Y 16.31 864.3378 7 29.3 433.1889 2 42.65 1 15951 AEV 2_3_RA2_01_1224.d 1.15E5 1 1 70 76 Acetylation (N-term); Phosphorylation (STY)
K.AAND(-18.01)LLNK.D Y 16.14 839.4501 8 7.6 420.7355 2 21.52 3 8659 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 13 20 Dehydration
K.V(+42.01)GNTVGLEVSSK(+42.01).Y Y 16.08 1272.6561 12 13.7 319.1757 4 15.33 3 5300 AEV_3_3_RA3_01_1233.d 9.28E4 1 1 228 239 Acetylation (N-term); Acetylation (K)
R.VNAQVEAGAK(+87.07).A Y 16.06 1072.5876 10 -0.7 537.3007 2 74.14 3 43459 AEV_3_3_RA3_01_1233.d 1.25E6 1 1 212 221 Hypusine
K.APNGVTFN(+.98)VK(+31.99).G Y 16.00 1078.5294 10 -2.3 540.2708 2 42.00 3 20724 AEV_3_3_RA3_01_1233.d 0 1 1 36 45 Deamidation (NQ); Dihydroxy
K.G(+27.99)RSAHEGPISGSLESK.Y Y 15.98 1638.7961 16 -14.5 547.2647 3 59.30 3 31888 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 46 61 Formylation
K.G(+42.01)AK(+43.99)LNLYFK.Q Y 15.80 1138.6022 9 -17.2 570.2986 2 49.04 2 19964 AEV_1_3_RA2_01_1232.d 0 1 1 125 133 Acetylation (N-term); Carboxylation (DKW)
R.L(+42.01)TM(+31.99)IQTWTTANSLDTK.L Y 15.80 1896.9139 16 16.3 475.2435 4 44.31 3 22120 AEV_3_3_RA3_01_1233.d 8.73E4 1 1 83 98 Acetylation (N-term); Sulphone
K.LELDNTIVK(+226.08).G Y 15.70 1269.6638 9 7.3 424.2316 3 57.81 3 30815 AEV_3_3_RA3_01_1233.d 4.93E4 1 1 99 107 Biotinylation
K.V(+42.01)GNTVGLEVSSKYRLDPSSFAK(+27.99).A Y 15.44 2423.2332 22 -32.7 606.7958 4 48.71 3 24901 AEV_3_3_RA3_01_1233.d 0 1 1 228 249 Acetylation (N-term); Formylation
MPS(+79.97)PPAFS(+79.97)DIAKAANDLLNK(+42.01).D Y 15.17 2301.0154 20 26.0 768.0323 3 78.92 2 39705 AEV_1_3_RA2_01_1232.d 6.43E4 1 1 1 20 Phosphorylation (STY); Acetylation (K)
total 88 peptides
C1GEX7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.ELAHMNAGLVEMERIEASQSPNAPATK.A Y 143.84 2893.4062 27 3.8 724.3616 4 76.19 2 37578 AEV_1_3_RA2_01_1232.d 4.74E5 2 2 350 376
R.HC(+57.02)C(+57.02)SGGADVYTSSR.S Y 141.99 1555.6144 14 4.7 519.5479 3 24.90 2 8445 AEV_1_3_RA2_01_1232.d 2.32E6 12 12 288 301 Carbamidomethylation
R.DHPLVGNSNSMGR.E Y 121.61 1382.6361 13 0.0 461.8860 3 37.51 3 17897 AEV_3_3_RA3_01_1233.d 9.2E5 9 9 337 349
K.Q(-17.03)SATSANWDATKQESNVTTDASMRR.D Y 109.52 2737.2361 25 1.4 913.4206 3 65.08 3 36336 AEV_3_3_RA3_01_1233.d 2.01E5 2 2 312 336 Pyro-glu from Q
R.ELAHM(+15.99)NAGLVEMERIEASQSPNAPATK.A Y 105.13 2909.4011 27 -5.9 728.3533 4 70.71 3 40789 AEV_3_3_RA3_01_1233.d 1.4E5 2 2 350 376 Oxidation (M)
K.AIVDEQSSDGQVSEDGNSIK.L Y 96.09 2076.9446 20 -2.8 693.3202 3 60.08 3 32481 AEV_3_3_RA3_01_1233.d 4.86E5 6 6 377 396
R.IEASQSPNAPATK.A Y 94.90 1312.6622 13 -14.6 657.3288 2 28.67 3 12687 AEV_3_3_RA3_01_1233.d 1.99E6 9 9 364 376
R.DHPLVGNSNSM(+15.99)GR.E Y 91.38 1398.6310 13 2.1 700.3242 2 23.25 3 9567 AEV_3_3_RA3_01_1233.d 1.9E6 21 21 337 349 Oxidation (M)
K.QSATSANWDATKQESNVTTDASM(+15.99)RR.D Y 85.31 2770.2576 25 5.1 693.5752 4 56.76 3 30040 AEV_3_3_RA3_01_1233.d 9.91E4 1 1 312 336 Oxidation (M)
K.QSATSANWDATKQESNVTTDASMR.R Y 83.21 2598.1616 24 1.4 867.0624 3 63.01 3 34753 AEV_3_3_RA3_01_1233.d 4.62E4 1 1 312 335
R.DHPLVGN(+.98)SNSM(+15.99)GR.E Y 80.25 1399.6150 13 5.2 700.8184 2 26.35 3 11340 AEV_3_3_RA3_01_1233.d 1E5 2 2 337 349 Deamidation (NQ); Oxidation (M)
R.DHPLVGNSNSM(-48.00)GR.E Y 79.12 1334.6327 13 3.6 445.8864 3 14.27 3 4707 AEV_3_3_RA3_01_1233.d 1.71E6 5 5 337 349 Dethiomethyl
R.ELAHMNAGLVEMER.I Y 74.97 1598.7545 14 6.5 533.9289 3 68.56 3 39099 AEV_3_3_RA3_01_1233.d 1.26E5 1 1 350 363
K.Q(-17.03)SATSANWDATKQESNVTTDASM(+15.99)RR.D Y 69.75 2753.2312 25 -1.9 918.7493 3 62.38 3 34257 AEV_3_3_RA3_01_1233.d 2.06E5 2 2 312 336 Pyro-glu from Q; Oxidation (M)
R.IE(+14.02)ASQSPNAPATK.A Y 69.49 1326.6779 13 4.4 664.3491 2 32.50 3 14861 AEV_3_3_RA3_01_1233.d 1.51E5 4 4 364 376 Methylation(others)
R.IEASQ(+.98)SPNAPATK.A Y 68.96 1313.6462 13 0.1 657.8304 2 32.28 3 14741 AEV_3_3_RA3_01_1233.d 2.5E5 3 3 364 376 Deamidation (NQ)
R.HC(+57.02)C(+57.02)SGGADVYTSSR(+14.02).S Y 67.96 1569.6300 14 1.4 785.8234 2 30.62 3 13754 AEV_3_3_RA3_01_1233.d 3.27E4 1 1 288 301 Carbamidomethylation; Methylation(KR)
R.IEASQS(+79.97)PNAPATK.A Y 67.94 1392.6285 13 -0.7 697.3210 2 32.06 3 14611 AEV_3_3_RA3_01_1233.d 2.63E5 3 3 364 376 Phosphorylation (STY)
K.LTPQQHLK.K Y 65.89 963.5502 8 0.1 482.7824 2 19.79 3 7714 AEV_3_3_RA3_01_1233.d 2.32E5 2 2 397 404
R.ELAHMNAGLVEMER(+14.02)IEAS(-18.01)QSPNAPATK.A Y 57.41 2889.4114 27 19.1 723.3739 4 76.22 2 37565 AEV_1_3_RA2_01_1232.d 0 1 1 350 376 Methylation(KR); Dehydration
K.QSATSANWDATK.Q Y 54.57 1278.5840 12 3.4 640.3015 2 36.90 3 17529 AEV_3_3_RA3_01_1233.d 8.79E4 1 1 312 323
R.RDHPLVGNSNSMGR.E Y 51.67 1538.7372 14 10.0 513.9248 3 30.50 3 13683 AEV_3_3_RA3_01_1233.d 9.06E4 1 1 336 349
R.IEASQ(+.98)SPN(+.98)APATK.A Y 50.18 1314.6302 13 -58.0 658.2843 2 37.17 1 12810 AEV 2_3_RA2_01_1224.d 5.37E4 1 1 364 376 Deamidation (NQ)
R.IEASQSPNAPATK(+14.02).A Y 46.68 1326.6779 13 30.3 664.3663 2 36.85 2 13952 AEV_1_3_RA2_01_1232.d 0 2 2 364 376 Methylation(KR)
R.RDHPLVGNSNSM(-48.00)GR.E Y 42.01 1490.7338 14 3.7 373.6921 4 13.67 3 4392 AEV_3_3_RA3_01_1233.d 1.06E5 1 1 336 349 Dethiomethyl
R.IEASQSPNAP(+13.98)ATK.A Y 37.34 1326.6415 13 -60.3 664.2880 2 46.47 1 18170 AEV 2_3_RA2_01_1224.d 6.71E4 2 2 364 376 Proline oxidation to pyroglutamic acid
R.IAVINWGK.N Y 36.49 899.5229 8 -3.6 450.7671 2 69.56 3 39947 AEV_3_3_RA3_01_1233.d 3.14E5 3 3 458 465
R.DHPLVGNSNSMGR(-.98)(+14.02).E Y 34.93 1395.6677 13 -1.2 466.2293 3 23.09 3 9489 AEV_3_3_RA3_01_1233.d 7.35E4 2 2 337 349 Amidation; Methylation(KR)
K.Q(-17.03)ESNVTTDASMRR.D Y 34.04 1476.6627 13 -0.9 739.3380 2 46.11 3 23261 AEV_3_3_RA3_01_1233.d 1.37E5 2 2 324 336 Pyro-glu from Q
R.IEAS(+79.97)QSPNAPATK.A Y 33.04 1392.6285 13 -85.7 697.2618 2 36.66 1 12530 AEV 2_3_RA2_01_1224.d 1.72E5 2 2 364 376 Phosphorylation (STY)
R.ELAH(+72.02)MNAGLVEMERIEASQSPNAPATK.A Y 32.37 2965.4272 27 -12.2 594.0855 5 58.26 3 31139 AEV_3_3_RA3_01_1233.d 0 1 1 350 376 Ethoxyformylation
K.Q(+.98)S(-18.01)ATSANWDATK.Q Y 31.84 1261.5575 12 2.8 631.7878 2 59.70 3 32190 AEV_3_3_RA3_01_1233.d 6.68E4 1 1 312 323 Deamidation (NQ); Dehydration
R.DHPLVGN(+.98)SNSMGR(+14.02).E Y 30.90 1397.6357 13 -92.6 466.8427 3 52.08 1 21450 AEV 2_3_RA2_01_1224.d 1.39E5 2 2 337 349 Deamidation (NQ); Methylation(KR)
R.IEASQ(+.98)SPNAPATK(+14.02).A Y 30.72 1327.6619 13 -2.7 664.8364 2 35.59 3 16682 AEV_3_3_RA3_01_1233.d 2.41E4 2 2 364 376 Deamidation (NQ); Methylation(KR)
K.QESNVTTD(-18.01)ASMR(+14.02).R Y 25.32 1333.5933 12 -15.5 667.7936 2 80.02 1 41861 AEV 2_3_RA2_01_1224.d 9.36E4 1 1 324 335 Dehydration; Methylation(KR)
K.QSATSANWD(+43.99)ATK.Q Y 23.61 1322.5739 12 -30.4 662.2741 2 70.10 1 34040 AEV 2_3_RA2_01_1224.d 1.16E5 1 1 312 323 Carboxylation (DKW)
R.ELAHMNAGLVE(+55.92)MERIEASQSPNAPATK.A Y 23.43 2949.3259 27 23.0 738.3557 4 63.42 3 35061 AEV_3_3_RA3_01_1233.d 7.33E4 1 1 350 376 Replacement of 2 protons by nickel
MN(+.98)CPSR.T Y 23.30 707.2731 6 -25.7 708.2621 1 3.74 3 876 AEV_3_3_RA3_01_1233.d 1.26E4 1 1 1 6 Deamidation (NQ)
R.IEASQSPN(+.98)APATK.A Y 23.09 1313.6462 13 -89.6 657.7715 2 39.54 1 14145 AEV 2_3_RA2_01_1224.d 5.08E4 1 1 364 376 Deamidation (NQ)
R.IEASQSPNAPAT(+79.97)K.A Y 22.61 1392.6285 13 -28.0 349.1547 4 58.26 1 25270 AEV 2_3_RA2_01_1224.d 2.57E5 1 1 364 376 Phosphorylation (STY)
K.QSATSANWD(+21.98)ATK.Q Y 22.05 1300.5659 12 -16.3 434.5222 3 69.70 1 33722 AEV 2_3_RA2_01_1224.d 0 1 1 312 323 Sodium adduct
R.DHPLVGN(+.98)SNSMGR.E Y 21.63 1383.6201 13 38.5 462.2318 3 19.44 2 6170 AEV_1_3_RA2_01_1232.d 0 1 1 337 349 Deamidation (NQ)
R.HC(+57.02)C(+57.02)S(+79.96)GGADVYTSSR.S Y 20.99 1635.5712 14 44.6 409.9183 4 78.98 1 41031 AEV 2_3_RA2_01_1224.d 3.74E4 1 1 288 301 Carbamidomethylation; Sulfation
R.DHPLVGN(+.98)SN(+.98)SMGR(+14.02).E Y 20.12 1398.6198 13 -24.1 467.2026 3 57.75 1 24915 AEV 2_3_RA2_01_1224.d 9.98E4 2 2 337 349 Deamidation (NQ); Methylation(KR)
K.QSAT(+79.97)SAN(+.98)WDATK(+42.01).Q Y 20.09 1401.5449 12 56.5 468.2153 3 71.27 1 35055 AEV 2_3_RA2_01_1224.d 0 1 1 312 323 Phosphorylation (STY); Deamidation (NQ); Acetylation (K)
R.IEASQSPN(+.98)APATK(+14.02).A Y 19.89 1327.6619 13 -24.4 664.8220 2 39.18 3 18899 AEV_3_3_RA3_01_1233.d 0 1 1 364 376 Deamidation (NQ); Methylation(KR)
K.QESNVTTDASM(+15.99)R.R Y 19.67 1353.5830 12 -98.9 677.7318 2 29.88 1 8899 AEV 2_3_RA2_01_1224.d 4.5E4 1 1 324 335 Oxidation (M)
K.QESNVTTDAS(+183.04)MR.R Y 19.28 1520.6235 12 -17.1 761.3060 2 61.77 1 27823 AEV 2_3_RA2_01_1224.d 3.08E4 1 1 324 335 Aminoethylbenzenesulfonylation
R.EDLN(+.98)GT(+79.97)VNSR.S Y 18.64 1184.4711 10 20.0 1185.5021 1 112.55 1 59497 AEV 2_3_RA2_01_1224.d 1.91E5 1 1 32 41 Deamidation (NQ); Phosphorylation (STY)
R.DHPLVGNSNS(+13.03)MGR.E Y 18.48 1395.6677 13 29.8 466.2437 3 24.64 2 8330 AEV_1_3_RA2_01_1232.d 0 1 1 337 349 Michael addition with methylamine
R.IEASQSPNAPATK(+42.01).A Y 18.00 1354.6729 13 -96.3 452.5214 3 77.52 1 39873 AEV 2_3_RA2_01_1224.d 0 1 1 364 376 Acetylation (K)
R.I(+42.01)EASQSPNAPATK(+226.08).A Y 17.72 1580.7504 13 -40.3 396.1790 4 74.22 1 37254 AEV 2_3_RA2_01_1224.d 0 1 1 364 376 Acetylation (N-term); Biotinylation
R.DHPLVGNS(-2.02)NSMGR.E Y 17.65 1380.6205 13 52.2 461.2381 3 37.36 3 17807 AEV_3_3_RA3_01_1233.d 0 1 1 337 349 2-amino-3-oxo-butanoic_acid
R.IEASQSPNAPAT(+79.97)K(+42.01).A Y 17.59 1434.6392 13 40.2 718.3557 2 64.46 2 28869 AEV_1_3_RA2_01_1232.d 0 1 1 364 376 Phosphorylation (STY); Acetylation (K)
R.IEAS(-2.02)QSPNAPATK.A Y 17.58 1310.6466 13 2.9 656.3325 2 32.65 3 14950 AEV_3_3_RA3_01_1233.d 0 1 1 364 376 2-amino-3-oxo-butanoic_acid
R.DHPLVGNSN(+.98)SM(+15.99)GR.E Y 17.17 1399.6150 13 -80.9 467.5079 3 39.72 1 14249 AEV 2_3_RA2_01_1224.d 2.84E5 1 1 337 349 Deamidation (NQ); Oxidation (M)
K.NLDSSLEK(+21.98).L Y 16.91 926.4321 8 44.7 927.4807 1 96.70 2 49908 AEV_1_3_RA2_01_1232.d 0 1 1 60 67 Sodium adduct
K.QS(+79.97)ATSAN(+.98)WDATK(+42.01).Q Y 16.73 1401.5449 12 24.1 468.2002 3 65.08 1 30212 AEV 2_3_RA2_01_1224.d 8.22E4 1 1 312 323 Phosphorylation (STY); Deamidation (NQ); Acetylation (K)
K.Q(+.98)SATS(+79.97)ANWDATK.Q Y 16.69 1359.5344 12 13.4 454.1915 3 30.94 1 9481 AEV 2_3_RA2_01_1224.d 4.92E4 1 1 312 323 Deamidation (NQ); Phosphorylation (STY)
K.SRLVGDLPIR.R Y 15.77 1124.6665 10 -10.2 375.8923 3 35.50 3 16637 AEV_3_3_RA3_01_1233.d 1.9E5 1 1 154 163
R.IEASQSPN(+.98)APATK(+31.99).A Y 15.71 1345.6361 13 39.9 449.5706 3 22.99 2 7641 AEV_1_3_RA2_01_1232.d 4.41E4 1 1 364 376 Deamidation (NQ); Dihydroxy
R.EDLNGTVN(+.98)SRSFR.N Y 15.71 1494.7063 13 10.0 374.6876 4 75.66 1 38394 AEV 2_3_RA2_01_1224.d 0 1 1 32 44 Deamidation (NQ)
R.IEASQS(+162.05)PNAPAT(+79.97)K.A Y 15.58 1554.6814 13 -36.7 778.3195 2 74.16 1 37212 AEV 2_3_RA2_01_1224.d 5.49E4 1 1 364 376 Hexose (NSY); Phosphorylation (STY)
R.IAVINWGK(+42.01).N Y 15.35 941.5334 8 -28.8 314.8427 3 23.25 3 9570 AEV_3_3_RA3_01_1233.d 0 1 1 458 465 Acetylation (K)
R.N(+27.99)GLSQSDTQC(+57.02)PEDAK.N Y 15.34 1676.6948 15 -6.5 420.1783 4 40.55 1 14732 AEV 2_3_RA2_01_1224.d 0 1 1 45 59 Formylation; Carbamidomethylation
K.N(+42.01)LDS(+79.97)SLEK.L Y 15.10 1026.4270 8 -38.0 1027.3953 1 85.81 1 46426 AEV 2_3_RA2_01_1224.d 5.53E4 1 1 60 67 Acetylation (N-term); Phosphorylation (STY)
total 66 peptides
C1FZI7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.SDYEC(+57.02)DYNYEPQIDGTC(+57.02)APVPGLKPLDPK.L Y 104.48 3340.4902 29 1.1 1114.5052 3 79.54 3 47711 AEV_3_3_RA3_01_1233.d 1.61E5 2 2 1278 1306 Carbamidomethylation
R.DTYSSPSAIGVMLGTGNVGEYLTLK.S Y 103.99 2572.2729 25 4.5 1287.1495 2 90.58 2 47505 AEV_1_3_RA2_01_1232.d 1.14E5 2 2 1076 1100
R.ELQHLDSIGDIC(+57.02)EC(+57.02)TR.S Y 103.86 1944.8669 16 5.8 649.3000 3 70.05 2 32881 AEV_1_3_RA2_01_1232.d 1.94E5 2 2 1262 1277 Carbamidomethylation
R.GC(+57.02)NWAVSTPIFGDGLNLSK.E Y 98.34 2034.9833 19 1.1 1018.5000 2 84.88 2 44236 AEV_1_3_RA2_01_1232.d 4.1E5 2 2 175 193 Carbamidomethylation
R.TC(+57.02)GKDDFETWPAR.L Y 86.81 1581.6881 13 2.6 528.2380 3 61.86 3 33860 AEV_3_3_RA3_01_1233.d 5.72E4 1 1 543 555 Carbamidomethylation
R.DTYSSPSAIGVMLGTGNVGEYLTLKSDADTFITR.D Y 86.46 3578.7449 34 -5.3 1193.9159 3 90.51 3 54995 AEV_3_3_RA3_01_1233.d 1.01E5 2 2 1076 1109
R.VC(+57.02)TDTLTVPVSGEIVVQK.T Y 84.74 1944.0238 18 1.4 973.0205 2 77.70 2 38734 AEV_1_3_RA2_01_1232.d 1.74E5 3 3 668 685 Carbamidomethylation
K.FQEPVPQFEPC(+57.02)KC(+57.02)TVEDFEC(+57.02)DFNFIR.S Y 80.31 3337.4517 26 1.8 1113.4932 3 87.19 3 53119 AEV_3_3_RA3_01_1233.d 5.33E4 2 2 587 612 Carbamidomethylation
R.LLYSDRFFKQDSGTEAPLDSGR.A Y 79.96 2501.2185 22 5.8 626.3156 4 74.79 2 36462 AEV_1_3_RA2_01_1232.d 9.13E4 1 1 216 237
R.TSELALYVTDDGSQWHR.A Y 76.81 1976.9229 17 4.1 659.9843 3 75.37 3 44418 AEV_3_3_RA3_01_1233.d 9.25E4 1 1 261 277
R.DYSC(+57.02)STEGGKPTDK.C Y 73.44 1543.6460 14 3.3 515.5576 3 20.63 2 6669 AEV_1_3_RA2_01_1232.d 1.2E5 3 3 1047 1060 Carbamidomethylation
R.SLPVPEGAC(+57.02)K.K Y 70.84 1056.5273 10 -0.3 529.2708 2 51.02 3 26381 AEV_3_3_RA3_01_1233.d 1.28E6 7 7 624 633 Carbamidomethylation
R.STEGKSC(+57.02)VPAR.S Y 70.81 1190.5713 11 3.8 596.2952 2 13.87 3 4507 AEV_3_3_RA3_01_1233.d 2.53E4 2 2 613 623 Carbamidomethylation
R.DISTVPSDTSR.N Y 70.06 1176.5623 11 -2.4 589.2870 2 44.08 2 17519 AEV_1_3_RA2_01_1232.d 7.89E5 11 11 1170 1180
K.SDADTFITR.D Y 66.38 1024.4825 9 5.0 513.2511 2 54.46 3 28723 AEV_3_3_RA3_01_1233.d 5.47E5 4 4 1101 1109
R.IFC(+57.02)IVPGLQSPWSDYNR.L Y 65.35 2050.9934 17 -12.1 684.6635 3 87.04 3 53016 AEV_3_3_RA3_01_1233.d 6.03E4 2 2 199 215 Carbamidomethylation
K.LIC(+57.02)TEDPKAVEWYEPTGYR.R Y 64.79 2326.0940 19 6.9 776.3773 3 76.16 3 45066 AEV_3_3_RA3_01_1233.d 2.79E5 2 2 1307 1325 Carbamidomethylation
K.IISQISFDDGRTFQPLK.A Y 61.69 1964.0366 17 1.3 655.6870 3 78.02 2 38988 AEV_1_3_RA2_01_1232.d 3.51E4 1 1 374 390
R.AYTVLESR.T Y 60.52 937.4869 8 3.3 469.7523 2 50.91 2 20902 AEV_1_3_RA2_01_1232.d 3.26E5 5 5 937 944
R.EGGVELDKQIER.V Y 58.98 1371.6993 12 2.3 686.8585 2 51.51 3 26723 AEV_3_3_RA3_01_1233.d 7.32E5 6 6 656 667
K.FQEPVPQFEPC(+57.02)K.C Y 51.29 1504.7020 12 1.2 753.3592 2 71.37 3 41307 AEV_3_3_RA3_01_1233.d 1.67E5 2 2 587 598 Carbamidomethylation
K.IISQISFDDGR.T Y 42.69 1249.6302 11 -8.6 625.8170 2 69.16 3 39610 AEV_3_3_RA3_01_1233.d 1.92E5 2 2 374 384
K.EASLPDGIK.I Y 42.09 928.4865 9 -86.3 465.2105 2 63.19 1 28922 AEV 2_3_RA2_01_1224.d 9.41E4 2 2 490 498
R.T(-2.02)SELALYVTDDGSQWHR.A Y 41.99 1974.9071 17 42.4 659.3375 3 75.42 3 44455 AEV_3_3_RA3_01_1233.d 1.88E4 1 1 261 277 2-amino-3-oxo-butanoic_acid
K.YLLAAAK.S Y 41.39 748.4483 7 -11.7 375.2271 2 48.01 3 24473 AEV_3_3_RA3_01_1233.d 3.94E5 2 2 251 257
K.DSEGRDYSC(+57.02)STEGGKPTDK.C Y 40.14 2087.8701 19 -4.4 522.9725 4 22.70 3 9273 AEV_3_3_RA3_01_1233.d 3.84E4 1 1 1042 1060 Carbamidomethylation
K.AVEWYEPTGYR.R Y 38.52 1369.6302 11 19.6 685.8358 2 71.74 3 41598 AEV_3_3_RA3_01_1233.d 1.58E4 2 2 1315 1325
K.EVTYYTTDGFK.T Y 37.86 1322.6030 11 15.4 662.3190 2 66.17 2 30071 AEV_1_3_RA2_01_1232.d 1.31E5 1 1 154 164
R.AVSGVVRT(+79.97)AS(+79.97)VK.K Y 37.65 1332.6204 12 2.1 667.3188 2 74.07 3 43402 AEV_3_3_RA3_01_1233.d 9.06E4 1 1 238 249 Phosphorylation (STY)
R.DISTVPSDTSR(+14.02).N Y 35.84 1190.5779 11 3.8 596.2985 2 53.04 2 22000 AEV_1_3_RA2_01_1232.d 5.43E4 1 1 1170 1180 Methylation(KR)
K.LIC(+57.02)TEDPK.A Y 35.20 974.4742 8 -79.4 488.2057 2 44.23 1 16826 AEV 2_3_RA2_01_1224.d 7.99E5 10 10 1307 1314 Carbamidomethylation
K.TVDILIENAR.G Y 34.13 1142.6295 10 -29.4 572.3052 2 69.41 3 39779 AEV_3_3_RA3_01_1233.d 2.71E5 2 2 165 174
K.EIFPGETITR.I Y 33.62 1161.6029 10 2.5 581.8102 2 69.19 2 32240 AEV_1_3_RA2_01_1232.d 2.55E5 2 2 733 742
K.KIISQISFDDGR.T Y 30.92 1377.7252 12 4.8 460.2512 3 66.16 2 30065 AEV_1_3_RA2_01_1232.d 0 1 1 373 384
R.ILTTM(+15.99)PDSTGLK.F Y 30.52 1291.6693 12 -2.0 646.8406 2 59.88 2 25800 AEV_1_3_RA2_01_1232.d 6E4 1 1 503 514 Oxidation (M)
R.NTYGYADFEK.M Y 28.10 1206.5193 10 -87.5 604.2141 2 68.50 1 32814 AEV 2_3_RA2_01_1224.d 8.27E4 1 1 985 994
R.VPGGSSSQR.V Y 27.98 873.4304 9 -114.8 874.3374 1 97.53 1 54697 AEV 2_3_RA2_01_1224.d 3.88E4 1 1 1446 1454
R.L(+42.01)NEKN(+.98)EPDC(+57.02)LMGHK(+42.01)QFYQR.R Y 27.84 2491.1260 19 -20.5 623.7760 4 95.76 1 53639 AEV 2_3_RA2_01_1224.d 9.73E5 2 2 556 574 Acetylation (N-term); Deamidation (NQ); Carbamidomethylation; Acetylation (K)
K.YLLAAAKSAR.T Y 27.34 1062.6185 10 -1.1 532.3160 2 98.49 3 58552 AEV_3_3_RA3_01_1233.d 2.41E4 1 1 251 260
K.D(+43.99)SEGR.D N 26.02 606.2245 5 -54.9 607.1985 1 26.99 1 7454 AEV 2_3_RA2_01_1224.d 0 1 1 1042 1046 Carboxylation (DKW)
R.GYARVPGGSSSQR.V Y 25.65 1320.6534 13 -0.6 661.3336 2 92.04 3 55809 AEV_3_3_RA3_01_1233.d 0 1 1 1442 1454
R.LNEKNEPDC(+57.02)LMGHK(+43.01).Q Y 24.79 1726.7766 14 -13.6 576.5917 3 82.72 1 43965 AEV 2_3_RA2_01_1224.d 7.04E4 1 1 556 569 Carbamidomethylation; Carbamylation
K.QDSGTEAPLDS(+79.97)GRAVS(+79.97)GVVR.T Y 23.83 2159.9248 20 -5.8 720.9780 3 91.79 1 50919 AEV 2_3_RA2_01_1224.d 8.72E4 1 1 225 244 Phosphorylation (STY)
K.KPNDKYMGSSGFR.L Y 23.66 1485.7034 13 -12.1 496.2357 3 76.06 1 38709 AEV 2_3_RA2_01_1224.d 1.69E5 1 1 634 646
K.LIC(+57.02)TEDPK(+14.02).A Y 23.54 988.4899 8 -2.4 495.2510 2 45.03 2 17951 AEV_1_3_RA2_01_1232.d 0 1 1 1307 1314 Carbamidomethylation; Methylation(KR)
R.V(+27.99)YSSRAAFAAQ(+.98)R.A Y 23.51 1354.6630 12 106.7 339.7092 4 57.13 3 30316 AEV_3_3_RA3_01_1233.d 1.96E4 1 1 1455 1466 Formylation; Deamidation (NQ)
K.H(+42.01)DLHLHS(+79.97)VTHLSNSGR.V Y 23.33 1930.8799 16 -0.8 483.7268 4 88.73 1 48668 AEV 2_3_RA2_01_1224.d 0 1 1 394 409 Acetylation (N-term); Phosphorylation (STY)
R.V(+226.08)LLQ(+.98)GHK.C Y 22.58 1020.5426 7 -46.8 341.1722 3 68.41 1 32751 AEV 2_3_RA2_01_1224.d 0 1 1 140 146 Biotinylation; Deamidation (NQ)
K.AD(-18.01)SPIIMATR.F Y 22.11 1055.5433 10 12.5 528.7855 2 49.19 3 25210 AEV_3_3_RA3_01_1233.d 3.76E4 1 1 24 33 Dehydration
R.TFQ(+.98)PLK.A Y 21.52 733.4010 6 -24.5 367.6988 2 28.62 2 10092 AEV_1_3_RA2_01_1232.d 5.75E4 1 1 385 390 Deamidation (NQ)
K.FQEPVPQFEPCK(+42.01).C Y 20.76 1489.6912 12 -18.0 745.8395 2 66.53 1 31275 AEV 2_3_RA2_01_1224.d 1.75E5 1 1 587 598 Acetylation (K)
K.EIFPGETIT(+122.01)R.I Y 20.69 1283.6162 10 -54.7 321.8938 4 24.86 1 6486 AEV 2_3_RA2_01_1224.d 1.35E5 1 1 733 742 O-Isopropylphosphorylation
K.ISYSLN(+.98)HGK.D Y 20.62 1018.5084 9 14.5 510.2689 2 35.78 2 13440 AEV_1_3_RA2_01_1232.d 3.46E3 1 1 478 486 Deamidation (NQ)
K.C(+57.02)ALHLHSYTER.A Y 20.32 1385.6510 11 -0.8 462.8906 3 42.01 3 20660 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 1061 1071 Carbamidomethylation
R.LNEK(-1.03)NEPDC(+57.02)LMGHKQFYQR.R Y 20.15 2405.0891 19 19.3 482.0344 5 60.75 2 26367 AEV_1_3_RA2_01_1232.d 0 1 1 556 574 Lysine oxidation to aminoadipic semialdehyde; Carbamidomethylation
K.Q(+42.01)DSGTEAPLDSGR(+14.02).A Y 20.04 1387.6215 13 1.0 463.5482 3 76.73 1 39237 AEV 2_3_RA2_01_1224.d 4.88E5 1 1 225 237 Acetylation (N-term); Methylation(KR)
K.C(+43.01)EGGK.Q Y 19.82 535.2061 5 -44.4 536.1896 1 2.75 2 638 AEV_1_3_RA2_01_1232.d 0 1 1 1332 1336 Carbamylation
R.D(+43.01)GGITWQEVR.K Y 19.80 1202.5680 10 -18.4 301.6437 4 31.29 1 9686 AEV 2_3_RA2_01_1224.d 3.37E5 1 1 1110 1119 Carbamylation
K.ALDEAHK(+42.01).Y Y 19.73 824.4028 7 -23.3 825.3909 1 79.65 1 41563 AEV 2_3_RA2_01_1224.d 6.74E4 1 1 450 456 Acetylation (K)
R.VLLQGHK(+42.01).C Y 19.62 835.4916 7 -76.4 836.4351 1 111.19 1 59096 AEV 2_3_RA2_01_1224.d 7E5 1 1 140 146 Acetylation (K)
K.CEGGK(+42.01).Q Y 19.37 534.2108 5 48.5 535.2440 1 89.94 1 49574 AEV 2_3_RA2_01_1224.d 2.73E4 1 1 1332 1336 Acetylation (K)
R.LNEKNEPDCLMGHK.Q Y 19.34 1626.7494 14 66.6 543.2932 3 65.16 3 36406 AEV_3_3_RA3_01_1233.d 0 1 1 556 569
K.KPGVAAVNIDFSNLKER.H Y 19.02 1857.0107 17 -0.2 465.2599 4 68.82 3 39387 AEV_3_3_RA3_01_1233.d 2.06E5 1 1 1194 1210
R.TASVK(+43.99).K Y 18.85 548.2806 5 4.7 549.2904 1 36.51 3 17260 AEV_3_3_RA3_01_1233.d 0 1 1 245 249 Carboxylation (DKW)
R.VYSSR(+14.02).A Y 18.77 624.3231 5 -150.4 625.2365 1 46.15 1 17952 AEV 2_3_RA2_01_1224.d 8.6E4 1 1 1455 1459 Methylation(KR)
K.QDSGTEAPLDS(+79.97)GR(+31.99).A Y 18.66 1443.5515 13 68.1 482.2239 3 77.94 1 40256 AEV 2_3_RA2_01_1224.d 0 1 1 225 237 Phosphorylation (STY); Dihydroxy
K.FLLVGSSKR.D Y 18.62 1005.5970 9 -3.7 336.2050 3 54.34 3 28572 AEV_3_3_RA3_01_1233.d 8.43E4 1 1 515 523
K.DSEGR.D N 18.60 562.2347 5 49.3 563.2697 1 30.40 3 13623 AEV_3_3_RA3_01_1233.d 6.21E3 1 1 1042 1046
K.C(+57.02)EGGK.Q Y 18.49 549.2217 5 -21.7 550.2170 1 32.37 1 10283 AEV 2_3_RA2_01_1224.d 0 1 1 1332 1336 Carbamidomethylation
R.NFLLWGNEVGNGK(+14.02).K Y 18.47 1460.7412 13 6.0 366.1948 4 22.86 2 7592 AEV_1_3_RA2_01_1232.d 1.08E5 1 1 1181 1193 Methylation(KR)
R.TASVK.K Y 18.46 504.2907 5 -53.7 505.2709 1 98.74 1 55254 AEV 2_3_RA2_01_1224.d 2.37E3 1 1 245 249
K.TLLYSLDE(+43.99)GK.S Y 18.36 1181.5815 10 -98.8 394.8289 3 38.01 1 13279 AEV 2_3_RA2_01_1224.d 5.07E5 1 1 1145 1154 Carboxylation (E)
K.D(-18.01)SEGR.D N 18.20 544.2241 5 3.7 545.2334 1 37.55 1 13019 AEV 2_3_RA2_01_1224.d 0 1 1 1042 1046 Dehydration
R.DISTVPS(+14.02)DTSR.N Y 18.02 1190.5779 11 21.2 596.3088 2 71.20 3 41165 AEV_3_3_RA3_01_1233.d 1.22E5 1 1 1170 1180 Methylation(others)
R.L(+42.01)NEKNEPDC(+57.02)LMGHK.Q Y 17.99 1725.7814 14 39.8 346.1773 5 21.86 1 5339 AEV 2_3_RA2_01_1224.d 0 1 1 556 569 Acetylation (N-term); Carbamidomethylation
R.STEGKS(+13.03)C(+57.02)VPAR.S Y 17.90 1203.6030 11 -7.1 602.8045 2 74.49 2 36243 AEV_1_3_RA2_01_1232.d 1.98E5 1 1 613 623 Michael addition with methylamine; Carbamidomethylation
K.Y(+42.01)LLAAAK(+226.08)SAR.T Y 17.78 1330.7067 10 -0.4 333.6838 4 28.15 2 9878 AEV_1_3_RA2_01_1232.d 0 1 1 251 260 Acetylation (N-term); Biotinylation
R.VPGGSSS(-18.01)Q(+.98)R.V Y 17.74 856.4039 9 -56.0 429.1852 2 25.88 1 6935 AEV 2_3_RA2_01_1224.d 8.78E4 1 1 1446 1454 Dehydration; Deamidation (NQ)
K.TFFTAD(+43.99)NYK(+42.01).G Y 17.69 1191.5084 9 -32.7 398.1638 3 23.62 1 5969 AEV 2_3_RA2_01_1224.d 0 1 1 686 694 Carboxylation (DKW); Acetylation (K)
K.ISYSLNHGK.D Y 17.68 1017.5243 9 -11.1 340.1783 3 65.58 1 30561 AEV 2_3_RA2_01_1224.d 1.77E5 1 1 478 486
R.N(+.98)FLLWGNEVGN(+.98)GK(+14.02).K Y 17.65 1462.7092 13 -12.5 732.3528 2 84.09 3 51085 AEV_3_3_RA3_01_1233.d 0 1 1 1181 1193 Deamidation (NQ); Methylation(KR)
K.DSEGRDYSC(+57.02)STEGGKPTD(+43.99)K.C Y 17.65 2131.8599 19 -6.9 711.6223 3 86.43 1 46905 AEV 2_3_RA2_01_1224.d 9.17E4 1 1 1042 1060 Carbamidomethylation; Carboxylation (DKW)
R.VFSSPAPGLVMGVGN(+.98)TGGHLK(+28.03).D Y 17.64 2053.0667 21 -0.3 514.2738 4 66.78 3 37682 AEV_3_3_RA3_01_1233.d 0 1 1 410 430 Deamidation (NQ); Dimethylation(KR)
K.HPGLR.G Y 17.58 578.3289 5 -92.4 579.2827 1 84.27 1 45199 AEV 2_3_RA2_01_1224.d 7.22E4 2 2 1357 1361
R.SLPVPEGAC(+57.02)K(+14.02).K Y 17.45 1070.5430 10 7.0 536.2825 2 58.78 2 25100 AEV_1_3_RA2_01_1232.d 9.35E4 1 1 624 633 Carbamidomethylation; Methylation(KR)
R.KDSSK.G Y 17.40 563.2914 5 -128.1 564.2266 1 69.01 1 33192 AEV 2_3_RA2_01_1224.d 2.7E4 1 1 702 706
R.KDSSK(-.98).G Y 17.38 562.3074 5 -64.3 563.2786 1 22.13 3 8964 AEV_3_3_RA3_01_1233.d 4.25E4 1 1 702 706 Amidation
R.LLYSDRFFK.Q Y 17.35 1187.6338 9 3.5 396.8866 3 72.21 2 34508 AEV_1_3_RA2_01_1232.d 6.57E4 1 1 216 224
R.T(+79.97)GKISYSLNHGK(+42.01).D Y 17.27 1425.6653 12 -8.3 476.2251 3 15.03 3 5140 AEV_3_3_RA3_01_1233.d 1.14E4 1 1 475 486 Phosphorylation (STY); Acetylation (K)
K.LIC(+57.02)TEDPKAVEWYEPTGYRR.I Y 17.25 2482.1951 20 13.0 828.4164 3 86.82 3 52890 AEV_3_3_RA3_01_1233.d 8.01E4 1 1 1307 1326 Carbamidomethylation
K.ALDEAHK(-2.02).Y Y 17.19 780.3766 7 -72.1 781.3276 1 85.76 1 46386 AEV 2_3_RA2_01_1224.d 0 1 1 450 456 2-amino-3-oxo-butanoic_acid
K.E(+43.01)VNDR.I Y 17.19 674.2983 5 -81.0 675.2510 1 62.11 1 28083 AEV 2_3_RA2_01_1224.d 2.68E5 2 2 194 198 Carbamylation
K.F(+226.08)KAPIPPNQDK(+42.01).L Y 17.08 1521.7649 11 -20.0 508.2521 3 39.26 2 15114 AEV_1_3_RA2_01_1232.d 4.17E5 1 1 775 785 Biotinylation; Acetylation (K)
R.SVRGYARVPGGSSSQR.V Y 17.05 1662.8550 16 33.3 416.7349 4 67.09 2 30723 AEV_1_3_RA2_01_1232.d 0 1 1 1439 1454
K.KFQEPVPQ(+.98)FEPC(+57.02)K.C Y 16.92 1633.7810 13 -25.2 545.5872 3 65.93 3 37008 AEV_3_3_RA3_01_1233.d 0 1 1 586 598 Deamidation (NQ); Carbamidomethylation
R.IPLTK.C N 16.85 570.3741 5 -281.8 571.2206 1 38.79 1 13704 AEV 2_3_RA2_01_1224.d 8.12E4 1 1 1327 1331
R.GYARVPGGS(+79.97)SSQR.V Y 16.76 1400.6198 13 45.7 701.3492 2 75.73 3 44702 AEV_3_3_RA3_01_1233.d 4.13E4 1 1 1442 1454 Phosphorylation (STY)
R.TASVK(+42.01)KYLLAAAK(+42.01)S(+79.97)AR.T Y 16.75 1840.9812 16 4.0 461.2544 4 72.44 3 42144 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 245 260 Acetylation (K); Phosphorylation (STY)
R.STEGKSC(+57.02)VPARSLPVPEGAC(+57.02)K.K Y 16.65 2229.0881 21 -35.4 558.2596 4 92.83 1 51645 AEV 2_3_RA2_01_1224.d 9.88E4 1 1 613 633 Carbamidomethylation
R.D(-18.01)ISTVPSDTSR.N Y 16.47 1158.5516 11 21.4 580.2955 2 55.41 2 23219 AEV_1_3_RA2_01_1232.d 2.4E3 1 1 1170 1180 Dehydration
R.N(+.98)GLGFVD(+21.98)FEK.I Y 16.40 1147.5161 10 -60.0 383.4897 3 48.47 1 19337 AEV 2_3_RA2_01_1224.d 1.4E5 1 1 336 345 Deamidation (NQ); Sodium adduct
K.QLHHIIPHAC(+57.02)PNK(+170.04).E Y 16.39 1733.8459 13 -21.1 578.9437 3 81.01 1 42620 AEV 2_3_RA2_01_1224.d 1.73E4 1 1 1337 1349 Carbamidomethylation; Menadione quinone derivative
K.L(+42.01)IC(+57.02)TEDPK(+42.01).A Y 16.25 1058.4954 8 -77.2 530.2141 2 26.53 1 7235 AEV 2_3_RA2_01_1224.d 5.39E4 1 1 1307 1314 Acetylation (N-term); Carbamidomethylation; Acetylation (K)
R.KALDEAHK.Y Y 16.18 910.4872 8 -0.7 456.2505 2 48.80 2 19845 AEV_1_3_RA2_01_1232.d 0 1 1 449 456
K.C(+57.02)EGGK(+42.01).Q Y 16.18 591.2322 5 -80.8 592.1918 1 20.04 1 4787 AEV 2_3_RA2_01_1224.d 0 1 1 1332 1336 Carbamidomethylation; Acetylation (K)
K.F(+42.01)LLVGSS(+79.97)K(+42.01).R Y 16.14 1013.4835 8 30.6 507.7645 2 58.31 3 31168 AEV_3_3_RA3_01_1233.d 2.02E5 1 1 515 522 Acetylation (N-term); Phosphorylation (STY); Acetylation (K)
R.V(+43.01)PGGSSSQR.V Y 16.09 916.4362 9 10.2 459.2300 2 13.72 3 4450 AEV_3_3_RA3_01_1233.d 0 1 1 1446 1454 Carbamylation
R.L(+316.20)NEKNEPDC(+57.02)LMGHK.Q Y 15.96 1999.9747 14 19.8 501.0108 4 69.65 3 39969 AEV_3_3_RA3_01_1233.d 0 1 1 556 569 Levuglandinyl-lysine pyrrole adduct; Carbamidomethylation
R.SLPVPEGAC(+57.02)K(+42.01).K Y 15.90 1098.5380 10 -56.0 550.2455 2 91.00 1 50349 AEV 2_3_RA2_01_1224.d 0 1 1 624 633 Carbamidomethylation; Acetylation (K)
R.A(+43.01)YTVLESR.T Y 15.90 980.4927 8 -6.0 491.2507 2 49.00 3 25089 AEV_3_3_RA3_01_1233.d 0 1 1 937 944 Carbamylation
R.KDS(-18.01)SK.G Y 15.89 545.2809 5 -24.0 546.2751 1 99.08 3 58768 AEV_3_3_RA3_01_1233.d 0 1 1 702 706 Dehydration
K.ALDEAHK(+14.02).Y Y 15.88 796.4079 7 -112.1 797.3259 1 94.25 1 52641 AEV 2_3_RA2_01_1224.d 4.45E4 1 1 450 456 Methylation(KR)
R.N(+42.01)GLGFVDFE(+21.98)K.I Y 15.83 1188.5427 10 56.8 595.3124 2 27.98 2 9802 AEV_1_3_RA2_01_1232.d 0 1 1 336 345 Acetylation (N-term); Sodium adduct
R.GPQCHSVAYYSTNHGSEWHFLMQY(+79.97)VR.R Y 15.70 3176.3423 26 -41.3 795.0601 4 94.94 1 53105 AEV 2_3_RA2_01_1224.d 0 1 1 811 836 Phosphorylation (STY)
K.F(+42.01)LLVGSSK(+43.01).R Y 15.67 934.5123 8 -26.5 468.2511 2 53.76 2 22368 AEV_1_3_RA2_01_1232.d 1.73E5 1 1 515 522 Acetylation (N-term); Carbamylation
R.VFS(+79.97)SPAPGLVM(+15.99)GVGNTGGHLK.D Y 15.63 2120.0125 21 12.2 531.0168 4 21.96 3 8877 AEV_3_3_RA3_01_1233.d 3.3E4 1 1 410 430 Phosphorylation (STY); Oxidation (M)
R.DISTVPSDTS(-18.01)R.N Y 15.57 1158.5516 11 -50.8 387.1715 3 25.77 1 6894 AEV 2_3_RA2_01_1224.d 1.1E5 1 1 1170 1180 Dehydration
K.KPN(+.98)DKYMGSSGFR(+14.02).L Y 15.51 1500.7031 13 -21.4 501.2309 3 70.92 1 34655 AEV 2_3_RA2_01_1224.d 1.26E5 1 1 634 646 Deamidation (NQ); Methylation(KR)
R.DISTVPSDTS(+79.97)R.N Y 15.45 1256.5286 11 96.2 315.1696 4 37.89 3 18130 AEV_3_3_RA3_01_1233.d 0 1 1 1170 1180 Phosphorylation (STY)
R.NFLLWGNEVGNGK.K Y 15.39 1446.7256 13 -2.1 483.2481 3 64.49 2 28891 AEV_1_3_RA2_01_1232.d 4.28E4 1 1 1181 1193
R.ILTTMPDS(+79.97)TGLK(+14.02).F Y 15.27 1369.6564 12 38.5 685.8618 2 64.83 3 36141 AEV_3_3_RA3_01_1233.d 0 1 1 503 514 Phosphorylation (STY); Methylation(KR)
R.ILTT(-18.01)M(+15.99)PDSTGLK.F Y 15.20 1273.6588 12 10.0 319.4252 4 32.92 2 12084 AEV_1_3_RA2_01_1232.d 8.27E4 1 1 503 514 Dehydration; Oxidation (M)
K.EVNDR(+14.02).I Y 15.17 645.3082 5 9.8 646.3218 1 71.16 3 41138 AEV_3_3_RA3_01_1233.d 0 1 1 194 198 Methylation(KR)
K.FLLVGSS(+79.97)K(+14.02).R Y 15.12 943.4780 8 2.6 472.7475 2 25.80 2 8854 AEV_1_3_RA2_01_1232.d 9.81E2 1 1 515 522 Phosphorylation (STY); Methylation(KR)
K.D(+42.01)WK(+14.02)EASLPDGIK(+42.01).I Y 15.07 1455.7245 12 -91.4 364.9051 4 62.25 1 28191 AEV 2_3_RA2_01_1224.d 1.27E5 1 1 487 498 Acetylation (N-term); Methylation(KR); Acetylation (K)
total 125 peptides
C1G820
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VGDIVDIKVNGAVQQGMPFK.I Y 121.02 2114.1194 20 -3.3 705.7114 3 78.79 2 39594 AEV_1_3_RA2_01_1232.d 1.98E5 2 2 36 55
K.KGVIPLSTFLR.V Y 114.87 1229.7495 11 4.8 410.9258 3 77.82 2 38853 AEV_1_3_RA2_01_1232.d 1.97E6 8 8 22 32
K.VNGAVQQGMPFK.I Y 104.54 1274.6442 12 1.9 638.3306 2 62.74 2 27703 AEV_1_3_RA2_01_1232.d 6.57E5 5 5 44 55
R.VGDIVDIKVN(+.98)GAVQQGMPFK.I Y 99.67 2115.1033 20 1.5 706.0428 3 79.67 2 40303 AEV_1_3_RA2_01_1232.d 6.06E5 2 2 36 55 Deamidation (NQ)
R.TVSTEGNLPETITPVPYETTI Y 92.82 2261.1313 21 -0.5 1131.5724 2 85.31 3 51935 AEV_3_3_RA3_01_1233.d 7.2E5 3 3 140 160
K.GVIPLSTFLR.V Y 82.01 1101.6545 10 -1.9 551.8335 2 82.75 3 50150 AEV_3_3_RA3_01_1233.d 4.66E6 6 6 23 32
K.AKEEGIHVHLKR.Q Y 80.18 1415.7997 12 7.1 708.9121 2 24.56 3 10324 AEV_3_3_RA3_01_1233.d 1.03E6 7 7 119 130
R.KAKEEGIHVHLKR.Q Y 80.01 1543.8947 13 0.2 515.6389 3 21.37 3 8581 AEV_3_3_RA3_01_1233.d 1.2E6 5 5 118 130
R.IEHVSHSR.S Y 77.99 963.4886 8 5.2 482.7541 2 9.69 2 2379 AEV_1_3_RA2_01_1232.d 1.88E5 3 3 93 100
K.VNGAVQQGM(+15.99)PFK.I Y 77.39 1290.6390 12 1.5 646.3278 2 44.48 3 22223 AEV_3_3_RA3_01_1233.d 1.16E5 5 5 44 55 Oxidation (M)
K.KGVIPLSTFLRVYR.V Y 73.31 1647.9824 14 3.7 413.0044 4 78.52 3 46913 AEV_3_3_RA3_01_1233.d 2.67E4 1 1 22 35
K.TGVVYNVTK.S Y 73.04 979.5338 9 3.4 490.7758 2 46.45 2 18650 AEV_1_3_RA2_01_1232.d 5.1E6 9 9 61 69
K.RQPVGPR.E Y 72.49 808.4667 7 1.1 405.2411 2 11.78 3 3404 AEV_3_3_RA3_01_1233.d 1.3E6 4 4 130 136
K.SAVGVIIYKR.V Y 72.26 1104.6655 10 -15.4 553.3315 2 57.98 3 30937 AEV_3_3_RA3_01_1233.d 2.18E6 6 6 70 79
K.AKEEGIHVHLK.R Y 71.82 1259.6986 11 -2.5 630.8550 2 26.81 3 11588 AEV_3_3_RA3_01_1233.d 5.93E5 4 4 119 129
K.KKGVIPLSTFLR.V Y 70.42 1357.8445 12 0.7 453.6224 3 72.29 2 34571 AEV_1_3_RA2_01_1232.d 3.97E5 4 4 21 32
K.VN(-17.03)GAVQQGMPFK.I Y 70.32 1257.6176 12 3.3 629.8181 2 76.18 2 37530 AEV_1_3_RA2_01_1232.d 1.57E5 1 1 44 55 Ammonia-loss (N)
K.VN(+.98)GAVQQGMPFK.I Y 66.62 1275.6282 12 3.5 638.8236 2 65.58 2 29671 AEV_1_3_RA2_01_1232.d 1.76E5 2 2 44 55 Deamidation (NQ)
K.VNGAVQQGMPFKIYHGK.T Y 66.02 1872.9668 17 -6.6 625.3254 3 64.01 3 35507 AEV_3_3_RA3_01_1233.d 2.17E5 2 2 44 60
R.VNVRIEHVSHSR.S Y 58.55 1431.7695 12 1.9 478.2647 3 26.10 3 11198 AEV_3_3_RA3_01_1233.d 9.87E5 5 5 89 100
R.YAFSRDYK.K Y 58.24 1048.4978 8 2.2 525.2573 2 40.29 3 19563 AEV_3_3_RA3_01_1233.d 8.31E5 6 6 13 20
M.GHSHGLR.S Y 56.01 762.3885 7 5.4 382.2036 2 9.06 2 2165 AEV_1_3_RA2_01_1232.d 1.05E5 2 2 2 8
K.TGVVYNVTK(+14.02).S Y 53.17 993.5495 9 -0.5 497.7818 2 52.86 3 27618 AEV_3_3_RA3_01_1233.d 4.04E5 2 2 61 69 Methylation(KR)
K.VNGAVQ(+.98)QGMPFK.I Y 52.17 1275.6282 12 -1.5 638.8204 2 64.02 3 35519 AEV_3_3_RA3_01_1233.d 4.8E4 1 1 44 55 Deamidation (NQ)
R.VYRVGDIVDIK.V Y 52.15 1275.7186 11 -0.6 638.8662 2 69.71 3 40011 AEV_3_3_RA3_01_1233.d 2.85E5 3 3 33 43
R.TVSTE(+14.02)GNLPETITPVPYETTI Y 50.46 2275.1472 21 0.1 1138.5811 2 86.67 3 52821 AEV_3_3_RA3_01_1233.d 2.2E5 1 1 140 160 Methylation(others)
R.SREEFLR.R Y 49.63 935.4824 7 0.4 468.7487 2 31.69 3 14410 AEV_3_3_RA3_01_1233.d 5.04E6 12 12 101 107
K.SAVGVIIYK.R Y 49.45 948.5644 9 -90.5 475.2466 2 73.30 1 36584 AEV 2_3_RA2_01_1224.d 4.92E5 2 2 70 78
R.TVSTEGNLPETITPVPYE(+14.02)TTI Y 49.06 2275.1472 21 -0.3 1138.5806 2 87.37 3 53237 AEV_3_3_RA3_01_1233.d 2.77E5 2 2 140 160 Methylation(others)
R.SREEFLRR.V Y 48.88 1091.5835 8 4.9 364.8702 3 30.75 2 11090 AEV_1_3_RA2_01_1232.d 1.83E6 3 3 101 108
R.SGTRYAFSR.D Y 47.17 1043.5148 9 1.4 522.7654 2 29.01 3 12816 AEV_3_3_RA3_01_1233.d 5.81E5 3 3 9 17
K.GVIPLSTFLR(+14.02).V Y 46.50 1115.6703 10 -0.4 558.8422 2 84.40 3 51306 AEV_3_3_RA3_01_1233.d 3.22E5 2 2 23 32 Methylation(KR)
R.VGDIVDIK.V Y 44.97 857.4858 8 -0.4 429.7500 2 61.79 2 27050 AEV_1_3_RA2_01_1232.d 3.59E6 6 6 36 43
R.Q(-17.03)PVGPR.E Y 41.59 635.3391 6 -88.0 318.6489 2 39.69 1 14223 AEV 2_3_RA2_01_1224.d 6.08E5 4 4 131 136 Pyro-glu from Q
K.TGVVYN(+.98)VTK.S Y 41.58 980.5178 9 -88.0 491.2230 2 61.76 1 27809 AEV 2_3_RA2_01_1224.d 1.04E5 1 1 61 69 Deamidation (NQ)
R.SREEFLR(+14.02).R Y 41.11 949.4981 7 0.2 475.7564 2 42.09 3 20711 AEV_3_3_RA3_01_1233.d 3.53E5 3 3 101 107 Methylation(KR)
R.QPVGPR.E Y 37.98 652.3656 6 0.3 327.1902 2 13.11 2 3664 AEV_1_3_RA2_01_1232.d 1.56E5 5 5 131 136
K.TGVVYN(+.98)VTK(+14.02).S Y 34.97 994.5335 9 -2.1 498.2730 2 55.71 2 23373 AEV_1_3_RA2_01_1232.d 0 1 1 61 69 Deamidation (NQ); Methylation(KR)
K.EEGIHVHLKR.Q Y 34.03 1216.6676 10 -5.9 609.3375 2 30.05 3 13416 AEV_3_3_RA3_01_1233.d 3.33E4 1 1 121 130
R.YAFSR(+14.02).D Y 33.15 656.3282 5 -0.3 329.1713 2 38.59 3 18546 AEV_3_3_RA3_01_1233.d 4.07E5 3 3 13 17 Methylation(KR)
K.RQPVGPR(+14.02).E Y 32.23 822.4824 7 -10.0 412.2443 2 14.90 3 5069 AEV_3_3_RA3_01_1233.d 3.34E4 2 2 130 136 Methylation(KR)
K.VNGAVQQ(+.98)GMPFK.I Y 31.85 1275.6282 12 6.1 638.8253 2 64.68 2 29034 AEV_1_3_RA2_01_1232.d 1.75E4 1 1 44 55 Deamidation (NQ)
K.VNGAVQQGM(+31.99)PFKIYHGK.T Y 31.62 1904.9567 17 7.9 477.2502 4 64.02 2 28574 AEV_1_3_RA2_01_1232.d 5.79E4 1 1 44 60 Sulphone
K.KGVIPLSTFLR(+14.02).V Y 30.48 1243.7653 11 -94.5 415.5565 3 88.71 1 48682 AEV 2_3_RA2_01_1224.d 9.61E4 1 1 22 32 Methylation(KR)
R.YAFSR.D Y 30.20 642.3125 5 4.7 322.1650 2 33.89 2 12539 AEV_1_3_RA2_01_1232.d 3.52E6 7 7 13 17
K.RVNVRIEHVSHSR.S Y 28.94 1587.8706 13 -2.5 397.9739 4 25.22 3 10694 AEV_3_3_RA3_01_1233.d 7.91E4 1 1 88 100
K.RQ(+.98)PVGPR.E Y 28.76 809.4507 7 -90.1 405.6962 2 28.94 1 8445 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 130 136 Deamidation (NQ)
R.VNVRIE(+14.02)HVSHSR.S Y 28.13 1445.7852 12 5.9 482.9385 3 33.10 3 15208 AEV_3_3_RA3_01_1233.d 3.68E4 1 1 89 100 Methylation(others)
M(+15.99)GHSHGLR.S Y 26.60 909.4239 8 7.9 304.1510 3 42.47 1 15842 AEV 2_3_RA2_01_1224.d 1.57E4 1 1 1 8 Oxidation (M)
R.VGNRYIEK.R Y 26.26 977.5294 8 2.3 489.7731 2 23.02 2 7654 AEV_1_3_RA2_01_1232.d 1.63E5 2 2 80 87
R.VKENAVKK.R Y 24.83 914.5549 8 -14.8 458.2780 2 8.40 2 1981 AEV_1_3_RA2_01_1232.d 4.5E3 2 2 109 116
K.AK(+14.02)EEGIHVHLKR.Q Y 23.95 1429.8153 12 3.5 358.4623 4 31.96 3 14545 AEV_3_3_RA3_01_1233.d 2.67E5 1 1 119 130 Methylation(KR)
R.IE(+43.99)HVSHSR.S Y 23.41 1007.4785 8 -61.9 336.8127 3 26.53 1 7237 AEV 2_3_RA2_01_1224.d 0 2 2 93 100 Carboxylation (E)
R.SR(+14.02)EEFLR.R Y 22.44 949.4981 7 7.0 317.5089 3 47.65 2 19256 AEV_1_3_RA2_01_1232.d 3.39E5 2 2 101 107 Methylation(KR)
R.Q(+.98)PVGPR.E Y 21.88 653.3497 6 -85.4 327.6542 2 22.72 1 5632 AEV 2_3_RA2_01_1224.d 0 1 1 131 136 Deamidation (NQ)
R.IE(+14.02)HVSHSR.S Y 21.40 977.5043 8 5.4 489.7621 2 13.31 2 3708 AEV_1_3_RA2_01_1232.d 2.35E4 1 1 93 100 Methylation(others)
K.ENAVK.K N 20.98 559.2966 5 -113.4 560.2404 1 49.76 1 20115 AEV 2_3_RA2_01_1224.d 0 1 1 111 115
R.VGNRYIEKR.V Y 20.54 1133.6305 9 2.8 567.8241 2 17.81 3 6654 AEV_3_3_RA3_01_1233.d 2.99E4 1 1 80 88
K.R(+14.02)QPVGPREAR.T Y 19.93 1178.6632 10 -6.7 393.8924 3 67.86 2 31266 AEV_1_3_RA2_01_1232.d 7.43E4 1 1 130 139 Methylation(KR)
R.SRE(+14.02)EFLR.R Y 19.73 949.4981 7 3.3 475.7579 2 47.89 2 19414 AEV_1_3_RA2_01_1232.d 8.67E4 1 1 101 107 Methylation(others)
K.IYHGK(+14.02).T Y 18.67 630.3489 5 -102.1 631.2919 1 28.31 1 8101 AEV 2_3_RA2_01_1224.d 1.91E4 1 1 56 60 Methylation(KR)
K.VN(+.98)GAVQ(+.98)QGMPFK.I Y 18.06 1276.6122 12 -97.6 639.2510 2 70.93 1 34727 AEV 2_3_RA2_01_1224.d 0 1 1 44 55 Deamidation (NQ)
R.EEFLR.R N 17.98 692.3493 5 -83.7 347.1530 2 55.76 1 23673 AEV 2_3_RA2_01_1224.d 2.04E5 1 1 103 107
R.Q(+42.01)PVGPR.E Y 17.73 694.3762 6 0.5 348.1956 2 14.60 3 4884 AEV_3_3_RA3_01_1233.d 2.05E4 1 1 131 136 Acetylation (N-term)
R.IEHVSHSR(+31.99)SR.E Y 17.45 1238.6116 10 -2.1 620.3118 2 50.19 3 25851 AEV_3_3_RA3_01_1233.d 8.96E4 1 1 93 102 Dihydroxy
R.VYRVGDIVDIK(+14.02).V Y 17.30 1289.7343 11 14.8 430.9250 3 70.75 3 40811 AEV_3_3_RA3_01_1233.d 1.48E3 1 1 33 43 Methylation(KR)
R.Q(-17.03)PVGPREAR.T Y 17.10 991.5199 9 -0.4 496.7670 2 32.60 3 14935 AEV_3_3_RA3_01_1233.d 1.62E5 1 1 131 139 Pyro-glu from Q
K.TGVVYNVTK(+42.01).S Y 16.78 1021.5444 9 -11.3 341.5182 3 75.16 2 36737 AEV_1_3_RA2_01_1232.d 3.18E4 1 1 61 69 Acetylation (K)
R.VKENAVK.K Y 16.53 786.4599 7 -7.2 394.2344 2 8.99 2 2148 AEV_1_3_RA2_01_1232.d 3.43E3 1 1 109 115
K.E(-18.01)NAVK.K N 15.16 541.2860 5 -1.8 542.2923 1 32.38 3 14797 AEV_3_3_RA3_01_1233.d 9.8E4 1 1 111 115 Pyro-glu from E
R.IEHVSHSRSR.E Y 15.14 1206.6217 10 -5.2 403.2124 3 23.37 3 9636 AEV_3_3_RA3_01_1233.d 7.77E4 1 1 93 102
total 71 peptides
C1GCI0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.LWNDVFNLAQDYVGMPR.G Y 115.48 2036.9778 17 0.6 1019.4968 2 90.89 2 47705 AEV_1_3_RA2_01_1232.d 4.34E5 4 4 226 242
R.AGHDGTWVAHPALAK.I Y 105.89 1529.7739 15 -2.7 510.9305 3 49.66 3 25517 AEV_3_3_RA3_01_1233.d 6.99E5 4 4 362 376
K.LLQEQTDELASK.A Y 96.48 1373.7037 12 -0.4 687.8589 2 59.52 3 32055 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 484 495
R.REDVHITANDLLNTNVPGR.I Y 91.22 2133.0925 19 -1.4 534.2797 4 70.66 3 40765 AEV_3_3_RA3_01_1233.d 1.38E5 2 2 396 414
R.SDRQAELDRGSLLDFLPETK.H Y 89.85 2289.1599 20 -0.8 573.2968 4 79.16 3 47421 AEV_3_3_RA3_01_1233.d 4.49E5 3 3 52 71
M.A(+42.01)YVDTLLKDVAILGPLNDQTR.K Y 89.00 2356.2637 21 -1.6 786.4272 3 95.96 3 57626 AEV_3_3_RA3_01_1233.d 6.1E5 6 6 2 22 Acetylation (Protein N-term)
R.ENDAWKGAPPAPGLVDR.R Y 85.41 1791.8904 17 -2.8 598.3024 3 67.27 3 38065 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 75 91
M.A(+42.01)YVDTLLKDVAILGPLNDQTRK.I Y 85.36 2484.3586 22 5.0 829.1310 3 91.90 3 55758 AEV_3_3_RA3_01_1233.d 2.22E5 3 3 2 23 Acetylation (Protein N-term)
K.IATDIFDQYMPTPNQLFVR.R Y 81.16 2268.1248 19 8.7 757.0554 3 89.77 2 47113 AEV_1_3_RA2_01_1232.d 4.93E5 5 5 377 395
K.EATAFLALLHR.T Y 79.25 1240.6927 11 -4.0 414.5699 3 78.75 3 47088 AEV_3_3_RA3_01_1233.d 4.27E5 4 4 28 38
K.ILTKEATAFLALLHR.T Y 78.66 1696.0035 15 -0.7 425.0078 4 82.18 3 49728 AEV_3_3_RA3_01_1233.d 3.44E4 1 1 24 38
R.GAGPYFYLPK.M Y 77.23 1111.5702 10 1.6 556.7933 2 75.41 2 36920 AEV_1_3_RA2_01_1232.d 1.04E6 4 4 208 217
M.AYVDTLLKDVAILGPLNDQTR.K Y 72.15 2314.2532 21 0.3 772.4252 3 88.57 3 53934 AEV_3_3_RA3_01_1233.d 6.57E4 1 1 2 22
R.RVEITGPTDR.K Y 69.87 1142.6044 10 1.4 381.8759 3 33.27 3 15337 AEV_3_3_RA3_01_1233.d 1.02E6 4 4 92 101
R.RVEITGPTDRK.M Y 69.06 1270.6993 11 2.2 424.5746 3 24.52 3 10294 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 92 102
K.ANEAAMASVR.A Y 68.30 1018.4866 10 5.3 510.2533 2 34.57 2 12872 AEV_1_3_RA2_01_1232.d 3.61E5 3 3 344 353
K.M(+15.99)ESHLEAR.L Y 66.31 987.4443 8 7.3 494.7330 2 12.84 2 3534 AEV_1_3_RA2_01_1232.d 1.14E5 2 2 218 225 Oxidation (M)
K.RGAGPYFYLPK.M Y 66.13 1267.6713 11 -1.2 423.5639 3 67.70 3 38414 AEV_3_3_RA3_01_1233.d 2.54E5 2 2 207 217
R.GSLLDFLPETK.H Y 65.44 1218.6495 11 -4.0 610.3296 2 83.85 3 50910 AEV_3_3_RA3_01_1233.d 0 1 1 61 71
R.Q(-17.03)AELDRGSLLDFLPETK.H Y 58.88 1913.9734 17 4.1 957.9979 2 87.02 2 45656 AEV_1_3_RA2_01_1232.d 9.03E4 1 1 55 71 Pyro-glu from Q
R.LWNDVFNLAQDYVGM(+15.99)PR.G Y 54.47 2052.9727 17 4.7 1027.4984 2 88.49 3 53884 AEV_3_3_RA3_01_1233.d 2.27E5 3 3 226 242 Oxidation (M)
K.ANEAAM(+15.99)ASVR.A Y 53.97 1034.4814 10 -84.7 518.2042 2 26.95 1 7437 AEV 2_3_RA2_01_1224.d 3.19E5 4 4 344 353 Oxidation (M)
R.SDVTMTVPFMDAYVK.L Y 53.18 1702.7947 15 -0.1 852.4045 2 84.12 2 43699 AEV_1_3_RA2_01_1232.d 1.2E5 3 3 301 315
R.HNPSFVLPDR.S Y 50.81 1180.5989 10 -94.8 394.5029 3 70.47 1 34324 AEV 2_3_RA2_01_1224.d 1.48E5 1 1 291 300
M.A(+42.01)YVDTLLKDVAILGPLNDQTR(+14.02).K Y 47.45 2370.2795 21 15.7 791.1129 3 95.73 3 57533 AEV_3_3_RA3_01_1233.d 6.44E4 2 2 2 22 Acetylation (Protein N-term); Methylation(KR)
M.A(+42.01)YVDTLLKDVAILGPLNDQ(+.98)TR.K Y 45.92 2357.2478 21 -7.5 1179.6223 2 96.53 3 57852 AEV_3_3_RA3_01_1233.d 1.32E4 1 1 2 22 Acetylation (Protein N-term); Deamidation (NQ)
R.Q(+.98)VD(-18.01)FKQGGKDYK.L Y 43.22 1394.6830 12 3.6 465.9033 3 47.05 3 23841 AEV_3_3_RA3_01_1233.d 1.99E5 1 1 144 155 Deamidation (NQ); Dehydration
R.VEITGPTDR(+14.02).K Y 39.43 1000.5189 9 1.0 501.2672 2 48.50 3 24766 AEV_3_3_RA3_01_1233.d 0 1 1 93 101 Methylation(KR)
R.LWNDVFNLAQDY(-2.02)VGMPR.G Y 37.48 2034.9622 17 32.0 679.3497 3 90.86 2 47646 AEV_1_3_RA2_01_1232.d 0 1 1 226 242 2-amino-3-oxo-butanoic_acid
R.KLPTLIAR.A Y 37.33 910.5964 8 3.1 304.5403 3 58.41 3 31232 AEV_3_3_RA3_01_1233.d 5.38E5 4 4 161 168
R.RSDRQAELDRGSLLDFLPETK.H Y 35.55 2445.2612 21 10.5 490.0646 5 76.56 3 45347 AEV_3_3_RA3_01_1233.d 5.79E4 1 1 51 71
R.GSLLDFLPETK(+14.02).H Y 33.39 1232.6652 11 3.5 617.3420 2 86.16 2 45085 AEV_1_3_RA2_01_1232.d 6.44E4 1 1 61 71 Methylation(KR)
R.Q(-17.03)AELDR(+14.02)GSLLDFLPETK.H Y 32.25 1927.9890 17 3.6 965.0052 2 87.75 3 53431 AEV_3_3_RA3_01_1233.d 2.94E4 1 1 55 71 Pyro-glu from Q; Methylation(KR)
R.SQLWQWVK.H Y 31.91 1073.5658 8 -1.8 537.7892 2 77.42 3 46037 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 458 465
R.Q(-17.03)AELDRGSLLDFLPETK(+14.02).H Y 31.14 1927.9890 17 -0.6 965.0012 2 87.33 3 53198 AEV_3_3_RA3_01_1233.d 3.84E4 1 1 55 71 Pyro-glu from Q; Methylation(KR)
R.Q(+42.01)AELDRGSLLDFLPET(+79.97)K.H Y 30.27 2052.9768 17 -14.3 685.3231 3 82.33 1 43658 AEV 2_3_RA2_01_1224.d 0 1 1 55 71 Acetylation (N-term); Phosphorylation (STY)
R.QVD(+43.99)FK.Q Y 30.00 679.3177 5 44.2 680.3550 1 98.81 1 55272 AEV 2_3_RA2_01_1224.d 0 1 1 144 148 Carboxylation (DKW)
R.TFNPTR.K Y 29.99 734.3711 6 -86.5 368.1611 2 36.57 1 12482 AEV 2_3_RA2_01_1224.d 1.57E5 5 5 39 44
R.GAGPYFYLPK(+14.02).M Y 29.53 1125.5858 10 3.7 563.8022 2 78.22 2 39146 AEV_1_3_RA2_01_1232.d 8.29E4 1 1 208 217 Methylation(KR)
M.A(+42.01)YVDTLLKDVAILGPLN(+.98)DQTR.K Y 29.46 2357.2478 21 7.1 786.7621 3 96.67 2 49901 AEV_1_3_RA2_01_1232.d 4.03E4 1 1 2 22 Acetylation (Protein N-term); Deamidation (NQ)
K.NLNIGLSYMEGWLR.G Y 24.87 1664.8345 14 0.4 833.4249 2 88.98 3 54137 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 423 436
R.REDVHITANDLLNT(-18.01)NVPGR(+14.02).I Y 23.96 2129.0977 19 23.8 533.2944 4 70.69 3 40764 AEV_3_3_RA3_01_1233.d 3.86E4 1 1 396 414 Dehydration; Methylation(KR)
R.VEITGPTDR.K Y 23.36 986.5032 9 -85.3 494.2168 2 51.99 1 21353 AEV 2_3_RA2_01_1224.d 2.8E5 2 2 93 101
K.DVAILGPLND(+61.92)QTR.K Y 22.89 1472.6685 13 0.1 737.3416 2 78.32 3 46751 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 10 22 Replacement of proton by copper
K.ANEAAM(+15.99)ASVRADK.L Y 22.68 1348.6405 13 -25.1 675.3106 2 55.08 2 23047 AEV_1_3_RA2_01_1232.d 0 1 1 344 356 Oxidation (M)
R.TFNPTRK.A Y 22.63 862.4661 7 8.3 432.2439 2 17.06 2 5182 AEV_1_3_RA2_01_1232.d 2.02E4 1 1 39 45
R.GVGC(+57.02)IPIN(+.98)YLMEDAATAEVSR.S Y 21.71 2266.0610 21 12.8 1134.0522 2 86.25 2 45145 AEV_1_3_RA2_01_1232.d 4.63E4 1 1 437 457 Carbamidomethylation; Deamidation (NQ)
K.ANEAAMASVRADK(+42.01).L Y 21.30 1374.6561 13 -47.6 688.3026 2 89.34 1 49137 AEV 2_3_RA2_01_1224.d 0 1 1 344 356 Acetylation (K)
R.IT(+79.96)EDGIR.K Y 21.07 882.3752 7 -3.5 442.1934 2 60.26 1 26680 AEV 2_3_RA2_01_1224.d 0 1 1 415 421 Sulfation
R.SQLWQ(+.98)WVK(+21.98).H Y 20.83 1096.5317 8 2.6 1097.5419 1 72.96 2 35086 AEV_1_3_RA2_01_1232.d 2.36E4 1 1 458 465 Deamidation (NQ); Sodium adduct
K.LLQEQT(+79.97)DELASK(-.98).A Y 19.63 1452.6862 12 43.3 727.3818 2 92.58 3 56091 AEV_3_3_RA3_01_1233.d 0 1 1 484 495 Phosphorylation (STY); Amidation
R.VEITGPTDRK.M Y 19.41 1114.5981 10 -110.5 558.2448 2 44.14 1 16767 AEV 2_3_RA2_01_1224.d 0 1 1 93 102
K.LLQ(+.98)EQTDELASK(+14.02).A Y 19.11 1388.7035 12 -14.4 695.3490 2 63.43 3 35066 AEV_3_3_RA3_01_1233.d 0 1 1 484 495 Deamidation (NQ); Methylation(KR)
K.LLQEQT(+95.94)DELASK.A Y 19.09 1469.6472 12 6.4 735.8356 2 63.63 1 29267 AEV 2_3_RA2_01_1224.d 8.75E4 1 1 484 495 Thiophosphorylation
R.V(+27.99)EITGPTDR(+14.02).K Y 18.70 1028.5138 9 26.1 515.2776 2 66.27 2 30146 AEV_1_3_RA2_01_1232.d 1.09E5 1 1 93 101 Formylation; Methylation(KR)
R.ADKLREVR.A Y 18.64 985.5668 8 -4.4 493.7885 2 14.71 3 4948 AEV_3_3_RA3_01_1233.d 2.56E4 1 1 354 361
K.DVAILGPLNDQT(+79.97)R.K Y 18.59 1490.7130 13 -7.0 497.9081 3 70.69 3 40768 AEV_3_3_RA3_01_1233.d 0 1 1 10 22 Phosphorylation (STY)
R.QVDFK.Q Y 18.49 635.3279 5 -149.4 636.2402 1 33.38 1 10855 AEV 2_3_RA2_01_1224.d 6.08E4 2 2 144 148
R.QVDFKQGGK(+226.08).D Y 18.47 1231.6019 9 -5.0 616.8052 2 32.74 2 12001 AEV_1_3_RA2_01_1232.d 1.42E5 1 1 144 152 Biotinylation
K.D(+226.08)VAILGPLNDQTRK.I Y 18.32 1764.9192 14 1.5 442.2377 4 74.06 3 43396 AEV_3_3_RA3_01_1233.d 0 1 1 10 23 Biotinylation
R.QAE(+14.02)LDR.G Y 18.26 744.3766 6 -112.4 745.3002 1 108.49 1 58327 AEV 2_3_RA2_01_1224.d 6.19E5 1 1 55 60 Methylation(others)
R.Q(+.98)VDFKQGGK(+14.02).D Y 17.89 1020.5240 9 16.9 511.2779 2 74.98 2 36601 AEV_1_3_RA2_01_1232.d 6.36E4 1 1 144 152 Deamidation (NQ); Methylation(KR)
R.GSLLDF(+31.99)LPETK.H Y 17.82 1250.6394 11 -18.8 626.3152 2 65.16 3 36408 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 61 71 Dihydroxy
R.K(+31.99)LPTLIAR.A Y 17.62 942.5862 8 -1.1 315.2023 3 62.50 2 27538 AEV_1_3_RA2_01_1232.d 7.58E4 1 1 161 168 Dihydroxy
R.QVDFK(-.98).Q Y 17.57 634.3438 5 -35.8 635.3284 1 81.02 3 48861 AEV_3_3_RA3_01_1233.d 7.6E4 1 1 144 148 Amidation
R.QAELDRGSLLDFLPETKHIRENDAWK.G Y 17.02 3080.5679 26 -31.0 617.1017 5 32.30 3 14757 AEV_3_3_RA3_01_1233.d 0 1 1 55 80
R.KLP(+31.99)TLIAR.A Y 16.90 942.5862 8 -113.2 315.1671 3 55.70 1 23631 AEV 2_3_RA2_01_1224.d 0 1 1 161 168 Dihydroxy
R.TDRKLPTLIAR.A Y 16.73 1282.7721 11 -1.0 321.7000 4 56.01 3 29539 AEV_3_3_RA3_01_1233.d 7.47E4 1 1 158 168
R.G(+42.01)SLLDFLPETK(+42.01).H Y 16.71 1302.6707 11 -22.0 652.3282 2 65.08 2 29371 AEV_1_3_RA2_01_1232.d 9.59E4 1 1 61 71 Acetylation (N-term); Acetylation (K)
R.ITE(+14.02)DGIRK.N Y 16.47 944.5291 8 -28.4 473.2584 2 70.12 2 32936 AEV_1_3_RA2_01_1232.d 0 1 1 415 422 Methylation(others)
K.G(+43.01)APPAPGLVDRR.V Y 16.21 1247.6735 12 -12.3 416.8933 3 45.78 3 23046 AEV_3_3_RA3_01_1233.d 1.59E5 1 1 81 92 Carbamylation
K.GAPPAPGLVD(+43.99)R.R Y 15.78 1092.5563 11 -2.8 547.2839 2 71.24 2 33806 AEV_1_3_RA2_01_1232.d 0 1 1 81 91 Carboxylation (DKW)
K.AYALK(+226.08).L Y 15.71 790.4047 5 -5.5 791.4077 1 89.72 3 54565 AEV_3_3_RA3_01_1233.d 1.61E5 1 1 479 483 Biotinylation
R.SDVTMTVPFMDAYVK(+27.99).L Y 15.60 1730.7896 15 7.4 433.7079 4 61.32 1 27468 AEV 2_3_RA2_01_1224.d 1.81E5 1 1 301 315 Formylation
K.R(+42.01)GAGPYFYLPK(+42.01).M Y 15.60 1351.6924 11 -9.7 451.5670 3 33.61 3 15514 AEV_3_3_RA3_01_1233.d 0 1 1 207 217 Acetylation (N-term); Acetylation (K)
K.D(+43.99)DPK(+14.02)ANEAAMASVRADK.L Y 15.57 1845.8527 17 9.5 616.2974 3 33.87 3 15672 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 340 356 Carboxylation (DKW); Methylation(KR)
K.LLQEQT(+79.97)DELASK(+226.08).A Y 15.42 1679.7477 12 -10.9 560.9171 3 64.13 1 29660 AEV 2_3_RA2_01_1224.d 1.13E5 1 1 484 495 Phosphorylation (STY); Biotinylation
K.DVAILGPLND(-18.01)Q(+.98)TR.K Y 15.11 1393.7201 13 -34.3 349.4254 4 57.19 3 30361 AEV_3_3_RA3_01_1233.d 2.43E5 1 1 10 22 Dehydration; Deamidation (NQ)
K.GAPPAPGLVDR(+14.02).R Y 15.10 1062.5822 11 -18.9 355.1946 3 40.36 2 15641 AEV_1_3_RA2_01_1232.d 0 1 1 81 91 Methylation(KR)
R.D(+17.03)HSSGLNC(+57.02)GR.W Y 15.06 1118.4886 10 -58.8 560.2187 2 55.21 1 23305 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 269 278 Replacement of proton with ammonium ion; Carbamidomethylation
R.TFNP(+31.99)T(+79.97)R.K Y 15.02 846.3273 6 7.2 847.3406 1 112.20 3 62590 AEV_3_3_RA3_01_1233.d 4.65E3 1 1 39 44 Dihydroxy; Phosphorylation (STY)
total 81 peptides
C1G1C8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TLSAISPYFSIAAGFGNVHGVYKPGNVR.L Y 148.18 2921.5188 28 0.3 731.3872 4 83.01 2 42885 AEV_1_3_RA2_01_1232.d 4.4E5 3 3 209 236
K.VFAIPAINVTSSSAVVAALEAAR.D Y 109.26 2256.2478 23 4.7 753.0934 3 91.69 2 48030 AEV_1_3_RA2_01_1232.d 5.9E5 5 5 30 52
R.DKNSPIILQVSQGGAAFFAGK.G Y 106.80 2147.1375 21 1.7 716.7210 3 83.27 2 43075 AEV_1_3_RA2_01_1232.d 2.98E5 2 2 53 73
K.GVPNGNQEASVAGAIAAAHYIR.S Y 102.35 2165.0977 22 -1.1 722.7057 3 76.58 2 37845 AEV_1_3_RA2_01_1232.d 7.69E5 4 4 74 95
R.SIAPSYGIPVVLHTDHC(+57.02)AK.K Y 90.39 2064.0461 19 -2.6 517.0175 4 70.66 3 40742 AEV_3_3_RA3_01_1233.d 7.96E5 3 3 96 114 Carbamidomethylation
K.GVPN(+.98)GNQEASVAGAIAAAHYIR.S Y 81.20 2166.0818 22 4.7 723.0380 3 78.09 2 39042 AEV_1_3_RA2_01_1232.d 4.75E5 2 2 74 95 Deamidation (NQ)
K.KLLPWLDGMLDADER.Y Y 81.04 1770.8975 15 10.3 591.3125 3 86.11 2 45053 AEV_1_3_RA2_01_1232.d 2.16E4 1 1 115 129
R.LHPELLSK.H Y 80.93 935.5440 8 -6.7 936.5450 1 45.52 3 22884 AEV_3_3_RA3_01_1233.d 2E6 10 10 237 244
K.INLDTDLQYAYLSGVRDFVLK.K Y 71.32 2442.2793 21 10.8 815.1091 3 88.70 3 54014 AEV_3_3_RA3_01_1233.d 6.24E4 2 2 287 307
K.AEFKEAISYGVVK.I Y 64.01 1439.7660 13 39.3 480.9481 3 65.98 3 37046 AEV_3_3_RA3_01_1233.d 1.04E5 2 2 274 286
R.LFQHAQEK.V Y 59.36 999.5137 8 11.7 500.7700 2 19.42 3 7531 AEV_3_3_RA3_01_1233.d 3.62E5 3 3 22 29
K.INLDTDLQYAYLSGVR.D Y 57.05 1839.9366 16 3.9 614.3219 3 83.14 2 42984 AEV_1_3_RA2_01_1232.d 0 1 1 287 302
K.TGVIVGDDVLR.L Y 55.57 1142.6295 11 -10.5 572.3160 2 70.27 2 33100 AEV_1_3_RA2_01_1232.d 4.71E5 2 2 11 21
R.KTGVIVGDDVLR.L Y 54.55 1270.7245 12 -24.9 636.3537 2 62.07 3 34017 AEV_3_3_RA3_01_1233.d 3.31E5 4 4 10 21
R.VQEAFDDFNTSNQL Y 52.17 1626.7162 14 -1.2 814.3644 2 79.54 3 47715 AEV_3_3_RA3_01_1233.d 3.08E5 2 2 347 360
K.VFAIPAINVTSSSAVVAALEAAR(+14.02).D Y 48.80 2270.2634 23 6.4 757.7666 3 93.17 2 48653 AEV_1_3_RA2_01_1232.d 4.69E4 1 1 30 52 Methylation(KR)
K.LLPWLDGMLDADER.Y Y 38.28 1642.8025 14 2.5 822.4106 2 89.65 3 54527 AEV_3_3_RA3_01_1233.d 6.1E4 1 1 116 129
R.SIAPSYGIPVVLHTDHC(+57.02)AKK.L Y 36.18 2192.1411 20 11.9 439.4407 5 67.43 2 30961 AEV_1_3_RA2_01_1232.d 1.23E5 1 1 96 115 Carbamidomethylation
K.GVPN(+.98)GN(+.98)Q(+.98)EASVAGAIAAAHYIR.S Y 33.91 2168.0498 22 31.1 723.7130 3 76.64 2 37901 AEV_1_3_RA2_01_1232.d 2E4 1 1 74 95 Deamidation (NQ)
K.GVPNGNQEAS(+14.02)VAGAIAAAHYIR.S Y 31.20 2179.1133 22 3.3 727.3807 3 78.54 3 46925 AEV_3_3_RA3_01_1233.d 7.08E4 1 1 74 95 Methylation(others)
K.EAISYGVVK.I Y 31.10 964.5229 9 -91.1 483.2248 2 64.97 1 30145 AEV 2_3_RA2_01_1224.d 1.72E5 1 1 278 286
K.AE(+6.01)FKEAISYGVVK.I Y 29.08 1445.7742 13 -22.8 482.9210 3 65.97 3 37043 AEV_3_3_RA3_01_1233.d 0 1 1 274 286 Replacement of proton by lithium
K.GVPNGNQ(+.98)EASVAGAIAAAHYIR.S Y 28.86 2166.0818 22 7.4 723.0399 3 77.49 2 38566 AEV_1_3_RA2_01_1232.d 2.49E5 1 1 74 95 Deamidation (NQ)
K.T(+114.04)GSSK.N Y 27.04 592.2816 5 -35.9 593.2676 1 42.07 2 16501 AEV_1_3_RA2_01_1232.d 0 2 2 253 257 Ubiquitin
K.EKTGSSKNKPVY(+79.97)LVFHGGSGS(+162.05)TK.A Y 23.57 2649.2686 23 6.7 663.3289 4 77.92 3 46441 AEV_3_3_RA3_01_1233.d 0 1 1 251 273 Phosphorylation (STY); Hexose (NSY)
K.GVPNGNQEAS(+79.97)VAGAIAAAHYIR(+14.02).S Y 22.88 2259.0796 22 19.7 452.8321 5 45.10 2 17985 AEV_1_3_RA2_01_1232.d 0 1 1 74 95 Phosphorylation (STY); Methylation(KR)
R.V(+42.01)QEAFDDFNTSNQL Y 21.98 1668.7267 14 -6.9 835.3649 2 90.71 1 50130 AEV 2_3_RA2_01_1224.d 0 1 1 347 360 Acetylation (N-term)
K.EKT(+79.96)GSS(+79.97)K.N Y 21.80 895.2994 7 70.0 896.3694 1 92.24 1 51239 AEV 2_3_RA2_01_1224.d 0 1 1 251 257 Sulfation; Phosphorylation (STY)
R.LHPE(+14.02)LLSK.H Y 21.63 949.5596 8 -29.1 475.7733 2 54.90 2 22952 AEV_1_3_RA2_01_1232.d 0 1 1 237 244 Methylation(others)
R.LHPELLS(+79.97)K(+42.01).H Y 21.32 1057.5209 8 40.8 353.5286 3 45.35 3 22780 AEV_3_3_RA3_01_1233.d 0 1 1 237 244 Phosphorylation (STY); Acetylation (K)
R.AAPM(+15.99)K.Q Y 20.93 532.2679 5 -2.9 533.2736 1 63.61 2 28297 AEV_1_3_RA2_01_1232.d 0 1 1 165 169 Oxidation (M)
K.TMC(+57.02)AR.V Y 20.56 637.2676 5 72.1 638.3209 1 71.02 2 33608 AEV_1_3_RA2_01_1232.d 1.14E5 2 2 342 346 Carbamidomethylation
K.YFDPR.V N 20.08 696.3231 5 -10.3 697.3232 1 36.72 3 17409 AEV_3_3_RA3_01_1233.d 8.4E4 3 3 329 333
R.L(+119.04)HPELLSK.H Y 19.08 1054.5811 8 -0.8 352.5340 3 48.92 2 19905 AEV_1_3_RA2_01_1232.d 1.26E5 1 1 237 244 Pyridylacetyl
K.EAIS(-18.01)YGVVK(+42.01).I Y 19.05 988.5229 9 -11.9 495.2628 2 55.92 2 23493 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 278 286 Dehydration; Acetylation (K)
R.K(+42.01)(+43.99)TGVIVGDDVLR.L Y 18.79 1356.7249 12 -12.6 340.1842 4 29.08 2 10287 AEV_1_3_RA2_01_1232.d 5.99E4 1 1 10 21 Acetylation (Protein N-term); Carboxylation (DKW)
K.T(+27.99)GVIVGDDVLR.L Y 17.82 1170.6244 11 -10.4 391.2114 3 45.36 2 18113 AEV_1_3_RA2_01_1232.d 1.13E5 1 1 11 21 Formylation (Protein N-term)
K.TGSSK(+6.01).N Y 17.30 484.2469 5 20.2 485.2639 1 60.36 2 26115 AEV_1_3_RA2_01_1232.d 0 1 1 253 257 Replacement of proton by lithium
R.AAPMK(+27.99).Q Y 17.04 544.2679 5 6.5 545.2787 1 70.69 2 33366 AEV_1_3_RA2_01_1232.d 1.3E5 1 1 165 169 Formylation
K.GVPNGNQEAS(-2.02)VAGAIAAAHYIR.S Y 16.84 2163.0820 22 26.7 722.0539 3 77.27 3 45914 AEV_3_3_RA3_01_1233.d 0 1 1 74 95 2-amino-3-oxo-butanoic_acid
R.AAPM(+15.99)K(+28.03).Q Y 16.65 560.2992 5 -26.9 561.2914 1 20.74 3 8209 AEV_3_3_RA3_01_1233.d 0 1 1 165 169 Oxidation (M); Dimethylation(KR)
R.AAPMK(+21.98)(+42.01).Q Y 16.59 580.2655 5 -56.7 581.2399 1 83.37 1 44490 AEV 2_3_RA2_01_1224.d 0 1 1 165 169 Sodium adduct; Acetylation (K)
K.NKPVYLVFHGGS(+79.97)GSTK(+28.03).A Y 16.36 1797.8815 16 17.2 600.3114 3 80.89 2 41264 AEV_1_3_RA2_01_1232.d 8.33E4 1 1 258 273 Phosphorylation (STY); Dimethylation(KR)
R.YFK(+27.99)LHK.E Y 16.35 862.4701 6 24.0 863.4980 1 99.75 1 55604 AEV 2_3_RA2_01_1224.d 0 1 1 130 135 Formylation
K.TGSSK.N Y 16.32 478.2387 5 -161.8 479.1686 1 18.15 1 4301 AEV 2_3_RA2_01_1224.d 0 3 3 253 257
K.VFAIPAINVTSSSAVVAALEAARDK.N Y 16.17 2499.3696 25 4.6 834.1343 3 88.14 3 53669 AEV_3_3_RA3_01_1233.d 5.59E4 1 1 30 54
R.VQEAFDDFN(+.98)TSN(+203.08)QL Y 16.04 1830.7795 14 -27.9 611.2501 3 82.68 1 43932 AEV 2_3_RA2_01_1224.d 6.73E4 1 1 347 360 Deamidation (NQ); HexNAcylation (N)
K.DILS(+79.96)R.K Y 16.01 682.2956 5 43.1 683.3323 1 30.66 2 11001 AEV_1_3_RA2_01_1232.d 0 1 1 5 9 Sulfation
R.AAPMK.Q Y 15.77 516.2730 5 -192.3 517.1810 1 20.67 1 4963 AEV 2_3_RA2_01_1224.d 0 1 1 165 169
R.AAPMK(+31.99).Q Y 15.73 548.2628 5 23.8 549.2831 1 33.47 2 12340 AEV_1_3_RA2_01_1232.d 0 1 1 165 169 Dihydroxy
R.V(+43.01)QEAFDDFNTSNQL Y 15.69 1669.7219 14 -9.8 835.8600 2 89.50 1 49254 AEV 2_3_RA2_01_1224.d 1.78E5 1 1 347 360 Carbamylation
R.A(+43.01)APMK(+14.02).Q Y 15.67 573.2944 5 -141.2 574.2208 1 32.39 1 10290 AEV 2_3_RA2_01_1224.d 0 1 1 165 169 Carbamylation; Methylation(KR)
K.DILSRKTGVIVGDDVLR.L Y 15.34 1855.0526 17 -6.9 464.7672 4 63.84 2 28445 AEV_1_3_RA2_01_1232.d 0 1 1 5 21
K.KDYLMSAVGNPEGEDKPNK.K Y 15.21 2090.9941 19 -59.1 419.1814 5 65.91 1 30805 AEV 2_3_RA2_01_1224.d 0 1 1 309 327
K.DILSR(+21.98).K Y 15.03 624.3207 5 45.0 625.3561 1 21.72 2 7096 AEV_1_3_RA2_01_1232.d 0 1 1 5 9 Sodium adduct
total 55 peptides
C1FYX6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AADAVGEGPSQYGQSIETDTDGFQQAMK.A Y 143.63 2900.2771 28 1.7 967.7679 3 78.36 2 39319 AEV_1_3_RA2_01_1232.d 3.88E5 4 4 326 353
K.VIFLPAINQTVQDQLR.A Y 136.20 1854.0363 16 3.0 619.0212 3 84.66 2 44102 AEV_1_3_RA2_01_1232.d 1.11E6 7 7 310 325
R.LEDLQPSYAQVLR.H Y 99.05 1530.8042 13 18.2 511.2846 3 75.78 2 37214 AEV_1_3_RA2_01_1232.d 6.5E5 5 5 49 61
K.APTQSGPLSTDVGFRPSNNGIVK.V Y 96.32 2341.2026 23 -0.7 781.4076 3 70.77 3 40831 AEV_3_3_RA3_01_1233.d 7.22E5 5 5 21 43
K.APTQSGPLSTDVGFRPSNN(+.98)GIVK.V Y 88.58 2342.1865 23 -1.0 781.7354 3 72.99 2 35135 AEV_1_3_RA2_01_1232.d 4.71E5 2 2 21 43 Deamidation (NQ)
R.AADAVGEGPSQYGQSIETDTDGFQQAM(+15.99)K.A Y 86.70 2916.2720 28 1.9 973.0998 3 74.12 3 43443 AEV_3_3_RA3_01_1233.d 1.68E5 2 2 326 353 Oxidation (M)
K.VNPLSEHLTTVDVK.I Y 78.38 1550.8304 14 -4.9 776.4187 2 68.44 2 31685 AEV_1_3_RA2_01_1232.d 5.91E5 3 3 128 141
K.APTQSGPLSTDVGFRPSN(+.98)NGIVK.V Y 74.83 2342.1865 23 -0.5 781.7357 3 71.84 3 41673 AEV_3_3_RA3_01_1233.d 8.85E4 1 1 21 43 Deamidation (NQ)
M.S(+42.01)ASTNLLDTPSTSTATN(+.98)GK.A Y 71.22 1907.8960 19 -1.6 954.9537 2 73.41 3 42908 AEV_3_3_RA3_01_1233.d 7.9E5 5 5 2 20 Acetylation (Protein N-term); Deamidation (NQ)
R.TAANILSSAPAMQIR.Y Y 71.05 1542.8188 15 1.1 772.4175 2 76.26 3 45112 AEV_3_3_RA3_01_1233.d 2.45E5 2 2 280 294
R.YLETM(+15.99)QAM(+15.99)AK.T Y 68.02 1216.5468 10 24.1 609.2953 2 29.30 3 12978 AEV_3_3_RA3_01_1233.d 5.81E4 2 2 295 304 Oxidation (M)
K.VQPARLEDLQPSYAQVLR.H Y 67.20 2082.1221 18 3.7 695.0505 3 76.33 2 37655 AEV_1_3_RA2_01_1232.d 5.57E5 3 3 44 61
K.VIFLPAINQ(+.98)TVQDQLR.A Y 65.14 1855.0203 16 -4.4 619.3447 3 85.22 3 51847 AEV_3_3_RA3_01_1233.d 1.27E5 2 2 310 325 Deamidation (NQ)
K.VIFLPAINQTVQDQLR(+14.02).A Y 63.28 1868.0520 16 6.5 623.6953 3 85.98 2 44967 AEV_1_3_RA2_01_1232.d 5.08E4 1 1 310 325 Methylation(KR)
K.DNVTLNLTSVIYYHITSPHK.A Y 60.73 2314.1958 20 -4.9 772.4021 3 83.23 3 50482 AEV_3_3_RA3_01_1233.d 4.58E5 3 3 156 175
K.VQPAR(+14.02)LEDLQPSYAQVLR.H Y 59.56 2096.1377 18 1.6 699.7209 3 77.70 2 38728 AEV_1_3_RA2_01_1232.d 3.57E4 1 1 44 61 Methylation(KR)
M.S(+42.01)ASTNLLDTPSTSTATNGK.A Y 58.96 1906.9120 19 -0.9 954.4624 2 71.76 3 41609 AEV_3_3_RA3_01_1233.d 4E5 2 2 2 20 Acetylation (Protein N-term)
K.AAFGITNIR.Q Y 57.86 961.5345 9 -1.1 481.7740 2 67.34 3 38139 AEV_3_3_RA3_01_1233.d 8.96E5 5 5 176 184
R.AADAVGEGPSQYGQ(+.98)SIETDTDGFQQAMK.A Y 54.24 2901.2610 28 5.8 968.0999 3 78.83 2 39627 AEV_1_3_RA2_01_1232.d 9.7E4 1 1 326 353 Deamidation (NQ)
M.S(+42.01)ASTNLLDTPSTSTATN(+.98)GKAPTQSGPLSTDVGFRPSNNGIVK.V Y 53.46 4231.0879 42 1.4 1058.7808 4 80.02 2 40575 AEV_1_3_RA2_01_1232.d 2.95E5 1 1 2 43 Acetylation (Protein N-term); Deamidation (NQ)
K.IQIVEVPR.Q Y 53.04 952.5706 8 -16.8 477.2845 2 66.99 2 30643 AEV_1_3_RA2_01_1232.d 1.58E5 3 3 142 149
K.AHIVEDI Y 50.70 795.4127 7 -85.9 398.6794 2 66.90 1 31586 AEV 2_3_RA2_01_1224.d 1.32E6 5 5 354 360
R.LE(+14.02)DLQPSYAQVLR.H Y 47.16 1544.8198 13 -0.6 773.4167 2 77.99 2 38962 AEV_1_3_RA2_01_1232.d 6.17E4 1 1 49 61 Methylation(others)
R.AVDPGLVK.V Y 46.86 797.4647 8 -0.6 399.7394 2 41.78 3 20519 AEV_3_3_RA3_01_1233.d 1.76E6 7 7 120 127
R.AADAVGE(+14.02)GPSQYGQSIETDTDGFQQAMK.A Y 40.20 2914.2927 28 13.7 972.4515 3 79.27 2 39978 AEV_1_3_RA2_01_1232.d 4.85E4 1 1 326 353 Methylation(others)
R.TAANILSSAPAM(+15.99)QIR.Y Y 36.61 1558.8137 15 -12.5 780.4044 2 69.12 2 32193 AEV_1_3_RA2_01_1232.d 4.2E4 3 3 280 294 Oxidation (M)
R.LEDLQPSYAQ(+.98)VLR.H Y 35.53 1531.7882 13 -9.0 766.8945 2 76.51 3 45309 AEV_3_3_RA3_01_1233.d 1.56E5 2 2 49 61 Deamidation (NQ)
R.LEDLQPSYAQVLR(+14.02).H Y 34.22 1544.8198 13 -4.7 773.4136 2 77.62 3 46198 AEV_3_3_RA3_01_1233.d 4.84E4 1 1 49 61 Methylation(KR)
R.TAAN(+.98)ILSSAPAMQ(+.98)IR(+14.02).Y Y 31.19 1558.8025 15 -1.3 520.6074 3 46.88 3 23739 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 280 294 Deamidation (NQ); Methylation(KR)
R.T(+79.96)AANILSSAPAMQIR.Y Y 30.93 1622.7756 15 48.1 406.7207 4 37.20 2 14122 AEV_1_3_RA2_01_1232.d 0 1 1 280 294 Sulfation
R.AEVESAKLM(+15.99)R.T Y 30.51 1148.5859 10 -8.8 575.2952 2 25.74 3 11056 AEV_3_3_RA3_01_1233.d 1.97E4 1 1 270 279 Oxidation (M)
R.VLQDVIER.R Y 28.11 970.5447 8 -28.3 486.2659 2 59.79 3 32263 AEV_3_3_RA3_01_1233.d 1.07E5 2 2 203 210
R.IGESKVIAAR.A Y 27.75 1042.6134 10 3.1 348.5461 3 32.33 3 14768 AEV_3_3_RA3_01_1233.d 5.07E4 1 1 260 269
K.AHIVEDI(-.98) Y 27.43 794.4286 7 -55.1 398.1997 2 56.32 2 23725 AEV_1_3_RA2_01_1232.d 0 1 1 354 360 Amidation
K.IQIVEVPR(+14.02).Q Y 26.78 966.5862 8 -45.0 484.2786 2 68.84 3 39328 AEV_3_3_RA3_01_1233.d 0 1 1 142 149 Methylation(KR)
K.VIFLPAIN(+.98)QTVQDQLR.A Y 26.37 1855.0203 16 0.3 619.3475 3 86.00 2 44977 AEV_1_3_RA2_01_1232.d 1.32E5 2 2 310 325 Deamidation (NQ)
K.VQPARLEDLQ(+.98)PSYAQVLR.H Y 25.43 2083.1062 18 2.0 695.3774 3 76.67 3 45433 AEV_3_3_RA3_01_1233.d 6.65E4 1 1 44 61 Deamidation (NQ)
K.VIFLPAINQTVQ(+.98)DQLR.A Y 24.69 1855.0203 16 -27.4 928.4920 2 85.97 3 52353 AEV_3_3_RA3_01_1233.d 0 1 1 310 325 Deamidation (NQ)
K.APTQSGPLSTDVGFRPSN(+.98)N(+.98)GIVK.V Y 24.26 2343.1707 23 6.5 782.0692 3 74.02 2 35889 AEV_1_3_RA2_01_1232.d 6.75E4 1 1 21 43 Deamidation (NQ)
K.VQPAR.L Y 23.77 569.3285 5 3.7 570.3379 1 91.80 2 48081 AEV_1_3_RA2_01_1232.d 4.39E5 3 3 44 48
MS(-18.01)ASTNLLDTPSTSTATNGK(+42.01).A Y 22.49 2019.9419 20 -67.3 674.2759 3 95.01 1 53149 AEV 2_3_RA2_01_1224.d 7E3 1 1 1 20 Dehydration; Acetylation (K)
K.A(+43.01)AFGITNIR.Q Y 22.05 1004.5403 9 -68.4 503.2430 2 83.82 1 44854 AEV 2_3_RA2_01_1224.d 1.12E4 1 1 176 184 Carbamylation
K.T(-18.01)ANSK.V Y 21.96 501.2547 5 4.2 502.2641 1 25.31 2 8644 AEV_1_3_RA2_01_1232.d 4.04E4 1 1 305 309 Dehydration
R.IGES(+79.96)K.V N 21.77 612.2425 5 10.5 613.2562 1 30.15 2 10770 AEV_1_3_RA2_01_1232.d 0 1 1 260 264 Sulfation
R.IGESK(+43.99).V N 21.63 576.2755 5 -5.4 577.2797 1 18.12 3 6822 AEV_3_3_RA3_01_1233.d 1.77E4 1 1 260 264 Carboxylation (DKW)
K.AHIVED(+14.02)I Y 21.52 809.4283 7 6.7 405.7241 2 64.38 2 28838 AEV_1_3_RA2_01_1232.d 9.07E4 1 1 354 360 Methylation(others)
R.T(+42.01)AANILSSAPAM(+31.99)QIR.Y Y 20.78 1616.8192 15 0.9 405.2124 4 19.74 3 7696 AEV_3_3_RA3_01_1233.d 0 1 1 280 294 Acetylation (N-term); Sulphone
R.IGESK.V N 20.40 532.2856 5 -17.6 533.2836 1 20.95 2 6798 AEV_1_3_RA2_01_1232.d 0 1 1 260 264
R.TAAN(+.98)ILSS(+79.97)APAMQIR.Y Y 20.27 1623.7692 15 50.3 542.2909 3 67.65 3 38377 AEV_3_3_RA3_01_1233.d 0 1 1 280 294 Deamidation (NQ); Phosphorylation (STY)
M(+15.99)S(+79.97)ASTNLLDTPSTSTATNGK.A Y 20.07 2091.9031 20 43.3 698.3385 3 68.66 3 39185 AEV_3_3_RA3_01_1233.d 4.25E4 1 1 1 20 Oxidation (M); Phosphorylation (STY)
R.TAANILS(+14.02)SAPAMQIR.Y Y 19.08 1556.8345 15 -2.6 390.2149 4 35.99 3 16926 AEV_3_3_RA3_01_1233.d 0 1 1 280 294 Methylation(others)
K.TANS(-18.01)K.V Y 18.88 501.2547 5 -92.9 502.2154 1 65.51 1 30502 AEV 2_3_RA2_01_1224.d 1.8E5 1 1 305 309 Dehydration
K.APTQSGPLSTDVGFRPS(+79.97)NNGIVK.V Y 18.61 2421.1689 23 -0.3 606.2993 4 74.69 3 43948 AEV_3_3_RA3_01_1233.d 9.41E4 1 1 21 43 Phosphorylation (STY)
R.Q(+.98)ALVER.T Y 18.28 715.3864 6 -124.6 716.3046 1 86.79 1 47184 AEV 2_3_RA2_01_1224.d 9.52E4 1 1 185 190 Deamidation (NQ)
K.LMRTAANILSSAPAMQIR.Y Y 18.04 1943.0444 18 -42.0 648.6616 3 70.47 2 33201 AEV_1_3_RA2_01_1232.d 0 1 1 277 294
K.TANSK.V Y 17.98 519.2653 5 -74.9 520.2336 1 67.26 1 31845 AEV 2_3_RA2_01_1224.d 0 1 1 305 309
K.LMRTAANILS(+79.97)SAPAM(+15.99)QIR.Y Y 17.93 2039.0057 18 17.9 510.7678 4 58.28 3 31151 AEV_3_3_RA3_01_1233.d 7.89E4 1 1 277 294 Phosphorylation (STY); Oxidation (M)
R.QALVERTQT(-18.01)TLR.H Y 17.66 1396.7787 12 43.9 350.2173 4 44.55 2 17719 AEV_1_3_RA2_01_1232.d 0 1 1 185 196 Dehydration
R.TAANILSSAP(-27.99)AMQIR.Y Y 17.57 1514.8239 15 -12.7 505.9422 3 35.25 2 13188 AEV_1_3_RA2_01_1232.d 3.68E4 1 1 280 294 Pyrrolidone from Proline
K.AHIVED(-18.01)I Y 17.53 777.4021 7 -92.1 778.3378 1 93.06 1 51799 AEV 2_3_RA2_01_1224.d 0 1 1 354 360 Dehydration
K.LMRTAANILS(+79.97)SAPAMQIR(+14.02).Y Y 17.48 2037.0265 18 27.0 510.2776 4 74.00 3 43352 AEV_3_3_RA3_01_1233.d 0 1 1 277 294 Phosphorylation (STY); Methylation(KR)
K.T(+43.01)ANSK.V Y 17.38 562.2711 5 10.8 563.2844 1 32.47 3 14843 AEV_3_3_RA3_01_1233.d 0 1 1 305 309 Carbamylation
R.T(+42.01)(-18.01)AANILSSAPAMQIR.Y Y 17.31 1566.8188 15 -76.8 392.6819 4 58.70 1 25567 AEV 2_3_RA2_01_1224.d 2.76E5 1 1 280 294 Acetylation (N-term); Dehydration
R.TAANILSSAPAM(+15.99)QIR(+14.02).Y Y 16.94 1572.8293 15 -14.7 394.2088 4 16.70 3 6043 AEV_3_3_RA3_01_1233.d 0 1 1 280 294 Oxidation (M); Methylation(KR)
K.VQ(+.98)PAR(+21.98).L Y 16.77 592.2945 5 -104.1 593.2401 1 78.89 1 40956 AEV 2_3_RA2_01_1224.d 0 1 1 44 48 Deamidation (NQ); Sodium adduct
R.FGRFER.A Y 16.70 810.4136 6 1.0 406.2145 2 29.70 3 13211 AEV_3_3_RA3_01_1233.d 9.88E5 2 2 114 119
R.Q(+27.99)ALVER.T Y 16.65 742.3973 6 -129.0 743.3088 1 85.27 1 46002 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 185 190 Formylation
R.TQTTLR(+144.04).H Y 16.60 862.4396 6 5.6 432.2295 2 43.39 2 17153 AEV_1_3_RA2_01_1232.d 0 1 1 191 196 Condensation product of 3-deoxyglucosone
K.LM(+15.99)RTAANILSSAPAM(+15.99)QIR.Y Y 16.49 1975.0343 18 34.0 494.7827 4 77.20 2 38339 AEV_1_3_RA2_01_1232.d 5.59E4 1 1 277 294 Oxidation (M)
R.AVDP(+31.99)GLVK.V Y 16.16 829.4545 8 2.3 415.7354 2 12.33 3 3666 AEV_3_3_RA3_01_1233.d 2.16E4 1 1 120 127 Dihydroxy
R.I(+226.08)GESK.V N 16.13 758.3632 5 2.4 759.3723 1 112.50 2 54443 AEV_1_3_RA2_01_1232.d 1.68E4 1 1 260 264 Biotinylation
K.T(+42.01)ANS(-18.01)K.V Y 16.07 543.2653 5 9.9 544.2779 1 45.24 3 22712 AEV_3_3_RA3_01_1233.d 3.9E4 1 1 305 309 Acetylation (N-term); Dehydration
K.VQ(+.98)PAR.L Y 15.88 570.3126 5 -83.6 571.2722 1 50.77 1 20640 AEV 2_3_RA2_01_1224.d 0 1 1 44 48 Deamidation (NQ)
K.TANSKVIFLPAINQTVQD(-18.01)QLR.A Y 15.70 2337.2805 21 -20.3 585.3156 4 78.95 2 39724 AEV_1_3_RA2_01_1232.d 0 1 1 305 325 Dehydration
K.L(+42.01)MRTAAN(+162.05)ILSSAPAMQIR.Y Y 15.69 2147.1079 18 11.7 537.7905 4 67.61 3 38342 AEV_3_3_RA3_01_1233.d 0 1 1 277 294 Acetylation (N-term); Hexose (NSY)
K.D(+42.01)IIFSNELQESLS(+79.97)MAAQS(+79.97)KR.I Y 15.58 2468.0696 20 -18.4 618.0133 4 96.38 1 54018 AEV 2_3_RA2_01_1224.d 0 1 1 240 259 Acetylation (N-term); Phosphorylation (STY)
R.QALVER(-.98).T Y 15.53 713.4184 6 -14.6 357.7113 2 9.70 3 2424 AEV_3_3_RA3_01_1233.d 2.03E3 1 1 185 190 Amidation
K.V(+42.01)QPAR.L Y 15.39 611.3391 5 -38.1 612.3231 1 81.94 3 49549 AEV_3_3_RA3_01_1233.d 1.84E5 1 1 44 48 Acetylation (N-term)
total 78 peptides
C1GMI6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
M.AGPDQDSSADAAAGNLANLHLDEVTGER.V Y 143.70 2793.2800 28 -4.4 932.0966 3 77.36 2 38454 AEV_1_3_RA2_01_1232.d 4.11E5 2 2 2 29
K.ASAEEEESNLTPNQYFEIR.S Y 113.59 2226.0076 19 0.4 1114.0115 2 78.05 2 39013 AEV_1_3_RA2_01_1232.d 2.39E5 3 3 63 81
K.KASAEEEESNLTPNQYFEIR.S Y 112.38 2354.1025 20 0.5 785.7085 3 73.63 2 35600 AEV_1_3_RA2_01_1232.d 3.24E5 2 2 62 81
R.RGDIIGVVGWPGR.T Y 93.56 1380.7626 13 -1.6 461.2607 3 75.43 3 44462 AEV_3_3_RA3_01_1233.d 2.92E5 3 3 180 192
K.VNVQC(+57.02)SPPETNAR.M Y 80.81 1470.6885 13 0.6 736.3520 2 42.03 3 20674 AEV_3_3_RA3_01_1233.d 8.67E5 8 8 435 447 Carbamidomethylation
K.MLIVGGLER.V Y 66.31 986.5583 9 1.2 494.2870 2 72.56 2 34779 AEV_1_3_RA2_01_1232.d 2.31E5 3 3 313 321
R.SPNPYPHK.F Y 65.10 938.4610 8 2.1 470.2388 2 15.95 3 5634 AEV_3_3_RA3_01_1233.d 3.22E5 4 4 93 100
R.SPNPYPHKFQVTDDAR.E Y 59.79 1870.8961 16 -2.5 624.6378 3 55.41 3 29190 AEV_3_3_RA3_01_1233.d 1.8E5 3 3 93 108
K.AAVAPPKAEK.K Y 58.78 980.5654 10 -6.4 491.2869 2 18.91 2 5952 AEV_1_3_RA2_01_1232.d 3.21E5 4 4 52 61
K.NRADGELSIFAK.E Y 56.35 1319.6833 12 -93.2 440.8607 3 75.40 1 38192 AEV 2_3_RA2_01_1224.d 2.61E5 1 1 197 208
R.VAPELYLK.M Y 48.02 931.5378 8 -5.3 466.7737 2 65.86 2 29846 AEV_1_3_RA2_01_1232.d 2.27E5 2 2 305 312
K.FQVTDDAREIIK.K Y 47.46 1433.7513 12 9.1 478.9287 3 69.06 3 39538 AEV_3_3_RA3_01_1233.d 1.21E5 1 1 101 112
R.FEEQASQK.A Y 45.39 965.4454 8 -84.9 483.6890 2 22.72 1 5633 AEV 2_3_RA2_01_1224.d 4.61E4 1 1 517 524
K.K(+14.02)ASAEEEESNLTPNQYFEIR.S Y 44.92 2368.1182 20 2.7 790.3821 3 75.26 3 44330 AEV_3_3_RA3_01_1233.d 3.52E4 1 1 62 81 Methylation(KR)
K.FQVTDDAR.E Y 39.77 950.4457 8 -87.6 476.1885 2 52.41 1 21602 AEV 2_3_RA2_01_1224.d 2.92E5 6 6 101 108
K.VNVQC(+57.02)SPPETN(+.98)AR.M Y 38.93 1471.6725 13 6.5 736.8483 2 44.64 3 22323 AEV_3_3_RA3_01_1233.d 4.77E4 1 1 435 447 Carbamidomethylation; Deamidation (NQ)
K.KASAEEEESNLTPNQYFEIR(+14.02).S Y 38.93 2368.1182 20 6.2 790.3849 3 74.17 3 43483 AEV_3_3_RA3_01_1233.d 2.81E5 2 2 62 81 Methylation(KR)
K.LIFYDVR.A Y 35.76 924.5068 7 -89.0 463.2195 2 80.07 1 41899 AEV 2_3_RA2_01_1224.d 2.1E5 1 1 144 150
R.NNVGLC(+57.02)ER.F Y 35.56 960.4447 8 -62.4 481.1996 2 39.57 1 14161 AEV 2_3_RA2_01_1224.d 0 1 1 483 490 Carbamidomethylation
M.AGPDQDSSADAAAGNLANLHLDEVTGERVSK.S Y 35.50 3107.4756 31 3.8 777.8791 4 75.35 2 36882 AEV_1_3_RA2_01_1232.d 1.56E5 1 1 2 32
K.M(+15.99)LIVGGLER.V Y 32.92 1002.5532 9 10.4 502.2891 2 66.73 2 30462 AEV_1_3_RA2_01_1232.d 1.12E5 2 2 313 321 Oxidation (M)
K.S(+42.01)AAAK(+14.02).E N 31.61 502.2751 5 -13.8 503.2755 1 19.03 2 6006 AEV_1_3_RA2_01_1232.d 0 2 2 583 587 Acetylation (N-term); Methylation(KR)
K.RIE(+197.05)MIPALEEATGEK.F Y 30.66 1882.9111 15 -24.8 628.6288 3 92.51 1 51415 AEV 2_3_RA2_01_1224.d 6.53E4 1 1 398 412 Glycerylphosphorylethanolamine
K.AAVAPPKAEKK.A Y 30.39 1108.6604 11 4.1 555.3397 2 13.32 2 3712 AEV_1_3_RA2_01_1232.d 4.68E4 2 2 52 62
K.EIVNAYTELNDPFDQR.L Y 29.74 1922.9010 16 -72.4 641.9279 3 84.02 1 45008 AEV 2_3_RA2_01_1224.d 1.96E5 2 2 499 514
R.G(+42.01)DIIGVVGWPGR(+14.02).T Y 27.12 1280.6877 12 -18.3 427.8954 3 41.41 3 20273 AEV_3_3_RA3_01_1233.d 2.25E5 1 1 181 192 Acetylation (N-term); Methylation(KR)
K.S(+79.97)AAAK(+42.01).E N 26.11 568.2258 5 -35.3 569.2130 1 113.06 1 59642 AEV 2_3_RA2_01_1224.d 2.38E6 1 1 583 587 Phosphorylation (STY); Acetylation (K)
R.IEMIPALEEATGEK.F Y 25.42 1529.7646 14 -64.7 510.8958 3 66.61 1 31330 AEV 2_3_RA2_01_1224.d 3.31E4 1 1 399 412
R.SPNPYPH(+15.99)K(+14.02)FQVTDDAR.E Y 25.10 1900.9067 16 26.2 476.2464 4 39.99 3 19429 AEV_3_3_RA3_01_1233.d 0 2 2 93 108 Oxidation (HW); Methylation(KR)
R.SAGAK(+42.01).L Y 24.87 474.2438 5 -11.9 475.2454 1 57.82 3 30821 AEV_3_3_RA3_01_1233.d 2.14E4 1 1 139 143 Acetylation (K)
R.VYELGR.Q Y 24.63 735.3915 6 -88.1 368.6706 2 51.27 1 20919 AEV 2_3_RA2_01_1224.d 4.37E5 3 3 322 327
R.NVFITR.S Y 23.90 748.4232 6 -0.6 375.2186 2 47.12 3 23882 AEV_3_3_RA3_01_1233.d 4.84E5 3 3 249 254
R.S(-18.01)AGAK.L Y 23.78 414.2227 5 -38.7 415.2139 1 65.36 1 30436 AEV 2_3_RA2_01_1224.d 9.4E5 1 1 139 143 Dehydration
K.SRNVFITRSK.M Y 23.76 1206.6832 10 -33.0 604.3290 2 26.77 3 11566 AEV_3_3_RA3_01_1233.d 0 2 2 247 256
K.AAVAPPK.A Y 23.68 652.3907 7 8.7 653.4037 1 100.28 2 51090 AEV_1_3_RA2_01_1232.d 0 1 1 52 58
K.EK(+170.04)AAVAPPKAEKK.A Y 23.33 1535.8347 13 -11.4 308.1707 5 12.88 3 3977 AEV_3_3_RA3_01_1233.d 2.17E5 1 1 50 62 Menadione quinone derivative
R.YLDLIMND(+43.99)K.S Y 23.30 1167.5481 9 -7.8 584.7768 2 60.45 3 32752 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 238 246 Carboxylation (DKW)
K.EDKSAAAK(+21.98).E Y 22.37 840.3953 8 21.5 421.2140 2 49.74 3 25567 AEV_3_3_RA3_01_1233.d 0 1 1 580 587 Sodium adduct
R.S(+79.97)PN(+.98)PYPHK.F Y 22.27 1019.4113 8 -28.7 340.8013 3 29.16 1 8532 AEV 2_3_RA2_01_1224.d 2.16E5 1 1 93 100 Phosphorylation (STY); Deamidation (NQ)
K.SAAAK(+42.01).E N 22.25 488.2594 5 -15.2 489.2593 1 21.81 2 7136 AEV_1_3_RA2_01_1232.d 4.6E4 1 1 583 587 Acetylation (K)
K.SAAAK.E N 22.10 446.2489 5 -29.6 447.2429 1 48.43 2 19664 AEV_1_3_RA2_01_1232.d 5.96E5 2 2 583 587
K.M(+42.01)LIVGGLER.V Y 22.07 1028.5688 9 36.7 343.8761 3 42.42 3 20905 AEV_3_3_RA3_01_1233.d 0 1 1 313 321 Acetylation (N-term)
K.RIE(+43.99)MIPALEEATGEK.F Y 21.59 1729.8556 15 -69.3 433.4412 4 29.63 1 8781 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 398 412 Carboxylation (E)
K.KASAEEEES(+14.02)NLTPNQYFEIR.S Y 21.24 2368.1182 20 8.8 790.3870 3 76.45 2 37749 AEV_1_3_RA2_01_1232.d 1.33E5 1 1 62 81 Methylation(others)
K.KASAEEEESNLTPNQYFEIR(-.98).S Y 20.88 2353.1187 20 -3.0 785.3778 3 73.56 2 35548 AEV_1_3_RA2_01_1232.d 1.07E4 1 1 62 81 Amidation
K.GDQ(+.98)IKEKEVR(+14.02).I Y 20.00 1215.6459 10 25.6 304.9265 4 10.41 3 2736 AEV_3_3_RA3_01_1233.d 1.98E4 1 1 120 129 Deamidation (NQ); Methylation(KR)
K.EDK(+14.02)SAAAKEEK.L Y 19.98 1218.6091 11 -35.5 610.2902 2 56.38 2 23751 AEV_1_3_RA2_01_1232.d 5.24E4 1 1 580 590 Methylation(KR)
R.IAGRIYTK.R Y 19.78 920.5443 8 -10.3 307.8522 3 46.96 3 23784 AEV_3_3_RA3_01_1233.d 2.65E5 1 1 130 137
K.LIFYD(+21.98)VR(+14.02)AEGVK.I Y 19.62 1444.7690 12 15.2 362.2050 4 46.75 2 18803 AEV_1_3_RA2_01_1232.d 0 1 1 144 155 Sodium adduct; Methylation(KR)
K.EVLAFPFMK(+21.98)(+14.02).E Y 19.45 1116.5653 9 -27.9 559.2744 2 58.43 2 24899 AEV_1_3_RA2_01_1232.d 4.43E4 1 1 571 579 Sodium adduct; Methylation(KR)
R.L(+43.01)RFEEQ(+.98)ASQK.A Y 19.31 1278.6204 10 -49.5 320.6465 4 67.20 1 31794 AEV 2_3_RA2_01_1224.d 0 1 1 515 524 Carbamylation; Deamidation (NQ)
K.EIVNAYTELN(+.98)DPFDQ(+.98)R.L Y 19.19 1924.8690 16 -71.4 385.9536 5 72.45 1 35867 AEV 2_3_RA2_01_1224.d 0 1 1 499 514 Deamidation (NQ)
K.IQ(+.98)VAC(+57.02)QSQNAEGDVSFEAQHEHLR(+28.03).R Y 19.17 2781.2776 24 21.3 696.3415 4 72.15 3 41916 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 156 179 Deamidation (NQ); Carbamidomethylation; Dimethylation(KR)
R.A(+42.01)EGVK(+21.98).I N 18.87 566.2676 5 -110.2 567.2125 1 36.28 1 12327 AEV 2_3_RA2_01_1224.d 7.13E4 1 1 151 155 Acetylation (N-term); Sodium adduct
K.S(+27.99)(+79.97)AAAK.E N 18.62 554.2101 5 -102.3 555.1606 1 12.63 1 2985 AEV 2_3_RA2_01_1224.d 0 1 1 583 587 Formylation; Phosphorylation (STY)
K.V(+42.01)NVQC(+57.02)SPPET(+79.97)N(+.98)AR.M Y 18.30 1593.6494 13 -3.7 532.2218 3 36.65 1 12526 AEV 2_3_RA2_01_1224.d 8.41E5 1 1 435 447 Acetylation (N-term); Carbamidomethylation; Phosphorylation (STY); Deamidation (NQ)
K.YESLQKGDQIK.E Y 18.07 1307.6721 11 -2.9 436.8967 3 33.36 3 15357 AEV_3_3_RA3_01_1233.d 8.73E3 1 1 114 124
R.SKM(+15.99)ITYIRRFFDER.D Y 17.77 1876.9618 14 -7.0 470.2444 4 64.81 3 36145 AEV_3_3_RA3_01_1233.d 1.91E5 1 1 255 268 Oxidation (M)
K.YHRNNVGLC(+57.02)ER.F Y 17.68 1416.6681 11 70.3 473.2632 3 52.43 3 27332 AEV_3_3_RA3_01_1233.d 1.41E5 1 1 480 490 Carbamidomethylation
K.T(+27.99)HSPPPPPGAVPSIFFWIFLYSR.R Y 17.50 2640.3528 23 18.9 529.0878 5 83.32 3 50542 AEV_3_3_RA3_01_1233.d 0 1 1 613 635 Formylation
K.VNVQC(+57.02)SPPET(+79.97)NARMLDK.L Y 17.43 2037.9012 17 25.0 680.3247 3 98.42 3 58523 AEV_3_3_RA3_01_1233.d 6.02E3 1 1 435 451 Carbamidomethylation; Phosphorylation (STY)
R.SAGAK(+42.01)LIFYDVR.A Y 17.37 1380.7401 12 24.8 461.2654 3 73.93 2 35830 AEV_1_3_RA2_01_1232.d 0 1 1 139 150 Acetylation (K)
K.VNVQC(+57.02)SPPETNARMLDK.L Y 17.17 1957.9349 17 37.6 980.0116 2 83.90 2 43549 AEV_1_3_RA2_01_1232.d 1.94E5 1 1 435 451 Carbamidomethylation
R.T(+42.01)APKNRADGELSIFAK(+226.08).E Y 17.01 1985.0040 16 -0.8 497.2579 4 48.84 3 24979 AEV_3_3_RA3_01_1233.d 0 1 1 193 208 Acetylation (N-term); Biotinylation
K.FQ(+.98)VTDDAR(-.98).E Y 17.00 950.4457 8 4.6 476.2323 2 16.24 3 5795 AEV_3_3_RA3_01_1233.d 4.87E4 1 1 101 108 Deamidation (NQ); Amidation
K.LIFYDVRAEGVK.I Y 16.99 1408.7714 12 15.0 353.2054 4 65.87 2 29856 AEV_1_3_RA2_01_1232.d 9.47E4 1 1 144 155
K.MITYIR.R Y 16.86 795.4313 6 -154.9 796.3153 1 85.61 1 46274 AEV 2_3_RA2_01_1224.d 7.58E4 1 1 257 262
K.SAAAK(+21.98).E N 16.85 468.2308 5 -132.1 469.1762 1 21.19 1 5113 AEV 2_3_RA2_01_1224.d 0 1 1 583 587 Sodium adduct
K.S(-18.01)AAAK(+42.01).E N 16.83 470.2489 5 -2.4 471.2550 1 14.83 3 5035 AEV_3_3_RA3_01_1233.d 0 1 1 583 587 Dehydration; Acetylation (K)
K.SAAAK(-.98).E N 16.81 445.2649 5 -206.5 446.1802 1 26.13 1 7046 AEV 2_3_RA2_01_1224.d 8.69E4 1 1 583 587 Amidation
R.YRQRYLDLIMNDK(-.98).S Y 16.68 1725.8984 13 -7.2 576.3026 3 69.14 2 32207 AEV_1_3_RA2_01_1232.d 2.43E5 1 1 234 246 Amidation
R.S(+162.05)AGAK.L Y 16.64 594.2860 5 24.0 595.3076 1 29.57 2 10515 AEV_1_3_RA2_01_1232.d 0 1 1 139 143 Hexose (NSY)
K.E(+226.08)K(+14.02)AAVAPPK.A Y 16.63 1149.6216 9 -11.5 384.2101 3 53.18 2 22078 AEV_1_3_RA2_01_1232.d 7.69E4 1 1 50 58 Biotinylation; Methylation(KR)
R.Y(+27.99)LDLIMNDK(+42.01).S Y 16.62 1193.5638 9 -72.7 398.8330 3 63.80 1 29397 AEV 2_3_RA2_01_1224.d 6E4 1 1 238 246 Formylation; Acetylation (K)
K.EDKSAAAK(+42.01).E Y 16.60 860.4240 8 36.0 431.2347 2 40.09 3 19460 AEV_3_3_RA3_01_1233.d 4.28E5 1 1 580 587 Acetylation (K)
R.L(+42.01)VMFLTDNYSIK.E Y 16.12 1484.7585 12 37.7 495.9454 3 69.00 2 32093 AEV_1_3_RA2_01_1232.d 4.53E3 1 1 559 570 Acetylation (N-term)
R.R(+42.01)GDIIGVVGW(+31.99)PGR.T Y 15.66 1454.7629 13 -22.4 728.3724 2 81.27 2 41568 AEV_1_3_RA2_01_1232.d 8.45E4 1 1 180 192 Acetylation (N-term); Dihydroxy
K.EVLAFPFM(+15.99)K.E Y 15.43 1096.5626 9 -40.2 549.2665 2 19.32 3 7473 AEV_3_3_RA3_01_1233.d 2.43E4 1 1 571 579 Oxidation (M)
R.LVM(+15.99)FLTDNYS(-18.01)IK.E Y 15.41 1440.7323 12 -1.3 361.1899 4 47.48 2 19186 AEV_1_3_RA2_01_1232.d 1.15E5 1 1 559 570 Oxidation (M); Dehydration
R.LRFEEQASQK.A Y 15.37 1234.6306 10 5.1 618.3257 2 35.33 2 13228 AEV_1_3_RA2_01_1232.d 6.3E4 1 1 515 524
R.SAGAK(+27.99).L Y 15.20 460.2281 5 49.0 461.2580 1 71.64 2 34078 AEV_1_3_RA2_01_1232.d 0 1 1 139 143 Formylation
R.SAGAK.L Y 15.15 432.2332 5 34.7 433.2555 1 38.92 3 18763 AEV_3_3_RA3_01_1233.d 7.32E4 1 1 139 143
R.LRFEEQAS(-18.01)QK.A Y 15.11 1216.6200 10 20.7 305.1686 4 28.63 3 12602 AEV_3_3_RA3_01_1233.d 1.35E6 1 1 515 524 Dehydration
K.S(+27.99)AAAK.E N 15.01 474.2438 5 -118.1 475.1950 1 29.22 1 8568 AEV 2_3_RA2_01_1224.d 8.64E4 1 1 583 587 Formylation
total 84 peptides
C1G411
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.ILSGEEDSLGDISTLSDPSVVAK.I Y 113.62 2331.1692 23 1.8 1166.5940 2 81.47 2 41711 AEV_1_3_RA2_01_1232.d 2.41E5 3 3 626 648
K.LALIYEADDPGEGR.N Y 101.74 1517.7361 14 6.5 759.8802 2 73.65 2 35619 AEV_1_3_RA2_01_1232.d 4.44E5 3 3 103 116
K.LYEESIRDPDTFWSR.L Y 98.00 1912.8955 15 -5.7 638.6355 3 76.55 2 37828 AEV_1_3_RA2_01_1232.d 2E5 2 2 38 52
R.LNASYNC(+57.02)VDR.H Y 94.06 1210.5400 10 3.7 606.2795 2 44.14 3 22073 AEV_3_3_RA3_01_1233.d 1.41E6 8 8 85 94 Carbamidomethylation
R.KILSGEEDSLGDISTLSDPSVVAK.I Y 90.77 2459.2642 24 -1.1 820.7611 3 78.79 2 39595 AEV_1_3_RA2_01_1232.d 2.33E5 2 2 625 648
R.NITYGELLKEVSR.L Y 88.52 1520.8198 13 2.4 507.9484 3 77.03 3 45721 AEV_3_3_RA3_01_1233.d 5.19E5 3 3 117 129
R.YGTFEMGNIAWFLGGR.L Y 85.97 1817.8558 16 -1.5 909.9338 2 90.87 3 55191 AEV_3_3_RA3_01_1233.d 2.77E5 3 3 69 84
R.HAIKDPNKLALIYEADDPGEGR.N Y 84.78 2421.2288 22 -3.9 485.2511 5 66.54 3 37501 AEV_3_3_RA3_01_1233.d 3.53E5 2 2 95 116
R.GRVDDVVNVSGHR.L Y 82.50 1408.7170 13 3.2 470.5811 3 44.08 2 17477 AEV_1_3_RA2_01_1232.d 7.63E5 6 6 523 535
K.AVFVVEDLPK.T Y 80.35 1115.6226 10 -0.1 558.8185 2 75.88 3 44866 AEV_3_3_RA3_01_1233.d 2.24E5 2 2 603 612
R.TGADVPWTK.G Y 79.39 973.4869 9 6.3 487.7538 2 57.23 2 24259 AEV_1_3_RA2_01_1232.d 9.1E5 6 6 231 239
K.GLYFTGDGAGR.D Y 76.95 1112.5250 11 4.1 557.2721 2 63.42 2 28168 AEV_1_3_RA2_01_1232.d 1.27E6 7 7 503 513
R.ELLTWERDFDTAR.Y Y 76.04 1650.8002 13 3.3 551.2758 3 77.00 2 38183 AEV_1_3_RA2_01_1232.d 7.31E5 3 3 56 68
K.IVDEALKQC(+57.02)PDVNHC(+57.02)IVYKR.T Y 67.20 2456.2305 20 3.9 492.2553 5 63.57 2 28269 AEV_1_3_RA2_01_1232.d 3.8E5 2 2 211 230 Carbamidomethylation
R.VVITTDEGKR.G Y 66.94 1116.6139 10 -13.8 559.3065 2 26.09 3 11223 AEV_3_3_RA3_01_1233.d 3.86E5 5 5 192 201
R.SRVVITTDEGKR.G Y 66.91 1359.7469 12 8.7 454.2602 3 27.19 2 9455 AEV_1_3_RA2_01_1232.d 3.62E5 4 4 190 201
R.AGNQYIHHKLETLR.I Y 62.29 1678.8903 14 1.6 420.7305 4 47.78 3 24304 AEV_3_3_RA3_01_1233.d 8.49E5 3 3 375 388
K.IIDVYQATK.S Y 59.99 1049.5757 9 2.4 525.7964 2 61.38 2 26779 AEV_1_3_RA2_01_1232.d 4.05E5 3 3 649 657
K.Q(-17.03)C(+57.02)PDVNHC(+57.02)IVYKR.T Y 58.82 1670.7657 13 8.8 557.9341 3 59.22 2 25373 AEV_1_3_RA2_01_1232.d 1.24E5 1 1 218 230 Pyro-glu from Q; Carbamidomethylation
R.YGTFEM(+15.99)GNIAWFLGGR.L Y 57.16 1833.8508 16 -2.6 917.9303 2 86.75 3 52842 AEV_3_3_RA3_01_1233.d 6.81E4 2 2 69 84 Oxidation (M)
K.IVDEALK(-1.03)QC(+57.02)PDVNHC(+57.02)IVYKR.T Y 54.09 2455.1987 20 9.5 492.0517 5 62.79 3 34569 AEV_3_3_RA3_01_1233.d 0 1 1 211 230 Lysine oxidation to aminoadipic semialdehyde; Carbamidomethylation
K.AVFVVEDLPKTR.S Y 51.49 1372.7714 12 12.9 458.6036 3 70.43 2 33168 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 603 614
R.VDDVVNVSGHR.L Y 50.80 1195.5945 11 2.5 598.8060 2 37.84 3 18100 AEV_3_3_RA3_01_1233.d 1.01E5 1 1 525 535
R.YM(+15.99)DTYFNVYK.G Y 44.95 1358.5853 10 25.5 680.3173 2 70.35 3 40506 AEV_3_3_RA3_01_1233.d 1.54E4 2 2 493 502 Oxidation (M)
K.EVSRLAWVLKQAGVK.K Y 44.85 1682.9832 15 -1.0 421.7526 4 63.61 2 28298 AEV_1_3_RA2_01_1232.d 0 1 1 126 140
R.YMDTYFNVYK.G Y 42.49 1342.5903 10 -85.9 672.2448 2 80.85 1 42491 AEV 2_3_RA2_01_1224.d 6.13E4 1 1 493 502
R.NITYGELLKEVSR(+14.02).L Y 38.96 1534.8354 13 1.0 512.6196 3 79.98 2 40544 AEV_1_3_RA2_01_1232.d 4.23E4 1 1 117 129 Methylation(KR)
R.S(+79.97)GKIM(+15.99)R.R Y 36.65 786.3459 6 14.2 394.1858 2 45.56 1 17590 AEV 2_3_RA2_01_1224.d 0 1 1 615 620 Phosphorylation (STY); Oxidation (M)
R.LN(+.98)ASYNC(+57.02)VDR.H Y 35.51 1211.5240 10 7.0 606.7736 2 49.75 2 20324 AEV_1_3_RA2_01_1232.d 1.22E5 1 1 85 94 Deamidation (NQ); Carbamidomethylation
R.T(-2.02)GADVPWTK.G Y 30.48 971.4713 9 40.2 486.7625 2 55.83 3 29424 AEV_3_3_RA3_01_1233.d 7.99E4 2 2 231 239 2-amino-3-oxo-butanoic_acid
R.AGNQYIHHK.L Y 27.59 1066.5308 9 11.1 534.2786 2 78.68 2 39547 AEV_1_3_RA2_01_1232.d 0 2 2 375 383
K.DLVLQVR.K Y 27.55 841.5021 7 -88.6 421.7211 2 73.06 1 36340 AEV 2_3_RA2_01_1224.d 2.92E5 1 1 586 592
R.LAWVLK.Q Y 27.47 728.4585 6 3.0 365.2376 2 71.91 2 34317 AEV_1_3_RA2_01_1232.d 2.55E5 3 3 130 135
K.SIGPFAAPK.A Y 25.50 886.4912 9 -56.4 887.4485 1 82.94 3 50271 AEV_3_3_RA3_01_1233.d 6.96E4 1 1 594 602
R.S(+42.01)RVVITTDEGK(+42.01).R Y 25.27 1287.6670 11 -9.0 644.8350 2 63.97 2 28535 AEV_1_3_RA2_01_1232.d 9.51E4 1 1 190 200 Acetylation (N-term); Acetylation (K)
R.KSIGPFAAPK.A Y 24.69 1014.5862 10 -38.7 508.2807 2 53.17 2 22097 AEV_1_3_RA2_01_1232.d 1.67E5 2 2 593 602
K.H(+158.13)EVTQFYVAPTALR.L Y 23.67 1788.9774 14 -3.0 448.2503 4 74.23 3 43532 AEV_3_3_RA3_01_1233.d 2.07E4 1 1 357 370 Reduced 4-Hydroxynonenal
K.IIDVYQATK(+21.98).S Y 23.64 1071.5576 9 -23.5 358.1848 3 82.89 1 44094 AEV 2_3_RA2_01_1224.d 0 1 1 649 657 Sodium adduct
K.S(+79.97)IGPFAAPK(+14.02).A Y 23.60 980.4732 9 -8.6 491.2397 2 31.30 3 14146 AEV_3_3_RA3_01_1233.d 6.18E4 1 1 594 602 Phosphorylation (STY); Methylation(KR)
K.GLY(+79.97)FTGDGAGR(-.98).D Y 23.38 1191.5073 11 -35.5 596.7398 2 65.19 1 30293 AEV 2_3_RA2_01_1224.d 2.33E5 1 1 503 513 Phosphorylation (STY); Amidation
R.KSIGP(+31.99)FAAPK.A Y 23.00 1046.5759 10 -49.8 524.2692 2 39.65 3 19187 AEV_3_3_RA3_01_1233.d 4.77E4 1 1 593 602 Dihydroxy
R.LNASYN(+.98)C(+57.02)VDR.H Y 21.58 1211.5240 10 -74.3 606.7243 2 52.99 1 21981 AEV 2_3_RA2_01_1224.d 1.68E5 3 3 85 94 Deamidation (NQ); Carbamidomethylation
K.G(+42.01)LY(+31.99)FTGDGAGR.D Y 21.15 1186.5254 11 -36.3 594.2484 2 39.03 1 13851 AEV 2_3_RA2_01_1224.d 1.78E4 1 1 503 513 Acetylation (N-term); Dihydroxy
R.TVWGAHK.R Y 20.79 797.4184 7 -24.1 798.4064 1 87.55 2 45942 AEV_1_3_RA2_01_1232.d 0 1 1 485 491
K.YVFDIHPTDR.F Y 20.58 1261.6091 10 -98.1 421.5024 3 74.63 1 37572 AEV 2_3_RA2_01_1224.d 1.88E5 1 1 299 308
R.VVITTDEGK.R Y 20.56 960.5128 9 -20.4 481.2538 2 32.26 3 14740 AEV_3_3_RA3_01_1233.d 1.53E5 2 2 192 200
R.VVITTDEGK(+43.99)R.G Y 20.27 1160.6036 10 -5.7 581.3058 2 31.62 3 14340 AEV_3_3_RA3_01_1233.d 4.63E4 1 1 192 201 Carboxylation (DKW)
R.KDLVLQVR.K Y 19.73 969.5971 8 -2.0 324.2057 3 53.28 3 27896 AEV_3_3_RA3_01_1233.d 6.03E4 1 1 585 592
K.LETLR.I N 19.50 630.3701 5 -93.6 316.1628 2 40.03 1 14411 AEV 2_3_RA2_01_1224.d 8.31E4 1 1 384 388
R.VD(+43.99)DVVNVS(+79.97)GHR.L Y 19.34 1319.5507 11 22.6 660.7975 2 74.23 1 37258 AEV 2_3_RA2_01_1224.d 1.36E5 1 1 525 535 Carboxylation (DKW); Phosphorylation (STY)
K.SIGPFAAPK(+42.01).A Y 19.33 928.5018 9 -61.6 929.4518 1 81.61 3 49310 AEV_3_3_RA3_01_1233.d 6.31E4 1 1 594 602 Acetylation (K)
R.LNASYNC(+57.02)VDR(+14.02).H Y 19.29 1224.5557 10 32.7 613.3051 2 55.13 2 23075 AEV_1_3_RA2_01_1232.d 0 1 1 85 94 Carbamidomethylation; Methylation(KR)
K.HEVTQFY(+162.05)VAPTALR.L Y 19.26 1792.8995 14 -78.4 449.1970 4 84.47 1 45359 AEV 2_3_RA2_01_1224.d 4.67E4 1 1 357 370 Hexose (NSY)
R.LN(+.98)ASYN(+.98)C(+57.02)VDR.H Y 18.78 1212.5081 10 4.6 607.2641 2 48.43 3 24716 AEV_3_3_RA3_01_1233.d 0 1 1 85 94 Deamidation (NQ); Carbamidomethylation
K.Q(+.98)C(+57.02)PDVNHC(+57.02)IVYK(+226.08).R Y 18.71 1758.7528 12 -3.6 587.2561 3 80.27 1 42050 AEV 2_3_RA2_01_1224.d 0 1 1 218 229 Deamidation (NQ); Carbamidomethylation; Biotinylation
K.SIGPFAAP(+31.99)K(+14.02).A Y 18.63 932.4967 9 33.1 311.8498 3 24.85 3 10491 AEV_3_3_RA3_01_1233.d 2.71E4 1 1 594 602 Dihydroxy; Methylation(KR)
K.TRSGK(+21.98).I Y 18.28 569.2897 5 -75.2 570.2542 1 82.32 1 43650 AEV 2_3_RA2_01_1224.d 1.25E5 2 2 613 617 Sodium adduct
K.NGDDGES(-18.01)LR(+14.02).K Y 18.09 957.4152 9 -41.2 320.1325 3 48.45 1 19328 AEV 2_3_RA2_01_1224.d 0 1 1 576 584 Dehydration; Methylation(KR)
K.RYM(+31.99)DT(+79.97)YFNVYK.G Y 17.96 1610.6476 11 -9.9 806.3231 2 89.25 1 49068 AEV 2_3_RA2_01_1224.d 1.39E5 1 1 492 502 Sulphone; Phosphorylation (STY)
K.IVDEALKQ(+.98)C(+57.02)PDVNHC(+57.02)IVYK(+43.99).R Y 17.92 2345.1030 19 -9.9 587.2772 4 85.74 1 46370 AEV 2_3_RA2_01_1224.d 0 1 1 211 229 Deamidation (NQ); Carbamidomethylation; Carboxylation (DKW)
K.R(+14.02)TGADVPWT(+79.97)K.G Y 17.91 1223.5699 10 -61.6 612.7546 2 45.98 1 17863 AEV 2_3_RA2_01_1224.d 0 1 1 230 239 Methylation(KR); Phosphorylation (STY)
K.S(+42.01)IGPFAAPK(+27.99).A Y 17.82 956.4967 9 -5.9 479.2528 2 58.53 2 24961 AEV_1_3_RA2_01_1232.d 3.39E4 1 1 594 602 Acetylation (N-term); Formylation
K.HPWPSM(+15.99)AR.T Y 16.93 996.4600 8 46.6 333.1761 3 55.83 2 23441 AEV_1_3_RA2_01_1232.d 8.17E4 1 1 477 484 Oxidation (M)
R.AGNQY(+31.99)IHHK.L Y 16.91 1098.5206 9 -0.8 1099.5270 1 93.33 2 48717 AEV_1_3_RA2_01_1232.d 0 1 1 375 383 Dihydroxy
R.DRVLDARSR(+14.02)VVIT(+79.97)TDEGK(+14.02).R Y 16.90 2137.0891 18 -1.6 535.2787 4 70.24 2 33025 AEV_1_3_RA2_01_1232.d 0 1 1 183 200 Methylation(KR); Phosphorylation (STY)
R.VVITTDEGKR(+14.02).G Y 16.88 1130.6295 10 -58.5 566.2889 2 39.48 2 15216 AEV_1_3_RA2_01_1232.d 0 1 1 192 201 Methylation(KR)
R.T(+27.99)GADVPWTK.G Y 16.72 1001.4818 9 -72.4 334.8104 3 29.25 1 8584 AEV 2_3_RA2_01_1224.d 6.86E4 1 1 231 239 Formylation
K.LIGT(-18.01)KK.I Y 16.64 640.4272 6 52.2 641.4679 1 104.90 1 57280 AEV 2_3_RA2_01_1224.d 0 1 1 205 210 Dehydration
K.Q(+27.99)AGVK.K Y 16.56 529.2860 5 7.5 530.2972 1 58.02 3 30964 AEV_3_3_RA3_01_1233.d 2.15E4 1 1 136 140 Formylation
R.VVITTDEGK(+68.06).R Y 16.50 1028.5753 9 -26.3 515.2814 2 24.83 2 8417 AEV_1_3_RA2_01_1232.d 0 1 1 192 200 Piperidination
K.RTGADVPWTK.G Y 16.29 1129.5880 10 -21.0 565.7894 2 63.98 2 28544 AEV_1_3_RA2_01_1232.d 3.01E4 1 1 230 239
K.SIGPF(+31.99)AAPK(+42.01).A Y 16.21 960.4916 9 -40.4 321.1582 3 68.85 1 33081 AEV 2_3_RA2_01_1224.d 1.43E5 1 1 594 602 Dihydroxy; Acetylation (K)
K.L(+42.01)YEESIR.D Y 16.06 950.4709 7 7.3 476.2462 2 35.76 3 16795 AEV_3_3_RA3_01_1233.d 2.01E4 1 1 38 44 Acetylation (N-term)
R.T(+226.08)VWGAHK.R Y 16.00 1023.4960 7 -46.8 342.1566 3 35.92 1 12153 AEV 2_3_RA2_01_1224.d 5.06E4 1 1 485 491 Biotinylation
R.S(+43.01)RVVITTDEGKR.G Y 15.89 1402.7528 12 30.3 351.7061 4 69.32 3 39707 AEV_3_3_RA3_01_1233.d 1.31E5 1 1 190 201 Carbamylation
K.LIGTKK(+104.03).I Y 15.89 762.4639 6 3.2 382.2405 2 68.85 2 31987 AEV_1_3_RA2_01_1232.d 1.53E5 1 1 205 210 Benzoyl
K.S(+226.08)IGPFAAPK.A Y 15.86 1112.5688 9 -2.5 557.2903 2 21.07 3 8417 AEV_3_3_RA3_01_1233.d 0 1 1 594 602 Biotinylation
K.S(+42.01)IGP(+31.99)FAAPK.A Y 15.82 960.4916 9 -6.6 481.2499 2 59.27 3 31868 AEV_3_3_RA3_01_1233.d 0 1 1 594 602 Acetylation (N-term); Dihydroxy
K.R(+27.99)TGADVPWT(+79.97)K.G Y 15.78 1237.5492 10 -2.4 413.5227 3 61.71 1 27768 AEV 2_3_RA2_01_1224.d 1.75E5 1 1 230 239 Formylation; Phosphorylation (STY)
K.GRDMWWHEEVEK.Y Y 15.49 1600.7092 12 -37.7 534.5569 3 54.09 1 22616 AEV 2_3_RA2_01_1224.d 4.43E4 1 1 240 251
R.DFDTAR.Y Y 15.37 723.3187 6 12.9 724.3353 1 32.92 3 15099 AEV_3_3_RA3_01_1233.d 5.24E4 1 1 63 68
K.T(+42.01)RSGK.I Y 15.33 589.3184 5 3.9 590.3279 1 110.86 1 59002 AEV 2_3_RA2_01_1224.d 0 1 1 613 617 Acetylation (N-term)
K.HEVTQFYVAPTALR.L Y 15.23 1630.8467 14 -7.5 816.4245 2 92.45 3 56024 AEV_3_3_RA3_01_1233.d 0 1 1 357 370
R.VLD(+21.98)AR.S Y 15.18 594.3101 5 -73.8 595.2736 1 33.27 1 10784 AEV 2_3_RA2_01_1224.d 2.22E4 1 1 185 189 Sodium adduct
R.KS(+79.97)IGPFAAPK(+42.01)AVFVVEDLPK.T Y 15.14 2234.1750 20 0.0 559.5510 4 76.23 3 45092 AEV_3_3_RA3_01_1233.d 3.71E5 1 1 593 612 Phosphorylation (STY); Acetylation (K)
K.RAGNQYIHHK.L Y 15.06 1222.6320 10 -103.2 612.2602 2 81.58 1 43069 AEV 2_3_RA2_01_1224.d 1.01E5 1 1 374 383
total 86 peptides
C1G9D7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.EMSRTDAVQSLYQDMAAR.H Y 125.43 2070.9463 18 1.9 691.3240 3 76.28 2 37613 AEV_1_3_RA2_01_1232.d 3.69E5 2 2 100 117
R.TDAVQSLYQDM(+15.99)AAR.H Y 120.94 1583.7250 14 10.3 792.8779 2 65.45 2 29592 AEV_1_3_RA2_01_1232.d 7.14E5 4 4 104 117 Oxidation (M)
R.TDAVQSLYQDMAAR.H Y 119.85 1567.7300 14 1.9 784.8738 2 78.06 2 39041 AEV_1_3_RA2_01_1232.d 2.13E6 6 6 104 117
R.HLPTEANPTPK.L Y 116.01 1203.6248 11 3.0 602.8215 2 34.44 2 12875 AEV_1_3_RA2_01_1232.d 1.57E7 32 32 17 27
R.EMSRTDAVQSLYQDM(+15.99)AAR.H Y 94.21 2086.9412 18 -2.0 696.6530 3 65.18 3 36435 AEV_3_3_RA3_01_1233.d 8.33E4 1 1 100 117 Oxidation (M)
R.SGTHNMYKEYR.E Y 93.91 1384.6194 11 21.6 693.3319 2 21.59 3 8702 AEV_3_3_RA3_01_1233.d 3.81E5 4 4 89 99
R.HLPTEANPTPKLYR.M Y 93.41 1635.8733 14 -0.3 546.2982 3 57.89 3 30877 AEV_3_3_RA3_01_1233.d 2.18E5 3 3 17 30
R.LTEYQVIGR.H Y 88.35 1077.5818 9 -2.4 539.7969 2 62.04 3 34022 AEV_3_3_RA3_01_1233.d 1.07E6 6 6 8 16
R.SGTHNM(+15.99)YKEYR.E Y 84.68 1400.6143 11 2.5 701.3162 2 13.84 3 4494 AEV_3_3_RA3_01_1233.d 8.73E5 7 7 89 99 Oxidation (M)
R.IFAPNTVVAK.S Y 82.04 1058.6124 10 -3.6 530.3116 2 63.39 3 35032 AEV_3_3_RA3_01_1233.d 4.11E6 7 7 33 42
R.EM(+15.99)SRTDAVQSLYQDMAAR.H Y 80.79 2086.9412 18 8.4 696.6602 3 74.14 2 35980 AEV_1_3_RA2_01_1232.d 3.92E4 1 1 100 117 Oxidation (M)
R.HLPTEANPTPK(+14.02).L Y 80.42 1217.6404 11 -0.3 406.8873 3 40.08 3 19450 AEV_3_3_RA3_01_1233.d 1.21E6 7 7 17 27 Methylation(KR)
R.TDAVQSLYQDMAAR(+14.02).H Y 77.50 1581.7457 14 0.5 791.8806 2 80.02 2 40576 AEV_1_3_RA2_01_1232.d 3.52E5 5 5 104 117 Methylation(KR)
K.ANGEIVSLNVIHEK.H Y 75.53 1521.8151 14 -10.6 508.2736 3 67.71 3 38540 AEV_3_3_RA3_01_1233.d 3.61E5 3 3 58 71
K.AN(-17.03)GEIVSLNVIHEK.H Y 75.17 1504.7886 14 -2.3 753.3998 2 76.48 3 45281 AEV_3_3_RA3_01_1233.d 2.89E5 3 3 58 71 Ammonia-loss (N)
K.SRFWYFLMKLR.K Y 72.19 1545.8279 11 -1.2 387.4638 4 82.75 3 50133 AEV_3_3_RA3_01_1233.d 4.46E4 2 2 43 53
R.HLPTE(+14.02)ANPTPK.L Y 71.99 1217.6404 11 9.0 406.8911 3 44.94 2 17896 AEV_1_3_RA2_01_1232.d 3.12E6 12 12 17 27 Methylation(others)
R.VVEIEKKDLVR.R Y 71.91 1326.7871 11 -19.5 664.3879 2 46.11 3 23262 AEV_3_3_RA3_01_1233.d 1.8E6 8 8 130 140
R.TDAVQSLYQ(+.98)DMAAR.H Y 64.38 1568.7140 14 4.7 785.3679 2 79.31 2 40012 AEV_1_3_RA2_01_1232.d 8.57E4 2 2 104 117 Deamidation (NQ)
R.RPSTFA Y 63.93 677.3497 6 2.0 339.6828 2 20.07 3 7856 AEV_3_3_RA3_01_1233.d 2.61E6 8 8 173 178
R.HLPTEAN(+.98)PTPK.L Y 61.40 1204.6088 11 -70.9 402.5151 3 51.19 1 20882 AEV 2_3_RA2_01_1224.d 2.22E6 10 10 17 27 Deamidation (NQ)
K.NLKFPLPHRVPK.A Y 59.26 1444.8666 12 -3.2 362.2228 4 60.30 3 32637 AEV_3_3_RA3_01_1233.d 2.31E6 9 9 151 162
R.IFAPNTVVAK(+14.02).S Y 57.61 1072.6281 10 -25.5 537.3076 2 66.37 3 37363 AEV_3_3_RA3_01_1233.d 3.02E5 3 3 33 42 Methylation(KR)
R.SGTHNM(-48.00)YKEYR.E Y 55.20 1336.6160 11 3.6 446.5475 3 11.44 3 3259 AEV_3_3_RA3_01_1233.d 1.76E5 1 1 89 99 Dethiomethyl
K.SRFWYFLMK.L Y 51.57 1276.6427 9 6.2 426.5575 3 81.75 2 41930 AEV_1_3_RA2_01_1232.d 2.06E5 3 3 43 51
K.FPLPHRVPK.A Y 49.99 1089.6447 9 -0.8 364.2219 3 50.65 3 26128 AEV_3_3_RA3_01_1233.d 0 1 1 154 162
R.VVEIEKK.D Y 48.96 843.5065 7 -4.4 422.7587 2 15.30 3 5274 AEV_3_3_RA3_01_1233.d 7.27E5 4 4 130 136
R.SIHILR.V Y 46.09 737.4548 6 -2.2 369.7339 2 40.79 3 19868 AEV_3_3_RA3_01_1233.d 2.54E6 9 9 124 129
K.NFGIWIR.Y Y 45.77 904.4919 7 1.4 453.2538 2 78.25 2 39167 AEV_1_3_RA2_01_1232.d 1.75E6 5 5 78 84
R.IFAPNTVVAKSRFWYFLMKLR.K Y 43.68 2586.4297 21 32.6 518.3101 5 86.03 3 52394 AEV_3_3_RA3_01_1233.d 0 1 1 33 53
R.LTE(+14.02)YQVIGR.H Y 43.21 1091.5975 9 -2.8 546.8045 2 68.62 3 39195 AEV_3_3_RA3_01_1233.d 1.9E5 2 2 8 16 Methylation(others)
R.HLPT(+14.02)EANPTPK.L Y 42.02 1217.6404 11 -1.7 609.8264 2 45.36 2 18112 AEV_1_3_RA2_01_1232.d 0 1 1 17 27 Methylation(others)
K.VKNFGIWIR.Y Y 40.40 1131.6553 9 -5.4 378.2237 3 70.55 3 40659 AEV_3_3_RA3_01_1233.d 4.71E5 3 3 76 84
R.M(+15.99)RIFAPNTVVAK.S Y 37.59 1361.7489 12 1.9 454.9244 3 61.58 2 26906 AEV_1_3_RA2_01_1232.d 1.23E5 2 2 31 42 Oxidation (M)
R.MRIFAPNTVVAK.S Y 34.08 1345.7540 12 9.0 449.5960 3 67.79 2 31214 AEV_1_3_RA2_01_1232.d 1.15E5 1 1 31 42
K.SRFWYFLM(+15.99)K.L Y 33.93 1292.6376 9 23.7 431.8967 3 77.58 3 46170 AEV_3_3_RA3_01_1233.d 3.01E4 2 2 43 51 Oxidation (M)
K.NFGIW(+15.99)IR.Y Y 32.32 920.4868 7 3.9 461.2525 2 75.78 2 37217 AEV_1_3_RA2_01_1232.d 0 1 1 78 84 Oxidation (HW)
R.R(+108.00)PSTFA Y 31.11 785.3473 6 -48.3 786.3167 1 38.65 1 13623 AEV 2_3_RA2_01_1224.d 3.97E4 1 1 173 178 O-Ethylphosphorylation
K.NLKFPLPHRVPK(+14.02).A Y 30.83 1458.8823 12 -0.6 365.7276 4 63.56 3 35210 AEV_3_3_RA3_01_1233.d 1.72E5 1 1 151 162 Methylation(KR)
R.FRSIHILR.V Y 30.66 1040.6243 8 -92.6 347.8499 3 77.24 1 39643 AEV 2_3_RA2_01_1224.d 1.04E5 1 1 122 129
K.NFGIWIRYDSR.S Y 30.37 1425.7153 11 18.8 476.2546 3 76.19 3 45063 AEV_3_3_RA3_01_1233.d 0 1 1 78 88
R.HLPT(+164.06)EANPTPK.L Y 30.21 1367.6849 11 -7.6 684.8445 2 29.95 3 13352 AEV_3_3_RA3_01_1233.d 2.71E4 1 1 17 27 O-Diisopropylphosphorylation
R.HLPTEANPTP(+13.98)K.L Y 30.18 1217.6040 11 -55.8 609.7753 2 60.26 1 26678 AEV 2_3_RA2_01_1224.d 3.52E5 1 1 17 27 Proline oxidation to pyroglutamic acid
R.T(+27.99)DAVQ(+.98)SLYQDMAAR.H Y 29.54 1596.7090 14 21.3 533.2549 3 69.62 2 32558 AEV_1_3_RA2_01_1232.d 1.86E4 1 1 104 117 Formylation; Deamidation (NQ)
K.Q(+.98)LLTK.N Y 29.36 602.3639 5 -20.4 603.3589 1 22.78 3 9318 AEV_3_3_RA3_01_1233.d 2.06E4 1 1 146 150 Deamidation (NQ)
K.N(+.98)FGIWIR.Y Y 27.67 905.4759 7 -80.3 453.7089 2 86.57 1 47015 AEV 2_3_RA2_01_1224.d 1.04E5 2 2 78 84 Deamidation (NQ)
R.HLP(+13.98)TEANPTPK.L Y 27.49 1217.6040 11 -56.1 609.7751 2 60.66 1 26969 AEV 2_3_RA2_01_1224.d 3.52E5 1 1 17 27 Proline oxidation to pyroglutamic acid
R.VVEIE(+14.02)KKDLVR.R Y 27.30 1340.8027 11 -3.0 336.2070 4 53.10 3 27774 AEV_3_3_RA3_01_1233.d 2.58E5 1 1 130 140 Methylation(others)
R.VVEIEKKDLVR(+14.02).R Y 26.77 1340.8027 11 -9.0 336.2050 4 53.92 3 28301 AEV_3_3_RA3_01_1233.d 0 1 1 130 140 Methylation(KR)
K.KLFAAR.R N 26.57 704.4333 6 -0.3 353.2238 2 26.49 3 11406 AEV_3_3_RA3_01_1233.d 2.66E6 8 8 167 172
R.EMSR(+282.05)TDAVQSLYQDMAAR.H Y 26.44 2352.9990 18 48.5 785.3783 3 78.26 3 46707 AEV_3_3_RA3_01_1233.d 3.66E4 1 1 100 117 Bis(hydroxphenylglyoxal) arginine
R.TDAVQ(+.98)SLYQDMAAR.H Y 26.24 1568.7140 14 -86.8 785.2962 2 83.31 1 44443 AEV 2_3_RA2_01_1224.d 1.56E5 1 1 104 117 Deamidation (NQ)
MC(+57.02)VILGR.L Y 24.96 847.4408 7 -28.6 848.4238 1 85.09 3 51756 AEV_3_3_RA3_01_1233.d 0 1 1 1 7 Carbamidomethylation
R.VVEIE(+14.02)KK.D Y 24.60 857.5222 7 4.0 429.7701 2 24.44 2 8247 AEV_1_3_RA2_01_1232.d 8.28E4 1 1 130 136 Methylation(others)
R.VVEIEK(+14.02)K.D Y 24.50 857.5222 7 -55.3 429.7446 2 21.38 3 8640 AEV_3_3_RA3_01_1233.d 0 1 1 130 136 Methylation(KR)
R.TDAVQSLYQDM(-4.99)AAR.H Y 23.93 1562.7437 14 18.7 782.3937 2 78.23 2 39154 AEV_1_3_RA2_01_1232.d 0 1 1 104 117 Methionine replacement by azido homoalanine
K.AN(+.98)GEIVSLNVIHEK(+14.02).H Y 23.85 1536.8147 14 16.6 513.2874 3 72.38 2 34643 AEV_1_3_RA2_01_1232.d 0 1 1 58 71 Deamidation (NQ); Methylation(KR)
R.RPYIK.Q Y 23.59 675.4067 5 2.2 338.7114 2 13.54 3 4328 AEV_3_3_RA3_01_1233.d 1.95E6 3 3 141 145
K.VKK(+42.01)AN(+162.05)GEIVSLNVIHEK.H Y 23.58 2081.1367 17 -6.7 521.2880 4 67.74 3 38443 AEV_3_3_RA3_01_1233.d 1.81E5 2 2 55 71 Acetylation (K); Hexose (NSY)
K.Q(-17.03)LLTK.N Y 22.69 584.3533 5 -7.8 585.3561 1 54.87 3 28914 AEV_3_3_RA3_01_1233.d 1.82E6 2 2 146 150 Pyro-glu from Q
R.SGTHNM(+15.99)YK.E Y 22.36 952.4073 8 -17.1 477.2028 2 68.45 1 32778 AEV 2_3_RA2_01_1224.d 0 2 2 89 96 Oxidation (M)
R.TD(+6.01)AVQSLYQDMAAR.H Y 19.80 1573.7382 14 -7.8 787.8702 2 78.01 3 46504 AEV_3_3_RA3_01_1233.d 4.02E4 1 1 104 117 Replacement of proton by lithium
K.QLLTK.N Y 18.98 601.3799 5 -88.1 301.6707 2 36.80 1 12602 AEV 2_3_RA2_01_1224.d 3.07E5 1 1 146 150
K.KLFAAR(+14.02).R N 18.71 718.4490 6 4.4 360.2333 2 36.42 3 17202 AEV_3_3_RA3_01_1233.d 2.71E5 1 1 167 172 Methylation(KR)
R.I(+42.01)FAPN(+.98)TVVAK.S Y 18.63 1101.6069 10 11.7 368.2139 3 61.43 2 26815 AEV_1_3_RA2_01_1232.d 7.91E4 1 1 33 42 Acetylation (N-term); Deamidation (NQ)
R.VVE(+14.02)IEKKDLVR.R Y 18.26 1340.8027 11 -5.1 336.2062 4 50.47 3 26023 AEV_3_3_RA3_01_1233.d 2.87E5 1 1 130 140 Methylation(others)
R.R(+42.01)PST(-18.01)FA Y 18.13 701.3497 6 14.0 702.3668 1 36.93 2 13984 AEV_1_3_RA2_01_1232.d 0 1 1 173 178 Acetylation (N-term); Dehydration
R.IFAPN(+.98)T(+79.97)VVAK.S Y 18.05 1139.5627 10 24.2 380.8707 3 24.86 2 8430 AEV_1_3_RA2_01_1232.d 5.94E4 1 1 33 42 Deamidation (NQ); Phosphorylation (STY)
K.LF(+31.99)AAR.R Y 18.04 608.3282 5 -47.6 609.3065 1 60.72 2 26349 AEV_1_3_RA2_01_1232.d 3.61E4 1 1 168 172 Dihydroxy
K.VKNFGIWIR(+31.99)YDSRSGTHNMYK(+14.02).E Y 17.68 2617.2859 21 23.5 655.3441 4 82.32 3 49827 AEV_3_3_RA3_01_1233.d 0 1 1 76 96 Dihydroxy; Methylation(KR)
R.HLPTEAN(+15.99)PTPK.L Y 17.56 1219.6196 11 13.9 407.5528 3 41.99 3 20643 AEV_3_3_RA3_01_1233.d 2.2E5 1 1 17 27 Oxidation or Hydroxylation
R.VVE(+14.02)IEKK.D Y 17.31 857.5222 7 -26.9 429.7568 2 22.90 3 9437 AEV_3_3_RA3_01_1233.d 0 1 1 130 136 Methylation(others)
R.HLPTEANPTPKLY(+164.06)R.M Y 17.24 1799.9335 14 -48.3 600.9561 3 32.40 3 14804 AEV_3_3_RA3_01_1233.d 0 1 1 17 30 O-Diisopropylphosphorylation
K.NLK(+71.04)FPLPHRVPK.A Y 16.65 1515.9038 12 -100.3 379.9452 4 60.24 3 32591 AEV_3_3_RA3_01_1233.d 0 1 1 151 162 Propionamide (K, X@N-term)
R.EMSRTDAVQSLYQD(+43.99)M(+15.99)AAR.H Y 16.48 2130.9309 18 15.6 533.7483 4 60.19 2 26005 AEV_1_3_RA2_01_1232.d 1.38E5 1 1 100 117 Carboxylation (DKW); Oxidation (M)
R.LT(-2.02)EYQVIGR.H Y 16.43 1075.5662 9 -38.5 538.7697 2 62.39 3 34263 AEV_3_3_RA3_01_1233.d 5.17E4 1 1 8 16 2-amino-3-oxo-butanoic_acid
K.NLK(-1.03)FPLPHRVPK.A Y 16.26 1443.8350 12 -55.7 482.2588 3 60.18 3 32548 AEV_3_3_RA3_01_1233.d 6.07E4 1 1 151 162 Lysine oxidation to aminoadipic semialdehyde
R.YDSRSGTHNM(+15.99)YK.E Y 15.99 1473.6306 12 -29.6 492.2029 3 69.53 1 33589 AEV 2_3_RA2_01_1224.d 2.4E5 1 1 85 96 Oxidation (M)
K.ATTKK.L N 15.36 547.3329 5 -67.3 548.3034 1 98.92 2 50661 AEV_1_3_RA2_01_1232.d 5.06E4 1 1 163 167
R.S(+68.06)GTHNMYKEYR.E Y 15.30 1452.6820 11 60.2 364.1996 4 11.72 3 3391 AEV_3_3_RA3_01_1233.d 0 1 1 89 99 Piperidination
total 80 peptides
C1GLV8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.GATVTDTGAPIMIPVGPGTLGR.I Y 117.58 2080.0986 22 -0.7 1041.0559 2 81.91 3 49542 AEV_3_3_RA3_01_1233.d 3.13E5 3 3 106 127
R.FTQAGSEVSALLGR.I Y 116.50 1434.7467 14 1.4 718.3817 2 77.36 2 38455 AEV_1_3_RA2_01_1232.d 2.37E5 2 2 294 307
K.TVFIQELINNIAK.A Y 109.69 1501.8503 13 2.2 751.9341 2 89.32 2 46895 AEV_1_3_RA2_01_1232.d 2.56E5 2 2 197 209
R.GISELGIYPAVDPLDSK.S Y 107.78 1772.9196 17 1.9 887.4688 2 83.25 2 43055 AEV_1_3_RA2_01_1232.d 5.47E5 4 4 371 387
K.LVLEVAQHLGENVVR.T Y 97.65 1674.9417 15 -2.4 559.3198 3 78.09 2 39048 AEV_1_3_RA2_01_1232.d 4.3E4 2 2 79 93
K.AHGGYSVFTGVGER.T Y 84.81 1435.6843 14 -2.5 718.8477 2 61.59 3 33650 AEV_3_3_RA3_01_1233.d 3.66E5 4 4 210 223
R.GATVTDTGAPIM(+15.99)IPVGPGTLGR.I Y 75.42 2096.0935 22 0.4 1049.0544 2 79.93 3 48010 AEV_3_3_RA3_01_1233.d 9.77E4 2 2 106 127 Oxidation (M)
R.FLSQPFTVAQVFTGIEGK.L Y 74.40 1968.0356 18 -0.1 985.0250 2 88.53 3 53911 AEV_3_3_RA3_01_1233.d 1.76E5 2 2 446 463
K.VVDLLAPYAR.G Y 67.97 1115.6338 10 -1.3 558.8234 2 76.65 3 45421 AEV_3_3_RA3_01_1233.d 1.4E5 2 2 173 182
K.SLQDIIAILGMDELSEADKLTVER.A Y 66.26 2658.3784 24 0.7 887.1340 3 95.91 2 49675 AEV_1_3_RA2_01_1232.d 7.68E4 2 2 416 439
K.IGLFGGAGVGK.T Y 65.86 974.5549 11 -5.2 488.2822 2 70.50 3 40619 AEV_3_3_RA3_01_1233.d 5.63E5 6 6 186 196
R.GISE(+14.02)LGIYPAVDPLDSK.S Y 64.82 1786.9352 17 -4.7 894.4707 2 84.72 3 51524 AEV_3_3_RA3_01_1233.d 6.44E4 1 1 371 387 Methylation(others)
R.VIQLDGESK.V Y 62.96 987.5236 9 -1.8 494.7682 2 41.61 3 20405 AEV_3_3_RA3_01_1233.d 4.93E5 3 3 239 247
R.TIAMDGTEGLVR.G Y 60.62 1261.6337 12 1.7 631.8252 2 67.92 3 38624 AEV_3_3_RA3_01_1233.d 1.26E5 1 1 94 105
K.VALVFGQMNEPPGAR.A Y 60.22 1584.8082 15 -4.9 793.4075 2 76.25 3 45106 AEV_3_3_RA3_01_1233.d 8.77E4 2 2 248 262
K.GSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSR.G Y 57.52 3699.8630 36 4.1 1234.3000 3 86.64 2 45389 AEV_1_3_RA2_01_1232.d 1.7E5 2 2 335 370
R.IMNVTGDPIDER.G Y 56.57 1358.6500 12 6.7 680.3369 2 67.58 2 31067 AEV_1_3_RA2_01_1232.d 4.76E5 3 3 128 139
R.IVGEEHYEVATR.V Y 56.15 1401.6888 12 -2.3 701.8501 2 48.76 3 24932 AEV_3_3_RA3_01_1233.d 5.58E5 3 3 395 406
K.ILAELEKS Y 46.97 901.5120 8 -4.4 451.7613 2 57.56 3 30623 AEV_3_3_RA3_01_1233.d 3.74E5 2 2 506 513
R.EGNDLYHEMQETR.V Y 46.27 1620.6838 13 23.9 541.2481 3 61.38 2 26804 AEV_1_3_RA2_01_1232.d 0 1 1 226 238
K.KAPIHAEAPEFVEQST(+13.03)TAEVLVTGIKVVDLLAPYAR.G Y 45.81 3875.1196 36 -18.7 776.0167 5 91.67 3 55631 AEV_3_3_RA3_01_1233.d 0 1 1 147 182 Michael addition with methylamine
K.LVDLKDTIR.S Y 43.74 1071.6288 9 -3.8 536.8196 2 62.01 3 33969 AEV_3_3_RA3_01_1233.d 1.25E5 2 2 464 472
K.A(+42.01)PIHAEAPEFVEQ(+.98)S(+79.97)TTAEVLVTGIK.V Y 39.39 2759.3306 25 17.3 690.8519 4 78.12 3 46594 AEV_3_3_RA3_01_1233.d 9.62E4 1 1 148 172 Acetylation (N-term); Deamidation (NQ); Phosphorylation (STY)
R.GISELGIYPAVDPLDSK(+14.02).S Y 38.26 1786.9352 17 -5.9 894.4696 2 83.37 3 50578 AEV_3_3_RA3_01_1233.d 3.17E4 1 1 371 387 Methylation(KR)
K.I(+42.01)GLFGGAGVGK.T Y 35.18 1016.5654 11 -6.6 339.8602 3 32.93 2 12093 AEV_1_3_RA2_01_1232.d 4.76E4 2 2 186 196 Acetylation (N-term)
R.IM(+15.99)NVTGDPIDER.G Y 29.21 1374.6449 12 -56.9 688.2906 2 76.26 1 38867 AEV 2_3_RA2_01_1224.d 4.15E4 2 2 128 139 Oxidation (M)
K.IHQVIGAVVDVK(+97.02).F Y 29.11 1373.7667 12 7.6 458.9330 3 41.22 3 20142 AEV_3_3_RA3_01_1233.d 2.25E5 1 1 46 57 Maleimide
M(+15.99)FKSGVAR.T Y 27.87 910.4694 8 -73.9 304.4746 3 67.06 1 31685 AEV 2_3_RA2_01_1224.d 5.83E4 1 1 1 8 Oxidation (M)
R.M(+15.99)LDPR.I Y 27.81 646.3109 5 3.1 647.3201 1 57.44 2 24334 AEV_1_3_RA2_01_1232.d 0 2 2 390 394 Oxidation (M)
R.SLASRYASTSSGQVGK(+14.02).I Y 27.30 1611.8217 16 12.0 538.2876 3 76.02 3 44938 AEV_3_3_RA3_01_1233.d 5.82E4 1 1 30 45 Methylation(KR)
K.I(+43.01)GLFGGAGVGK.T Y 27.17 1017.5607 11 -3.3 340.1931 3 62.61 3 34439 AEV_3_3_RA3_01_1233.d 2.25E4 2 2 186 196 Carbamylation
K.VVDLLAPYAR(+14.02).G Y 25.73 1129.6495 10 -11.5 565.8256 2 77.87 2 38868 AEV_1_3_RA2_01_1232.d 0 1 1 173 182 Methylation(KR)
R.EGND(+43.99)LYHEMQETR.V Y 25.44 1664.6736 13 5.4 555.9015 3 66.68 1 31383 AEV 2_3_RA2_01_1224.d 4.38E5 2 2 226 238 Carboxylation (DKW)
R.TREGNDLYHEM(-48.00)QETR.V Y 25.33 1829.8292 15 3.4 458.4662 4 19.43 3 7539 AEV_3_3_RA3_01_1233.d 5.49E4 1 1 224 238 Dethiomethyl
R.GGKIGLFGGAGVGK.T Y 24.27 1216.6927 14 10.4 406.5757 3 62.61 3 34435 AEV_3_3_RA3_01_1233.d 4.01E4 2 2 183 196
K.SGVAR.T Y 24.21 488.2707 5 47.0 489.3009 1 76.38 2 37688 AEV_1_3_RA2_01_1232.d 6.35E4 2 2 4 8
K.IGLFGGAGVGK(+27.99).T Y 23.92 1002.5498 11 -9.8 335.1873 3 24.87 2 8435 AEV_1_3_RA2_01_1232.d 2.04E5 1 1 186 196 Formylation
R.S(-17.03)ALAR.H Y 23.38 499.2754 5 -16.5 500.2745 1 71.98 3 41784 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 13 17 Ammonia-loss (Protein N-term)
K.S(+42.01)GVAR.T Y 22.04 530.2812 5 18.3 531.2982 1 30.95 3 13939 AEV_3_3_RA3_01_1233.d 0 1 1 4 8 Acetylation (Protein N-term)
R.SLASR.Y N 22.02 532.2969 5 0.7 533.3045 1 71.86 3 41688 AEV_3_3_RA3_01_1233.d 2.17E5 1 1 30 34
K.LVDLK.D N 21.79 586.3690 5 29.4 587.3936 1 11.87 3 3440 AEV_3_3_RA3_01_1233.d 5.74E3 1 1 464 468
K.S(+134.05)RMLDPRIVGEEHYEVATR.V Y 20.93 2391.1753 19 -15.3 598.7919 4 97.47 1 54686 AEV 2_3_RA2_01_1224.d 6.25E5 1 1 388 406 3-methyl-2-pyridyl isocyanate
R.EGNDLYHE(+43.99)MQETR.V Y 20.91 1664.6736 13 -9.9 833.3358 2 66.32 1 31115 AEV 2_3_RA2_01_1224.d 1.18E5 1 1 226 238 Carboxylation (E)
K.S(-18.01)GVAR.T Y 20.90 470.2601 5 -14.1 471.2607 1 65.83 2 29830 AEV_1_3_RA2_01_1232.d 0 1 1 4 8 Dehydration
R.VIQLD(+21.98)GESK(+14.02).V Y 20.51 1023.5212 9 -4.2 512.7657 2 69.63 1 33668 AEV 2_3_RA2_01_1224.d 6.13E4 1 1 239 247 Sodium adduct; Methylation(KR)
R.SLAS(+79.97)R.Y N 20.06 612.2632 5 11.2 613.2774 1 29.72 2 10579 AEV_1_3_RA2_01_1232.d 3.33E4 2 2 30 34 Phosphorylation (STY)
K.LVDLK(+31.99).D N 19.44 618.3588 5 -59.3 619.3294 1 82.09 3 49658 AEV_3_3_RA3_01_1233.d 0 1 1 464 468 Dihydroxy
R.LPQNP(+31.99)ALR.S Y 19.05 939.5137 8 13.1 314.1826 3 9.37 2 2275 AEV_1_3_RA2_01_1232.d 1.14E4 1 1 22 29 Dihydroxy
K.LVDLK(+42.01).D N 18.86 628.3796 5 12.6 315.2010 2 45.66 2 18266 AEV_1_3_RA2_01_1232.d 3.59E5 2 2 464 468 Acetylation (K)
MFKSGVAR.T Y 18.83 894.4745 8 -103.8 299.1345 3 56.62 1 24200 AEV 2_3_RA2_01_1224.d 0 1 1 1 8
K.LQR(+31.99)FLSQPFTVAQVFTGIEGK(+42.01).L Y 18.76 2439.2798 21 -9.8 610.8212 4 88.34 3 53794 AEV_3_3_RA3_01_1233.d 0 1 1 443 463 Dihydroxy; Acetylation (K)
K.IGLFGGAGVGK(+114.04).T Y 18.72 1088.5978 11 -49.5 545.2792 2 22.05 3 8920 AEV_3_3_RA3_01_1233.d 3.18E4 1 1 186 196 Ubiquitin
R.GISELGIYPAVDPLD(+43.99)SK.S Y 18.52 1816.9094 17 0.1 455.2347 4 37.31 3 17776 AEV_3_3_RA3_01_1233.d 0 1 1 371 387 Carboxylation (DKW)
R.TIAMD(-18.01)GTEGLVR.G Y 18.36 1243.6230 12 -103.1 311.8810 4 41.42 1 15260 AEV 2_3_RA2_01_1224.d 6.08E5 1 1 94 105 Dehydration
K.TVFIQ(+.98)ELINNIAK.A Y 18.31 1502.8344 13 -33.6 752.3992 2 90.69 3 55090 AEV_3_3_RA3_01_1233.d 5.47E4 1 1 197 209 Deamidation (NQ)
K.T(+79.97)VFIQELINN(+.98)IAK(+42.01).A Y 18.26 1624.8113 13 -0.2 813.4128 2 89.40 3 54378 AEV_3_3_RA3_01_1233.d 0 1 1 197 209 Phosphorylation (STY); Deamidation (NQ); Acetylation (K)
K.I(+27.99)LAELEK(+42.01).S Y 17.94 884.4855 7 3.7 443.2516 2 56.41 2 23769 AEV_1_3_RA2_01_1232.d 0 2 2 506 512 Formylation; Acetylation (K)
K.IGLFGGAGVGK(+43.01).T Y 17.92 1017.5607 11 16.3 340.1997 3 57.10 3 30297 AEV_3_3_RA3_01_1233.d 3.7E4 2 2 186 196 Carbamylation
R.VQQM(+15.99)LQEYK.S Y 17.65 1181.5751 9 -101.1 394.8258 3 40.20 1 14528 AEV 2_3_RA2_01_1224.d 0 1 1 407 415 Oxidation (M)
R.V(+42.01)IQLDGES(+162.05)K.V Y 17.55 1191.5870 9 -69.1 398.1755 3 65.11 1 30231 AEV 2_3_RA2_01_1224.d 0 1 1 239 247 Acetylation (N-term); Hexose (NSY)
R.SLAS(-18.01)R.Y N 17.09 514.2863 5 -24.8 515.2808 1 41.75 3 20505 AEV_3_3_RA3_01_1233.d 0 1 1 30 34 Dehydration
K.SRMLDPR.I Y 17.08 873.4490 7 -2.8 437.7306 2 24.13 3 10073 AEV_3_3_RA3_01_1233.d 0 1 1 388 394
R.I(+42.01)MNVTGDPIDER(+14.02).G Y 17.07 1414.6763 12 -1.7 354.6758 4 9.43 3 2357 AEV_3_3_RA3_01_1233.d 1.83E5 1 1 128 139 Acetylation (N-term); Methylation(KR)
R.GISELGIYPAVDPLDSKSR.M Y 16.97 2016.0527 19 -9.5 404.2140 5 42.19 3 20781 AEV_3_3_RA3_01_1233.d 0 1 1 371 389
K.LTVER(+31.99).A N 16.57 648.3442 5 0.1 325.1794 2 10.62 3 2823 AEV_3_3_RA3_01_1233.d 2.87E4 1 1 435 439 Dihydroxy
K.LVLEVAQ(+.98)HLGENVVR.T Y 16.27 1675.9257 15 -11.5 559.6428 3 78.27 2 39182 AEV_1_3_RA2_01_1232.d 0 1 1 79 93 Deamidation (NQ)
R.V(+58.01)ALTGLTIAEYFR.D Y 16.01 1510.8031 13 -10.5 378.7041 4 45.66 3 22968 AEV_3_3_RA3_01_1233.d 1.6E4 1 1 265 277 Carboxymethyl (KW, X@N-term)
R.S(+43.01)LASR.Y N 15.96 575.3027 5 -39.7 576.2872 1 48.30 2 19593 AEV_1_3_RA2_01_1232.d 1.12E5 1 1 30 34 Carbamylation
K.VALVFGQM(+31.99)NEPPGAR.A Y 15.55 1616.7980 15 -15.3 539.9317 3 50.89 2 20892 AEV_1_3_RA2_01_1232.d 2.9E4 1 1 248 262 Sulphone
R.SFKAIM(+15.99)NGEGDDLPEAAFYM(+15.99)VGDFESAR.A Y 15.49 3098.3638 28 -26.2 1033.7682 3 91.19 1 50508 AEV 2_3_RA2_01_1224.d 7.47E5 1 1 473 500 Oxidation (M)
R.GGK(+42.01)IGLFGGAGVGK.T Y 15.28 1258.7034 14 -2.0 315.6825 4 17.71 3 6597 AEV_3_3_RA3_01_1233.d 0 1 1 183 196 Acetylation (K)
K.AHGGYSVFTGVGER(+28.03)TR.E Y 15.02 1720.8645 16 7.2 431.2265 4 43.05 3 21323 AEV_3_3_RA3_01_1233.d 0 1 1 210 225 Dimethylation(KR)
total 72 peptides
C1GB65
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.EQGEGKEGGAPGDFAPSFR.G Y 130.00 1934.8757 19 3.9 645.9684 3 64.59 2 28964 AEV_1_3_RA2_01_1232.d 3.78E6 10 10 220 238
R.RREQGEGKEGGAPGDFAPSFR.G Y 104.74 2247.0779 21 -0.2 562.7766 4 54.19 3 28512 AEV_3_3_RA3_01_1233.d 2.58E6 11 11 218 238
R.REQGEGKEGGAPGDFAPSFR.G Y 102.06 2090.9768 20 1.7 523.7524 4 59.09 3 31738 AEV_3_3_RA3_01_1233.d 3.83E5 4 4 219 238
K.HGDIDTKNLYVIK.A Y 96.54 1514.8092 13 -1.5 505.9429 3 61.22 3 33356 AEV_3_3_RA3_01_1233.d 2.35E6 8 8 119 131
R.EWLHLPAEIVPATHVK.Q Y 93.53 1839.0043 16 -5.5 460.7558 4 77.84 3 46378 AEV_3_3_RA3_01_1233.d 3.96E5 3 3 165 180
R.E(+14.02)QGEGKEGGAPGDFAPSFR.G Y 88.72 1948.8915 19 -2.0 650.6365 3 64.63 3 35979 AEV_3_3_RA3_01_1233.d 3.26E5 2 2 220 238 Methylation(others)
K.EGGAPGDFAPSFR.G Y 87.10 1306.5941 13 11.4 654.3118 2 70.31 2 33124 AEV_1_3_RA2_01_1232.d 2.23E6 8 8 226 238
R.EQGE(+14.02)GKEGGAPGDFAPSFR.G Y 79.78 1948.8915 19 5.5 650.6414 3 66.38 2 30228 AEV_1_3_RA2_01_1232.d 6.5E5 4 4 220 238 Methylation(others)
K.AC(+57.02)QSLTSR.G Y 75.53 921.4338 8 1.8 461.7250 2 16.85 3 6134 AEV_3_3_RA3_01_1233.d 1.51E6 7 7 132 139 Carbamidomethylation
R.EQGEGK(+14.02)EGGAPGDFAPSFR.G Y 73.00 1948.8915 19 -1.1 650.6370 3 66.30 3 37303 AEV_3_3_RA3_01_1233.d 2.78E5 1 1 220 238 Methylation(KR)
R.FSWQYYYYTLTPEGLDFLREWLHLPAEIVPATHVK.Q Y 71.71 4282.1567 35 5.2 857.4431 5 96.72 3 57920 AEV_3_3_RA3_01_1233.d 1.8E5 2 2 146 180
R.EQ(+.98)GEGKEGGAPGDFAPSFR.G Y 68.80 1935.8597 19 0.9 646.2944 3 64.95 3 36230 AEV_3_3_RA3_01_1233.d 1.26E5 1 1 220 238 Deamidation (NQ)
R.SHAPPR.G Y 67.91 663.3452 6 0.4 332.6800 2 8.29 3 1956 AEV_3_3_RA3_01_1233.d 1.16E5 4 4 184 189
K.EGGAPGDFAPSFR(+.98).G Y 64.75 1307.5781 13 17.2 654.8076 2 69.95 2 32817 AEV_1_3_RA2_01_1232.d 3.29E5 2 2 226 238 Deamidation (R)
R.GDRGEGGYR.R Y 61.27 965.4315 9 6.2 483.7260 2 10.13 2 2532 AEV_1_3_RA2_01_1232.d 1.44E5 4 4 209 217
K.IHEYLFR.E Y 60.91 976.5130 7 0.8 326.5119 3 59.81 3 32322 AEV_3_3_RA3_01_1233.d 1.61E6 8 8 98 104
K.HGDIDT(+79.96)KNLYVIK.A Y 59.94 1594.7661 13 73.6 399.7281 4 62.33 2 27423 AEV_1_3_RA2_01_1232.d 5E4 1 1 119 131 Sulfation
K.AC(+57.02)QSLTSR(+14.02).G Y 57.83 935.4495 8 0.4 468.7322 2 24.00 3 9998 AEV_3_3_RA3_01_1233.d 3.85E5 2 2 132 139 Carbamidomethylation; Methylation(KR)
K.IHEYLFREGVLVAK.K Y 56.70 1672.9301 14 -3.6 419.2383 4 70.42 3 40556 AEV_3_3_RA3_01_1233.d 2.15E5 1 1 98 111
K.E(+14.02)GGAPGDFAPSFR.G Y 56.11 1320.6097 13 2.4 661.3137 2 70.99 3 41018 AEV_3_3_RA3_01_1233.d 5.16E5 4 4 226 238 Methylation(others)
R.RREQGEGK(+14.02)EGGAPGDFAPSFR.G Y 55.42 2261.0938 21 0.0 566.2807 4 56.71 3 30008 AEV_3_3_RA3_01_1233.d 0 1 1 218 238 Methylation(KR)
R.EGVLVAKK.D Y 54.89 842.5225 8 -6.8 422.2657 2 18.84 3 7206 AEV_3_3_RA3_01_1233.d 2.18E5 3 3 105 112
R.EGVLVAKKDFNLPK.H Y 54.20 1556.8926 14 -2.6 390.2294 4 64.30 3 35727 AEV_3_3_RA3_01_1233.d 2.48E5 3 3 105 118
K.DFNLPK.H Y 50.18 732.3806 6 1.6 367.1982 2 61.20 3 33406 AEV_3_3_RA3_01_1233.d 1.98E6 4 4 113 118
R.REQGEGKEGGAPGDFAPS(-18.01)FR(+14.02).G Y 50.12 2086.9819 20 60.5 522.7843 4 59.24 3 31845 AEV_3_3_RA3_01_1233.d 0 1 1 219 238 Dehydration; Methylation(KR)
R.EQGEGKE(+28.03)GGAPGDFAPSFR.G Y 49.58 1962.9071 19 -0.2 655.3095 3 66.80 3 37701 AEV_3_3_RA3_01_1233.d 0 1 1 220 238 Ethylation
R.E(-18.01)QGEGK(+14.02)EGGAPGDFAPSFR.G Y 49.12 1930.8809 19 47.7 644.6649 3 64.26 3 35699 AEV_3_3_RA3_01_1233.d 7.02E4 3 3 220 238 Pyro-glu from E; Methylation(KR)
K.NLYVIK.A Y 47.90 748.4483 6 -3.0 375.2303 2 56.17 3 29675 AEV_3_3_RA3_01_1233.d 3.12E6 9 9 126 131
K.AC(+57.02)Q(+.98)SLTSR.G Y 47.78 922.4178 8 7.3 462.2195 2 20.34 3 7989 AEV_3_3_RA3_01_1233.d 3.28E5 3 3 132 139 Carbamidomethylation; Deamidation (NQ)
R.SHAPPRGM(+15.99)M(+15.99)GGEERER.R Y 45.57 1827.8104 16 3.0 366.5705 5 11.72 3 3365 AEV_3_3_RA3_01_1233.d 4.48E5 3 3 184 199 Oxidation (M)
K.KIHEYLFR.E Y 44.77 1104.6079 8 -1.6 369.2093 3 53.01 3 27785 AEV_3_3_RA3_01_1233.d 8.84E5 4 4 97 104
R.KKIHEYLFR.E Y 42.66 1232.7029 9 7.7 411.9114 3 54.39 2 22706 AEV_1_3_RA2_01_1232.d 1.4E5 1 1 96 104
R.EGVLVAK.K Y 41.04 714.4276 7 -88.1 358.1896 2 45.88 1 17789 AEV 2_3_RA2_01_1224.d 2.43E6 7 7 105 111
R.GMMGGEERER.R Y 40.74 1150.4860 10 3.9 384.5041 3 20.39 3 8028 AEV_3_3_RA3_01_1233.d 2.09E5 2 2 190 199
K.EGGAPGDFAPSFR(+14.02).G Y 39.57 1320.6097 13 2.4 661.3137 2 72.96 3 42548 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 226 238 Methylation(KR)
R.SHAPPR(+14.02).G Y 39.35 677.3609 6 0.9 339.6880 2 11.00 3 3031 AEV_3_3_RA3_01_1233.d 3.92E5 4 4 184 189 Methylation(KR)
K.KDFNLPK.H Y 37.81 860.4756 7 3.7 431.2466 2 40.88 2 15879 AEV_1_3_RA2_01_1232.d 2.36E6 6 6 112 118
R.RPGGR(+28.03)GGPR.G Y 36.76 936.5366 9 -35.5 313.1750 3 9.96 3 2585 AEV_3_3_RA3_01_1233.d 0 1 1 200 208 Dimethylation(KR)
R.RREQGEGKEGGAPGDFAPS(-2.02)FR.G Y 35.43 2245.0623 21 28.3 562.2887 4 54.24 3 28516 AEV_3_3_RA3_01_1233.d 0 1 1 218 238 2-amino-3-oxo-butanoic_acid
R.GDRGE(+14.02)GGYR.R Y 35.43 979.4471 9 4.3 490.7329 2 14.35 3 4755 AEV_3_3_RA3_01_1233.d 4.93E5 3 3 209 217 Methylation(others)
R.R(+.98)PGGRGGPR.G Y 34.61 909.4893 9 -27.0 304.1622 3 24.01 3 10005 AEV_3_3_RA3_01_1233.d 0 1 1 200 208 Deamidation (R)
R.GM(-48.00)MGGEERER.R Y 33.93 1102.4825 10 1.2 368.5019 3 9.75 3 2438 AEV_3_3_RA3_01_1233.d 1.85E5 1 1 190 199 Dethiomethyl
R.EQGEGK.E Y 32.62 646.2922 6 -45.9 647.2698 1 70.99 1 34710 AEV 2_3_RA2_01_1224.d 0 1 1 220 225
R.EQGEGK(+14.02).E Y 32.46 660.3079 6 13.8 661.3242 1 66.32 3 37323 AEV_3_3_RA3_01_1233.d 1.95E5 1 1 220 225 Methylation(KR)
K.KIHEYLFREGVLVAK.K Y 30.90 1801.0250 15 -0.4 361.2121 5 67.47 3 38292 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 97 111
R.GGFGR(+28.03)GR(+14.02)GAPPPSS Y 30.49 1340.6948 14 1.0 447.9060 3 31.98 3 14555 AEV_3_3_RA3_01_1233.d 2.17E6 2 2 239 252 Dimethylation(KR); Methylation(KR)
R.EQGEGK(+28.03)EGGAPGDFAPSFR.G Y 30.20 1962.9071 19 16.8 655.3206 3 67.40 2 30932 AEV_1_3_RA2_01_1232.d 1.68E5 1 1 220 238 Dimethylation(KR)
R.RPGGR(+14.02)GGPR.G Y 29.13 922.5209 9 2.4 462.2688 2 9.70 3 2421 AEV_3_3_RA3_01_1233.d 4.39E5 2 2 200 208 Methylation(KR)
K.IHE(+14.02)YLFR.E Y 28.41 990.5287 7 3.3 331.1846 3 66.51 3 37469 AEV_3_3_RA3_01_1233.d 2.12E5 2 2 98 104 Methylation(others)
R.G(+42.01)GFGRGRGAPPPSS Y 28.00 1340.6584 14 30.6 447.9071 3 31.74 3 14413 AEV_3_3_RA3_01_1233.d 1.65E6 1 1 239 252 Acetylation (N-term)
R.GMM(+15.99)GGEERER.R Y 26.36 1166.4808 10 -7.0 389.8315 3 11.78 3 3412 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 190 199 Oxidation (M)
K.HGDIDTKNLY(-18.01)VIK(+14.02).A Y 26.00 1510.8143 13 -8.2 378.7078 4 61.55 3 33621 AEV_3_3_RA3_01_1233.d 3.69E4 1 1 119 131 Dehydration; Methylation(KR)
R.GGFGR(+14.02).G Y 25.63 506.2601 5 8.7 507.2718 1 26.69 2 9237 AEV_1_3_RA2_01_1232.d 7.44E4 2 2 239 243 Methylation(KR)
R.GGPRGDR.G Y 25.25 713.3569 7 -2.3 357.6849 2 54.00 1 22558 AEV 2_3_RA2_01_1224.d 3.48E5 1 1 205 211
R.SHAPPRGM(+15.99)M(+15.99)GGEER.E Y 25.00 1542.6667 14 19.8 386.6816 4 11.05 3 3032 AEV_3_3_RA3_01_1233.d 1.96E5 2 2 184 197 Oxidation (M)
K.DFNLPK(+14.02).H Y 24.55 746.3962 6 -4.4 374.2037 2 69.02 3 39473 AEV_3_3_RA3_01_1233.d 9.21E4 1 1 113 118 Methylation(KR)
R.G(+42.01)GFGRGR(+14.02)GAPPPSS Y 24.48 1354.6742 14 29.0 452.5784 3 35.06 3 16362 AEV_3_3_RA3_01_1233.d 2.8E6 3 3 239 252 Acetylation (N-term); Methylation(KR)
R.E(+14.02)GVLVAK.K Y 24.39 728.4432 7 -3.6 365.2276 2 40.63 3 19766 AEV_3_3_RA3_01_1233.d 1.85E5 1 1 105 111 Methylation(others)
R.EGVLVAK(+14.02).K Y 23.61 728.4432 7 -31.7 365.2173 2 42.50 3 21008 AEV_3_3_RA3_01_1233.d 0 1 1 105 111 Methylation(KR)
R.G(+42.01)APPPSS Y 23.51 653.3020 7 51.4 654.3428 1 112.86 2 54532 AEV_1_3_RA2_01_1232.d 9.52E3 1 1 246 252 Acetylation (N-term)
K.EGGAPGDFAP(+13.98)SFR.G Y 23.36 1320.5734 13 -54.3 661.2581 2 79.18 1 41217 AEV 2_3_RA2_01_1224.d 4.9E4 1 1 226 238 Proline oxidation to pyroglutamic acid
R.EQGEGKE(+6.01)GGAPGDFAPSFR.G Y 22.74 1940.8839 19 59.0 648.0068 3 64.37 3 35782 AEV_3_3_RA3_01_1233.d 1.73E4 1 1 220 238 Replacement of proton by lithium
R.RREQGEGKEGGAPGDFAPSFR(-.98).G Y 22.63 2246.0940 21 -21.5 450.2164 5 54.37 3 28596 AEV_3_3_RA3_01_1233.d 2.21E5 1 1 218 238 Amidation
K.HGDIDTK(+78.05)NLYVIK.A Y 22.48 1592.8562 13 27.9 399.2324 4 62.45 2 27508 AEV_1_3_RA2_01_1232.d 1.71E4 1 1 119 131 2,5-dimethypyrrole
R.L(+42.01)GSALVT(+79.97)C(+57.02)HIPLR.K Y 22.18 1557.7738 13 -53.9 390.4297 4 74.09 1 37154 AEV 2_3_RA2_01_1224.d 9.27E4 1 1 25 37 Acetylation (N-term); Phosphorylation (STY); Carbamidomethylation
R.GGFGR(+.98).G Y 21.92 493.2285 5 -65.6 494.2034 1 20.69 1 4968 AEV 2_3_RA2_01_1224.d 0 1 1 239 243 Deamidation (R)
R.GRGAPPPSS Y 21.63 824.4140 9 -122.9 413.1636 2 42.07 1 15611 AEV 2_3_RA2_01_1224.d 3.35E5 1 1 244 252
R.GMM(-48.00)GGEERER.R Y 21.40 1102.4825 10 2.3 368.5023 3 9.32 3 2270 AEV_3_3_RA3_01_1233.d 1.64E5 1 1 190 199 Dethiomethyl
R.G(+42.01)GFGR.G Y 20.79 534.2550 5 -127.3 535.1943 1 26.10 1 7029 AEV 2_3_RA2_01_1224.d 3.35E4 1 1 239 243 Acetylation (N-term)
R.GAPPPSS(+21.98) Y 20.53 633.2734 7 -30.9 634.2611 1 82.00 1 43401 AEV 2_3_RA2_01_1224.d 3.51E4 1 1 246 252 Sodium adduct
R.G(+42.01)GFGR(+14.02)GRGAPPPSS Y 20.52 1354.6742 14 27.8 678.3632 2 34.17 3 15818 AEV_3_3_RA3_01_1233.d 8.45E5 2 2 239 252 Acetylation (N-term); Methylation(KR)
R.S(-18.01)HAPPR.G Y 20.27 645.3347 6 -61.1 646.3025 1 96.43 1 54047 AEV 2_3_RA2_01_1224.d 0 1 1 184 189 Dehydration
R.GAP(+31.99)PPSS(+79.97) Y 19.74 723.2476 7 82.8 724.3148 1 76.01 1 38671 AEV 2_3_RA2_01_1224.d 6.59E4 1 1 246 252 Dihydroxy; Phosphorylation (STY)
R.ERRPGGR(+14.02)GGPR.G Y 19.69 1207.6646 11 10.1 302.9265 4 12.10 2 3258 AEV_1_3_RA2_01_1232.d 2.32E5 1 1 198 208 Methylation(KR)
R.RPGGR(+14.02)GGPRGDR.G Y 19.65 1250.6704 12 0.1 626.3425 2 10.59 3 2811 AEV_3_3_RA3_01_1233.d 1.78E4 1 1 200 211 Methylation(KR)
R.ERRPGGR(+28.03)GGPR.G Y 19.58 1221.6802 11 4.2 306.4286 4 11.14 3 3090 AEV_3_3_RA3_01_1233.d 1.11E6 2 2 198 208 Dimethylation(KR)
K.E(+42.01)GGAPGDFAP(+31.99)SFR.G Y 19.28 1380.5945 13 -56.7 691.2654 2 63.36 1 29056 AEV 2_3_RA2_01_1224.d 1.09E5 1 1 226 238 Acetylation (N-term); Dihydroxy
R.RP(+31.99)GGR(+14.02)GGPRGDR.G Y 19.18 1282.6602 12 -18.4 321.6664 4 17.47 3 6463 AEV_3_3_RA3_01_1233.d 7.13E4 1 1 200 211 Dihydroxy; Methylation(KR)
K.IHEYLFREGVLVAKK.D Y 19.06 1801.0250 15 1.0 361.2126 5 69.71 2 32633 AEV_1_3_RA2_01_1232.d 6.4E4 1 1 98 112
R.GDRGEGGYR(+14.02).R Y 19.01 979.4471 9 -84.1 490.6897 2 30.66 1 9312 AEV 2_3_RA2_01_1224.d 7.24E4 1 1 209 217 Methylation(KR)
K.RFPELRLELAT(+79.97)MLIPK.A Y 18.95 2006.0787 16 -8.4 402.2196 5 53.31 3 27919 AEV_3_3_RA3_01_1233.d 8.34E4 1 1 77 92 Phosphorylation (STY)
R.K(+42.01)(+42.01)K(+42.01)IHEYLFR.E Y 18.82 1358.7346 9 3.4 340.6921 4 60.00 3 32420 AEV_3_3_RA3_01_1233.d 1.42E5 1 1 96 104 Acetylation (N-term); Acetylation (K)
R.GGFGR(-.98).G Y 18.68 491.2604 5 -63.7 492.2364 1 77.57 1 39905 AEV 2_3_RA2_01_1224.d 9.05E4 1 1 239 243 Amidation
K.K(+14.02)IHEY(-18.01)LFR.E Y 18.66 1100.6130 8 18.2 367.8849 3 58.02 2 24650 AEV_1_3_RA2_01_1232.d 1.29E5 1 1 97 104 Methylation(KR); Dehydration
R.GMMGGEER.E Y 18.64 865.3422 8 15.7 433.6852 2 21.86 3 8828 AEV_3_3_RA3_01_1233.d 5.73E4 1 1 190 197
R.GGFGRGRGAPPPSS(-18.01) Y 18.44 1280.6373 14 -4.2 641.3232 2 69.01 2 32107 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 239 252 Dehydration
K.N(+43.01)(+.98)LYVIK.A Y 18.35 792.4381 6 -14.4 397.2206 2 56.30 3 29718 AEV_3_3_RA3_01_1233.d 2.38E5 1 1 126 131 Carbamylation; Deamidation (NQ)
R.SHAP(+31.99)PR.G Y 18.23 695.3351 6 -14.0 696.3326 1 38.41 3 18449 AEV_3_3_RA3_01_1233.d 3.45E4 1 1 184 189 Dihydroxy
R.GGFGR(+14.02)GR(+28.03)GAPPPSS Y 17.94 1340.6948 14 0.1 447.9056 3 32.33 3 14808 AEV_3_3_RA3_01_1233.d 1.65E6 1 1 239 252 Methylation(KR); Dimethylation(KR)
K.HGDIDT(-18.01)KNLYVIK.A Y 17.53 1496.7987 13 -64.2 375.1829 4 72.49 1 35895 AEV 2_3_RA2_01_1224.d 0 1 1 119 131 Dehydration
R.GR(+14.02)GAPPPSS Y 17.32 838.4297 9 1.6 420.2228 2 15.61 3 5466 AEV_3_3_RA3_01_1233.d 0 1 1 244 252 Methylation(KR)
R.GDRGEGGYRRR.E Y 17.05 1277.6337 11 4.2 426.8870 3 9.81 3 2467 AEV_3_3_RA3_01_1233.d 6.14E4 1 1 209 219
R.EQ(+.98)GEGK(-.98).E Y 17.03 646.2922 6 -92.9 647.2394 1 43.27 1 16292 AEV 2_3_RA2_01_1224.d 0 1 1 220 225 Deamidation (NQ); Amidation
R.GGFGR(+28.03).G Y 17.01 520.2758 5 9.8 521.2881 1 57.93 2 24599 AEV_1_3_RA2_01_1232.d 0 1 1 239 243 Dimethylation(KR)
K.AC(+57.02)Q(+.98)SLTSR(+14.02).G Y 16.87 936.4335 8 18.0 469.2324 2 25.17 2 8564 AEV_1_3_RA2_01_1232.d 0 1 1 132 139 Carbamidomethylation; Deamidation (NQ); Methylation(KR)
R.RPGGR(+28.03)GGPRGDRGEGGYR.R Y 16.76 1883.9574 18 1.9 377.7995 5 18.84 3 7207 AEV_3_3_RA3_01_1233.d 6.54E5 1 1 200 217 Dimethylation(KR)
R.R(+42.01)PGGR(+28.03)GGPR.G Y 16.50 978.5471 9 -46.1 327.1746 3 9.98 3 2619 AEV_3_3_RA3_01_1233.d 2.63E4 1 1 200 208 Acetylation (N-term); Dimethylation(KR)
R.G(+56.06)GFGRGRGAPPPSS Y 16.08 1354.7106 14 1.2 452.5780 3 34.26 3 15878 AEV_3_3_RA3_01_1233.d 2.8E6 1 1 239 252 Diethylation
K.HGDIDTKNLYVIK(+42.01).A Y 16.01 1556.8198 13 13.1 390.2173 4 62.60 2 27610 AEV_1_3_RA2_01_1232.d 0 1 1 119 131 Acetylation (K)
K.A(+42.01)CQSLTSR.G Y 15.92 906.4229 8 -51.1 454.1956 2 46.82 1 18368 AEV 2_3_RA2_01_1224.d 7.75E4 1 1 132 139 Acetylation (N-term)
R.E(-18.01)GVLVAKK.D Y 15.88 824.5120 8 -137.0 413.2068 2 37.66 1 13129 AEV 2_3_RA2_01_1224.d 0 1 1 105 112 Pyro-glu from E
R.SHAPPRGMM(+15.99)GGEER.E Y 15.86 1526.6718 14 64.5 382.6998 4 9.70 3 2422 AEV_3_3_RA3_01_1233.d 7.12E3 1 1 184 197 Oxidation (M)
R.GRGAPPPS(-18.01)S Y 15.85 806.4034 9 26.4 404.2196 2 9.71 3 2427 AEV_3_3_RA3_01_1233.d 0 1 1 244 252 Dehydration
K.EGGAPGDFAPSFRGGFGR(+79.97).G Y 15.69 1860.7944 18 -9.2 621.2664 3 69.12 1 33276 AEV 2_3_RA2_01_1224.d 1.3E5 1 1 226 243 Phosphorylation (HCDR)
K.D(+43.01)FNLPK.H Y 15.67 775.3864 6 -76.3 776.3345 1 22.63 1 5602 AEV 2_3_RA2_01_1224.d 0 1 1 113 118 Carbamylation
R.G(+42.01)DRGEGGY(+79.97)R(+14.02).R Y 15.55 1101.4241 9 6.7 551.7230 2 43.03 1 16167 AEV 2_3_RA2_01_1224.d 5.79E4 1 1 209 217 Acetylation (N-term); Phosphorylation (STY); Methylation(KR)
R.S(+42.01)HAPPR.G Y 15.30 705.3558 6 27.3 353.6948 2 37.61 3 17960 AEV_3_3_RA3_01_1233.d 3.55E5 1 1 184 189 Acetylation (N-term)
K.RFPELRLELATMLIPK.A Y 15.06 1926.1124 16 -10.8 386.2256 5 66.22 2 30108 AEV_1_3_RA2_01_1232.d 0 1 1 77 92
R.L(+42.01)ELATM(+15.99)LIPKADR.K Y 15.02 1527.8330 13 -27.3 764.9029 2 80.12 3 48164 AEV_3_3_RA3_01_1233.d 7.59E4 1 1 83 95 Acetylation (N-term); Oxidation (M)
total 109 peptides
C1G6U5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.MSSTFVGNSTSIQELFKR.V Y 127.31 2031.0095 18 5.5 678.0142 3 79.70 2 40323 AEV_1_3_RA2_01_1232.d 3.37E5 3 3 383 400
K.GHYTEGAELVDQVIDVVRR.E Y 114.25 2155.1021 19 -0.8 539.7823 4 81.58 3 49270 AEV_3_3_RA3_01_1233.d 5.28E5 3 3 124 142
K.M(+15.99)SSTFVGNSTSIQELFKR.V Y 114.17 2047.0044 18 1.9 683.3434 3 78.33 2 39300 AEV_1_3_RA2_01_1232.d 8.53E5 4 4 383 400 Oxidation (M)
K.M(+15.99)SSTFVGNSTSIQELFK.R Y 107.25 1890.9033 17 -2.7 946.4564 2 81.23 3 49013 AEV_3_3_RA3_01_1233.d 2.42E5 2 2 383 399 Oxidation (M)
R.LHFFMVGFAPLTSR.G Y 103.49 1621.8439 14 4.0 541.6241 3 85.46 2 44628 AEV_1_3_RA2_01_1232.d 5.11E5 5 5 283 296
R.AGPFGELFRPDNFVFGQSGAGNNWAK.G Y 98.23 2782.3252 26 3.0 928.4518 3 86.73 3 52823 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 98 123
R.YLTC(+57.02)SAIFR.G Y 91.71 1129.5590 9 -1.3 565.7860 2 70.71 3 40826 AEV_3_3_RA3_01_1233.d 8.64E5 3 3 330 338 Carbamidomethylation
R.AVTVPELSQQMFDPK.N Y 91.40 1688.8444 15 2.9 845.4319 2 80.36 2 40847 AEV_1_3_RA2_01_1232.d 6.13E5 4 4 303 317
K.MSSTFVGNSTSIQELFK.R Y 89.79 1874.9084 17 0.8 938.4622 2 82.74 3 50120 AEV_3_3_RA3_01_1233.d 3.46E5 3 3 383 399
K.LAVNMVPFPR.L Y 76.70 1142.6270 10 0.9 572.3213 2 78.63 2 39532 AEV_1_3_RA2_01_1232.d 2.37E5 2 2 273 282
R.VGDQFTAMFR.R Y 75.16 1170.5492 10 1.8 586.2829 2 76.76 3 45510 AEV_3_3_RA3_01_1233.d 1.9E5 2 2 401 410
R.AVLVDLEPGTM(+15.99)DAVR.A Y 70.45 1600.8130 15 -3.6 801.4109 2 74.65 3 43860 AEV_3_3_RA3_01_1233.d 1.62E5 2 2 83 97 Oxidation (M)
R.MNVYFNEASGK.K Y 69.33 1258.5652 11 -0.4 630.2896 2 63.00 3 34742 AEV_3_3_RA3_01_1233.d 1E5 2 2 67 77
R.AVLVDLEPGTMDAVR.A Y 64.90 1584.8181 15 -2.9 793.4141 2 79.39 2 40076 AEV_1_3_RA2_01_1232.d 1.42E5 2 2 83 97
R.LHFFM(+15.99)VGFAPLTSR.G Y 64.26 1637.8387 14 8.9 546.9584 3 82.68 2 42643 AEV_1_3_RA2_01_1232.d 6.69E4 2 2 283 296 Oxidation (M)
R.VGDQFTAM(+15.99)FR.R Y 61.60 1186.5441 10 13.4 594.2872 2 68.03 2 31379 AEV_1_3_RA2_01_1232.d 5.12E4 1 1 401 410 Oxidation (M)
R.AGPFGELFRPDN(+.98)FVFGQSGAGNNWAK.G Y 58.94 2783.3091 26 -8.3 928.7692 3 86.56 3 52751 AEV_3_3_RA3_01_1233.d 0 1 1 98 123 Deamidation (NQ)
R.MMATFSVVPSPK.V Y 57.89 1293.6461 12 10.5 647.8372 2 74.96 3 44088 AEV_3_3_RA3_01_1233.d 9.85E4 1 1 183 194
R.MNVYFNEASGKK.Y Y 50.06 1386.6602 12 -4.8 694.3340 2 52.70 3 27523 AEV_3_3_RA3_01_1233.d 5.47E4 2 2 67 78
R.M(+15.99)NVYFNEASGK.K Y 49.22 1274.5601 11 7.9 638.2924 2 53.79 2 22384 AEV_1_3_RA2_01_1232.d 1.33E5 4 4 67 77 Oxidation (M)
R.AVTVPELSQQM(+15.99)FDPK.N Y 48.65 1704.8392 15 -5.4 853.4223 2 74.65 3 43866 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 303 317 Oxidation (M)
R.FPGQLNSDLRK.L Y 48.02 1273.6779 11 -8.4 425.5630 3 57.84 3 30840 AEV_3_3_RA3_01_1233.d 9.28E5 3 3 262 272
K.LAVNM(+15.99)VPFPR.L Y 42.91 1158.6219 10 -5.1 580.3153 2 72.45 3 42156 AEV_3_3_RA3_01_1233.d 1.55E5 1 1 273 282 Oxidation (M)
R.GAYSFR.A Y 38.37 699.3340 6 1.4 350.6748 2 34.18 3 15820 AEV_3_3_RA3_01_1233.d 1.21E6 8 8 297 302
R.VGDQFTAMFRR.K Y 35.02 1326.6503 11 -0.1 443.2240 3 71.77 2 34173 AEV_1_3_RA2_01_1232.d 2.52E5 3 3 401 411
K.IREEFPDR.M Y 28.97 1060.5302 8 6.0 531.2755 2 38.47 3 18483 AEV_3_3_RA3_01_1233.d 2.26E5 2 2 175 182
K.LSEPSYGDLNHLVSAVMSGVTTC(+57.02)LR.F Y 28.94 2705.3152 25 4.2 902.7828 3 92.18 2 48245 AEV_1_3_RA2_01_1232.d 1.13E5 2 2 237 261 Carbamidomethylation
K.VSM(+15.99)KEVEDQM(+15.99)R.N Y 28.55 1382.6169 11 7.7 461.8831 3 20.77 3 8228 AEV_3_3_RA3_01_1233.d 2.29E5 1 1 341 351 Oxidation (M)
R.N(+.98)VQNK.N Y 25.74 602.3024 5 27.9 603.3265 1 65.44 2 29558 AEV_1_3_RA2_01_1232.d 4.74E4 1 1 352 356 Deamidation (NQ)
K.RVGDQFTAMFR.R Y 25.73 1326.6503 11 6.3 443.2268 3 73.21 3 42754 AEV_3_3_RA3_01_1233.d 7.49E4 2 2 400 410
R.NVQNK(-.98).N Y 24.56 600.3344 5 -165.2 601.2424 1 37.10 1 12768 AEV 2_3_RA2_01_1224.d 2.55E4 1 1 352 356 Amidation
R.L(+43.01)HFFMVGFAPLTSR.G Y 23.35 1664.8497 14 -5.6 555.9541 3 52.50 3 27375 AEV_3_3_RA3_01_1233.d 1.39E5 1 1 283 296 Carbamylation
R.VGDQFT(-18.01)AMFR.R Y 22.80 1152.5386 10 -30.7 385.1750 3 37.60 1 13050 AEV 2_3_RA2_01_1224.d 0 1 1 401 410 Dehydration
R.N(+42.01)VQNK.N Y 22.17 643.3289 5 12.8 644.3444 1 42.72 2 16820 AEV_1_3_RA2_01_1232.d 0 1 1 352 356 Acetylation (N-term)
K.NM(+15.99)M(+15.99)AASDFR.N Y 22.03 1073.4270 9 -13.1 1074.4202 1 99.33 1 55448 AEV 2_3_RA2_01_1224.d 1.86E4 1 1 318 326 Oxidation (M)
R.FPGQLN(+203.08)SDLR.K Y 19.72 1348.6622 10 26.2 675.3561 2 62.72 2 27693 AEV_1_3_RA2_01_1232.d 4.22E4 1 1 262 271 HexNAcylation (N)
R.V(+42.01)GDQFT(+79.97)AMFR.R Y 18.60 1292.5260 10 58.4 431.8745 3 79.23 1 41229 AEV 2_3_RA2_01_1224.d 9.11E4 1 1 401 410 Acetylation (N-term); Phosphorylation (STY)
R.F(+87.03)PGQLNSDLR.K Y 17.27 1232.6149 10 -10.5 309.1577 4 53.58 1 22287 AEV 2_3_RA2_01_1224.d 0 1 1 262 271 Glycidamide adduct
R.NGRYLTC(+57.02)SAIFRGK(+42.01)VS(+79.97)MK.E Y 17.14 2209.0537 18 10.9 553.2767 4 72.78 3 42409 AEV_3_3_RA3_01_1233.d 6.38E4 1 1 327 344 Carbamidomethylation; Acetylation (K); Phosphorylation (STY)
R.MNVY(+77.99)FNEASGK.K Y 17.01 1336.5522 11 -49.4 669.2504 2 46.93 1 18429 AEV 2_3_RA2_01_1224.d 0 1 1 67 77 Methylphosphonylation
R.AVTVP(-27.99)ELSQQMFDPK.N Y 16.91 1660.8494 15 -3.7 416.2181 4 40.98 2 15932 AEV_1_3_RA2_01_1232.d 1.04E5 1 1 303 317 Pyrrolidone from Proline
K.K(+42.01)(+31.99)YVPRAVLVDLEPGTMDAVR.A Y 16.49 2302.1990 20 -13.4 768.3967 3 82.21 3 49747 AEV_3_3_RA3_01_1233.d 0 1 1 78 97 Acetylation (N-term); Dihydroxy
R.K(+14.02)LAVN(+.98)MVPFPR.L Y 15.99 1285.7217 11 10.2 322.4410 4 63.55 2 28261 AEV_1_3_RA2_01_1232.d 6.1E4 1 1 272 282 Methylation(KR); Deamidation (NQ)
K.GHYT(+14.02)EGAELVDQVIDVVRR.E Y 15.38 2169.1177 19 6.7 543.2903 4 82.85 3 50206 AEV_3_3_RA3_01_1233.d 5.79E4 1 1 124 142 Methylation(others)
R.MM(+15.99)ATFSVVPSPK.V Y 15.37 1309.6410 12 4.7 655.8309 2 70.34 3 40497 AEV_3_3_RA3_01_1233.d 9.23E4 1 1 183 194 Oxidation (M)
R.L(+42.01)HFFMVGFAPLTSR.G Y 15.35 1663.8545 14 2.2 555.6266 3 50.55 2 20772 AEV_1_3_RA2_01_1232.d 3.64E5 1 1 283 296 Acetylation (N-term)
K.EVEDQMR(+14.02)NVQNK.N Y 15.06 1502.7147 12 -2.2 376.6851 4 55.27 1 23334 AEV 2_3_RA2_01_1224.d 6.68E5 1 1 345 356 Methylation(KR)
total 47 peptides
C1GCX5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AVFDALGSPMSNKYSEGYPGAR.Y Y 129.28 2316.0845 22 3.6 773.0382 3 76.61 2 37868 AEV_1_3_RA2_01_1232.d 1.98E5 2 2 52 73
R.YYGGNQHIDAIELTC(+57.02)QR.R Y 109.18 2036.9374 17 -1.9 679.9851 3 67.93 3 38625 AEV_3_3_RA3_01_1233.d 2.47E5 2 2 74 90 Carbamidomethylation
K.ISAVSTYFETFPYQVDLQTGIIDYDTLAK.N Y 106.93 3297.6333 29 2.0 1649.8271 2 93.39 3 56502 AEV_3_3_RA3_01_1233.d 3.61E5 4 4 152 180
R.IANFIDKAINIC(+57.02)K.S Y 91.88 1518.8228 13 2.1 507.2826 3 75.91 2 37322 AEV_1_3_RA2_01_1232.d 3.29E5 2 2 413 425 Carbamidomethylation
R.AVFDALGSPM(+15.99)SNKYSEGYPGAR.Y Y 87.41 2332.0793 22 6.3 778.3719 3 71.84 3 41678 AEV_3_3_RA3_01_1233.d 0 2 2 52 73 Oxidation (M)
K.C(+57.02)LVAGTSAYC(+57.02)R.L Y 81.58 1256.5642 11 6.3 629.2933 2 57.22 2 24220 AEV_1_3_RA2_01_1232.d 2.38E5 3 3 189 199 Carbamidomethylation
K.KISAVSTYFETFPYQVDLQTGIIDYDTLAK.N Y 79.36 3425.7283 30 1.2 1142.9181 3 89.92 3 54672 AEV_3_3_RA3_01_1233.d 4.52E4 1 1 151 180
K.YSEGYPGAR.Y N 76.58 998.4457 9 0.5 500.2304 2 33.08 3 15195 AEV_3_3_RA3_01_1233.d 7.34E5 6 6 65 73
K.Q(-17.03)ANTPEFKQYQEQVLK.N Y 75.24 1932.9581 16 -2.5 967.4839 2 73.29 3 42818 AEV_3_3_RA3_01_1233.d 1.09E4 1 1 310 325 Pyro-glu from Q
K.DIAEWASTFPLPV Y 74.10 1444.7238 13 -0.9 723.3685 2 97.63 3 58261 AEV_3_3_RA3_01_1233.d 2.85E5 3 3 459 471
K.VASETVPEILTLRK.D Y 65.86 1554.8981 14 -1.4 519.3059 3 73.35 2 35444 AEV_1_3_RA2_01_1232.d 2.53E5 2 2 445 458
K.ALEHEFKK.L Y 54.64 1000.5341 8 18.0 501.2833 2 18.71 3 7145 AEV_3_3_RA3_01_1233.d 0 1 1 329 336
R.IGAPAMTSR.G Y 51.42 902.4644 9 -1.4 452.2388 2 40.73 3 19827 AEV_3_3_RA3_01_1233.d 1.24E6 5 5 395 403
R.VEAVLEQINIAC(+57.02)NK.N Y 46.61 1599.8290 14 3.0 534.2852 3 75.38 3 44465 AEV_3_3_RA3_01_1233.d 6.52E5 2 2 365 378 Carbamidomethylation
R.YYGGNQHIDAIELTC(+57.02)QRR.A Y 44.99 2193.0386 18 11.3 732.0284 3 64.12 3 35595 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 74 91 Carbamidomethylation
K.SALSPGGIR.I Y 43.68 856.4766 9 2.0 429.2465 2 42.93 3 21240 AEV_3_3_RA3_01_1233.d 1.04E6 7 7 386 394
K.NSIPGDKSALSPGGIR.I Y 38.53 1567.8318 16 0.2 523.6180 3 60.86 2 26436 AEV_1_3_RA2_01_1232.d 7.09E4 1 1 379 394
K.SVQSELPK.N Y 38.11 886.4760 8 -27.6 444.2330 2 39.00 3 18798 AEV_3_3_RA3_01_1233.d 3.38E5 5 5 426 433
R.VEAVLEQINIAC(+57.02)NKNSIPGDK.S Y 34.94 2311.1841 21 -20.4 771.3862 3 74.82 3 43991 AEV_3_3_RA3_01_1233.d 3.23E4 1 1 365 385 Carbamidomethylation
R.GAMIFFR.K N 34.05 840.4316 7 3.4 421.2245 2 75.50 2 36995 AEV_1_3_RA2_01_1232.d 1.18E5 1 1 256 262
K.ISAVSTYFETFPYQVDLQTGIIDYDTLAKNAK.L Y 33.82 3610.8081 32 -1.4 903.7080 4 90.62 3 55055 AEV_3_3_RA3_01_1233.d 4.15E4 1 1 152 183
R.ESVVLIASENFTSR.A Y 32.98 1550.7939 14 -25.4 776.3846 2 78.50 2 39369 AEV_1_3_RA2_01_1232.d 0 1 1 38 51
K.LVSDGTDSHMVLLDLTPK.A Y 32.64 1939.9924 18 -26.9 647.6541 3 79.25 3 47485 AEV_3_3_RA3_01_1233.d 2.33E5 1 1 341 358
K.QYQEQVLK.N Y 30.59 1034.5397 8 -4.4 518.2748 2 39.62 3 19166 AEV_3_3_RA3_01_1233.d 3.96E5 2 2 318 325
K.SLVESDPEVAEIMR.K Y 25.92 1573.7657 14 -14.5 787.8787 2 77.31 3 45955 AEV_3_3_RA3_01_1233.d 0 1 1 17 30
R.IANFIDK.A Y 25.38 819.4490 7 -3.5 410.7304 2 55.16 3 29046 AEV_3_3_RA3_01_1233.d 1.4E5 1 1 413 419
R.IGAPAM(+15.99)TSR.G Y 22.53 918.4593 9 15.1 460.2438 2 23.02 3 9453 AEV_3_3_RA3_01_1233.d 0 1 1 395 403 Oxidation (M)
K.QANTPEFK.Q Y 21.78 933.4556 8 -49.8 312.1436 3 70.00 1 33956 AEV 2_3_RA2_01_1224.d 2.35E4 1 1 310 317
K.ISAVSTYFET(+13.03)FPYQVDLQTGIIDYDTLAK.N Y 21.70 3310.6648 29 -3.3 1104.5586 3 94.38 3 56956 AEV_3_3_RA3_01_1233.d 1.09E5 1 1 152 180 Michael addition with methylamine
R.A(+42.01)VFDALGSPMSN(+.98)K(+14.02)YSEGYPGAR.Y Y 19.26 2373.0947 22 6.7 594.2849 4 66.76 3 37664 AEV_3_3_RA3_01_1233.d 1.99E5 1 1 52 73 Acetylation (N-term); Deamidation (NQ); Methylation(KR)
K.ALDGAR.V Y 18.94 601.3184 6 -105.3 602.2623 1 42.83 1 16059 AEV 2_3_RA2_01_1224.d 2.02E4 1 1 359 364
R.AVFDALGSPMSNK.Y Y 18.72 1335.6493 13 30.5 446.2373 3 68.63 3 39160 AEV_3_3_RA3_01_1233.d 0 2 2 52 64
K.LDSSK.W N 18.33 548.2806 5 -96.6 549.2349 1 75.67 1 38408 AEV 2_3_RA2_01_1224.d 0 2 2 98 102
R.LIDYKR.M Y 16.55 806.4650 6 -1.2 404.2393 2 25.89 3 11075 AEV_3_3_RA3_01_1233.d 1.41E5 1 1 200 205
R.EQLEK.S N 16.43 645.3333 5 -20.1 646.3276 1 70.72 3 40796 AEV_3_3_RA3_01_1233.d 2.75E4 1 1 12 16
K.SLRGPR.G Y 15.66 684.4031 6 -25.1 685.3932 1 50.76 2 20836 AEV_1_3_RA2_01_1232.d 0 1 1 250 255
K.LYRPK.C Y 15.63 675.4067 5 -8.0 338.7079 2 15.03 2 4349 AEV_1_3_RA2_01_1232.d 4.13E5 1 1 184 188
total 37 peptides
C1GBM4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.DKSNGQSVPIGIHPSK.V Y 98.25 1662.8689 16 4.6 555.2994 3 46.50 2 18715 AEV_1_3_RA2_01_1232.d 1.95E6 12 12 88 103
K.SNGQSVPIGIHPSKVVITK.L Y 96.14 1960.1105 19 -23.8 654.3619 3 63.40 3 35042 AEV_3_3_RA3_01_1233.d 6.25E5 4 4 90 108
K.LKIDKDRESILER.M Y 95.72 1613.9100 13 0.3 404.4849 4 54.15 3 28478 AEV_3_3_RA3_01_1233.d 5.39E6 10 10 109 121
R.KAHFSAPSSER.R Y 92.50 1215.5996 11 1.8 608.8082 2 18.06 3 6789 AEV_3_3_RA3_01_1233.d 3.7E6 14 14 17 27
R.SIPIRKDDEVTIIR.G Y 91.99 1653.9413 14 -2.5 552.3196 3 62.49 3 34360 AEV_3_3_RA3_01_1233.d 1.04E7 12 12 47 60
K.SNGQSVPIGIHPSK.V Y 91.71 1419.7469 14 3.7 474.2580 3 50.82 2 20855 AEV_1_3_RA2_01_1232.d 1.56E6 8 8 90 103
K.AHFSAPSSER.R Y 89.69 1087.5046 10 2.9 544.7612 2 23.87 3 9977 AEV_3_3_RA3_01_1233.d 2.35E6 9 9 18 27
R.KAHFSAPSSERR.V Y 89.50 1371.7007 12 3.0 458.2422 3 15.91 3 5609 AEV_3_3_RA3_01_1233.d 5.02E6 13 13 17 28
K.SN(-17.03)GQSVPIGIHPSK.V Y 89.21 1402.7205 14 1.7 702.3687 2 62.39 2 27491 AEV_1_3_RA2_01_1232.d 1.75E6 3 3 90 103 Ammonia-loss (N)
R.DKSNGQSVPIGIHPSKVVITK.L Y 86.82 2203.2324 21 4.3 441.6556 5 61.88 3 33898 AEV_3_3_RA3_01_1233.d 5.49E5 3 3 88 108
K.AHFSAPSSERR.V Y 84.78 1243.6057 11 1.0 415.5429 3 19.00 3 7333 AEV_3_3_RA3_01_1233.d 2.68E6 12 12 18 28
R.DKSN(+.98)GQSVPIGIHPSK.V Y 84.69 1663.8529 16 -1.4 555.6241 3 48.66 3 24908 AEV_3_3_RA3_01_1233.d 1.64E6 6 6 88 103 Deamidation (NQ)
M.AKINSDLASSR.R Y 79.61 1160.6149 11 0.7 581.3151 2 27.41 3 11909 AEV_3_3_RA3_01_1233.d 1.22E7 15 15 2 12
K.SN(-17.03)GQSVPIGIHPSKVVITK.L Y 79.26 1943.0840 19 -12.5 972.5372 2 68.69 3 39207 AEV_3_3_RA3_01_1233.d 6.46E4 2 2 90 108 Ammonia-loss (N)
K.YVVHVER.V Y 78.80 900.4818 7 4.2 451.2500 2 33.81 2 12498 AEV_1_3_RA2_01_1232.d 3.87E6 13 13 78 84
K.S(-18.01)NGQ(+.98)SVPIGIHPSKVVITK.L Y 77.99 1943.0840 19 -6.9 648.6974 3 69.47 2 32448 AEV_1_3_RA2_01_1232.d 2.99E5 1 1 90 108 Dehydration; Deamidation (NQ)
K.DDEVTIIR.G Y 77.88 959.4924 8 -2.2 480.7524 2 61.03 3 33253 AEV_3_3_RA3_01_1233.d 1.69E6 5 5 53 60
R.RVIMSAPLSK.E Y 77.14 1100.6376 10 -8.5 551.3214 2 51.49 3 26736 AEV_3_3_RA3_01_1233.d 2.26E6 9 9 28 37
R.EGKITSVYR.L Y 74.82 1051.5662 9 -0.4 526.7902 2 30.96 3 13971 AEV_3_3_RA3_01_1233.d 3.73E6 14 14 67 75
R.LKYVVHVER.V Y 72.33 1141.6608 9 -4.7 571.8350 2 46.13 2 18528 AEV_1_3_RA2_01_1232.d 2.11E6 7 7 76 84
K.AHFSAPSSER(+14.02).R Y 69.63 1101.5203 10 4.7 551.7700 2 32.36 3 14793 AEV_3_3_RA3_01_1233.d 2.41E5 3 3 18 27 Methylation(KR)
R.VIM(+15.99)SAPLSK.E Y 67.35 960.5314 9 2.1 481.2740 2 39.35 3 19007 AEV_3_3_RA3_01_1233.d 2.37E6 22 22 29 37 Oxidation (M)
R.SIPIRK(+14.02)DDEVTIIR.G Y 66.97 1667.9569 14 -4.2 417.9948 4 64.93 3 36244 AEV_3_3_RA3_01_1233.d 2.51E5 2 2 47 60 Methylation(KR)
R.VIMSAPLSK.E Y 66.57 944.5365 9 -1.7 473.2747 2 59.06 3 31712 AEV_3_3_RA3_01_1233.d 2.99E6 7 7 29 37
K.SN(+.98)GQSVPIGIHPSKVVITK.L Y 66.00 1961.0945 19 -16.5 654.6946 3 66.85 2 30547 AEV_1_3_RA2_01_1232.d 0 1 1 90 108 Deamidation (NQ)
K.INSDLASSR.R Y 64.49 961.4828 9 3.1 481.7502 2 30.71 2 11029 AEV_1_3_RA2_01_1232.d 1.51E6 6 6 4 12
K.IDKDRESILER.M Y 64.14 1372.7310 11 0.8 458.5846 3 38.43 3 18505 AEV_3_3_RA3_01_1233.d 1.99E6 3 3 111 121
R.KDDEVTIIR.G Y 63.76 1087.5873 9 0.4 544.8011 2 43.12 3 21363 AEV_3_3_RA3_01_1233.d 1.03E6 6 6 52 60
M.AKINSDLASSRR.K Y 62.73 1316.7161 12 5.8 439.9152 3 24.66 2 8360 AEV_1_3_RA2_01_1232.d 1.34E6 6 6 2 13
R.RVIM(+15.99)SAPLSK.E Y 61.64 1116.6324 10 6.9 373.2206 3 38.84 2 14912 AEV_1_3_RA2_01_1232.d 6.75E5 9 9 28 37 Oxidation (M)
R.SIPIRKDDE(+14.02)VTIIR.G Y 59.50 1667.9569 14 -2.2 556.9917 3 65.63 3 36776 AEV_3_3_RA3_01_1233.d 9.46E5 2 2 47 60 Methylation(others)
R.KAHFSAPSSER(+14.02).R Y 58.85 1229.6152 11 -0.9 410.8787 3 25.01 3 10629 AEV_3_3_RA3_01_1233.d 6.21E5 3 3 17 27 Methylation(KR)
K.SNGQSVPIGIHPSK(+14.02).V Y 57.78 1433.7627 14 2.8 478.9295 3 52.40 3 27309 AEV_3_3_RA3_01_1233.d 1.88E5 1 1 90 103 Methylation(KR)
K.SNGQ(+.98)SVPIGIHPSK.V Y 57.60 1420.7310 14 -25.5 711.3546 2 52.38 3 27298 AEV_3_3_RA3_01_1233.d 0 1 1 90 103 Deamidation (NQ)
R.SIPIR(+.98)KDDEVTIIR.G Y 55.39 1654.9253 14 9.8 552.6544 3 62.72 3 34519 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 47 60 Deamidation (R)
K.ELREKHNVR.S Y 54.06 1179.6472 9 4.4 590.8335 2 11.42 3 3206 AEV_3_3_RA3_01_1233.d 1.07E5 2 2 38 46
M.AKINSDLASSR(+14.02).R Y 53.67 1174.6306 11 -1.2 588.3219 2 36.18 3 17054 AEV_3_3_RA3_01_1233.d 3.29E6 3 3 2 12 Methylation(KR)
K.YVVHVER(+14.02).V Y 50.14 914.4974 7 7.2 458.2593 2 38.92 3 18758 AEV_3_3_RA3_01_1233.d 2.62E5 2 2 78 84 Methylation(KR)
R.VIM(-48.00)SAPLSK.E Y 47.18 896.5331 9 0.8 449.2742 2 26.71 2 9244 AEV_1_3_RA2_01_1232.d 1.63E6 3 3 29 37 Dethiomethyl
K.SN(+.98)GQSVPIGIHPSK.V Y 47.10 1420.7310 14 -8.2 711.3669 2 55.48 3 29227 AEV_3_3_RA3_01_1233.d 6.31E5 3 3 90 103 Deamidation (NQ)
K.VVITK.L N 44.80 558.3741 5 4.0 559.3836 1 17.34 2 5302 AEV_1_3_RA2_01_1232.d 4.18E4 2 2 104 108
M.A(+43.01)K(+14.02)INSDLASSR.R Y 44.30 1217.6364 11 4.5 406.8879 3 28.18 3 12350 AEV_3_3_RA3_01_1233.d 8.77E5 3 3 2 12 Carbamylation; Methylation(KR)
R.K(+42.01)AHFSAPSSER.R Y 40.82 1257.6101 11 28.5 420.2226 3 20.58 2 6650 AEV_1_3_RA2_01_1232.d 0 1 1 17 27 Acetylation (Protein N-term)
R.VIMSAPLSK(+14.02).E Y 39.92 958.5521 9 0.0 480.2834 2 63.51 2 28227 AEV_1_3_RA2_01_1232.d 2.86E5 2 2 29 37 Methylation(KR)
R.LK(+43.99)YVVHVER.V Y 38.87 1185.6506 9 -30.9 396.2119 3 42.17 3 20767 AEV_3_3_RA3_01_1233.d 7.8E4 1 1 76 84 Carboxylation (DKW)
R.EGK(+14.02)ITSVYR.L Y 38.60 1065.5818 9 1.3 356.2017 3 38.27 3 18357 AEV_3_3_RA3_01_1233.d 8.58E5 2 2 67 75 Methylation(KR)
K.INSDLASSR(+14.02).R Y 38.46 975.4985 9 1.5 488.7572 2 39.11 3 18863 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 4 12 Methylation(KR)
R.VIMSAPLSKELREK.H Y 38.45 1599.9017 14 -28.6 534.2926 3 63.43 2 28173 AEV_1_3_RA2_01_1232.d 3.13E4 1 1 29 42
K.DD(+14.02)EVTIIR.G Y 38.34 973.5080 8 1.3 487.7619 2 66.03 3 37089 AEV_3_3_RA3_01_1233.d 5.03E4 1 1 53 60 Methylation(others)
K.ITSVYR.L Y 38.04 737.4072 6 3.5 369.7122 2 29.18 2 10334 AEV_1_3_RA2_01_1232.d 2.93E6 7 7 70 75
K.AHFSAP(+13.98)SSER.R Y 36.76 1101.4839 10 -54.4 551.7192 2 52.19 1 21474 AEV 2_3_RA2_01_1224.d 1.09E5 1 1 18 27 Proline oxidation to pyroglutamic acid
M.AKIN(+.98)SDLASSR.R Y 36.60 1161.5989 11 0.5 581.8070 2 33.09 3 15201 AEV_3_3_RA3_01_1233.d 7.25E4 1 1 2 12 Deamidation (NQ)
R.EGK(+43.01)ITSVYR.L Y 35.72 1094.5720 9 -4.2 365.8631 3 33.85 2 12522 AEV_1_3_RA2_01_1232.d 3.08E4 1 1 67 75 Carbamylation
K.S(+42.01)N(+.98)GQSVPIGIHPSK.V Y 35.49 1462.7416 14 -43.7 488.5665 3 50.53 2 20748 AEV_1_3_RA2_01_1232.d 5.64E4 1 1 90 103 Acetylation (N-term); Deamidation (NQ)
R.VIMSAPLSKELR(+14.02).E Y 33.68 1356.7799 12 -7.8 453.2637 3 70.08 3 40289 AEV_3_3_RA3_01_1233.d 1.83E4 1 1 29 40 Methylation(KR)
K.S(-18.01)NGQSVPIGIHPSK.V Y 32.60 1401.7365 14 -22.3 468.2423 3 53.05 2 22047 AEV_1_3_RA2_01_1232.d 5.83E4 1 1 90 103 Dehydration
M.AKINSD(+14.02)LASSR.R Y 30.87 1174.6306 11 0.2 588.3227 2 32.02 3 14582 AEV_3_3_RA3_01_1233.d 1.33E5 2 2 2 12 Methylation(others)
R.R(+43.01)VIMSAPLSK.E Y 30.75 1143.6434 10 -26.4 382.2117 3 51.83 3 26935 AEV_3_3_RA3_01_1233.d 1.5E5 1 1 28 37 Carbamylation
K.INSDLASSRR.K Y 30.64 1117.5840 10 1.5 373.5358 3 23.24 3 9617 AEV_3_3_RA3_01_1233.d 4.27E5 1 1 4 13
K.IN(+.98)SDLASSR(+14.02).R Y 29.50 976.4825 9 -6.4 489.2454 2 39.19 3 18909 AEV_3_3_RA3_01_1233.d 0 1 1 4 12 Deamidation (NQ); Methylation(KR)
K.S(+41.03)NGQSVPIGIHPSK.V Y 28.06 1460.7736 14 -22.5 487.9208 3 48.63 3 24849 AEV_3_3_RA3_01_1233.d 1.93E4 1 1 90 103 Amidination of lysines or N-terminal amines with methyl acetimidate
R.LKYVVHVER(+14.02).V Y 27.56 1155.6764 9 -1.1 386.2323 3 49.12 3 25163 AEV_3_3_RA3_01_1233.d 3.84E5 1 1 76 84 Methylation(KR)
R.RVIM(-48.00)SAPLSK.E Y 27.32 1052.6342 10 5.3 351.8872 3 30.17 2 10775 AEV_1_3_RA2_01_1232.d 2.72E6 2 2 28 37 Dethiomethyl
R.VIM(-48.00)SAPLSKELR.E Y 27.22 1294.7609 12 1.1 432.5947 3 44.25 3 22077 AEV_3_3_RA3_01_1233.d 2.54E5 1 1 29 40 Dethiomethyl
K.Y(+120.03)VVHVERVTR.D Y 26.97 1376.7329 10 39.9 345.2042 4 41.28 3 20221 AEV_3_3_RA3_01_1233.d 0 1 1 78 87 O-Isopropylmethylphosphonylation
K.GREGKITSVYRLK.Y Y 26.23 1505.8678 13 9.9 502.9682 3 82.59 2 42571 AEV_1_3_RA2_01_1232.d 9.83E4 1 1 65 77
K.A(+226.08)HFSAPSSER.R Y 25.58 1313.5823 10 -12.8 657.7900 2 20.62 2 6666 AEV_1_3_RA2_01_1232.d 3.22E4 1 1 18 27 Biotinylation
R.EGKITSVYRLK.Y Y 23.89 1292.7452 11 -1.0 324.1933 4 46.80 3 23686 AEV_3_3_RA3_01_1233.d 1.18E5 2 2 67 77
K.LKIDKDR.E Y 23.62 886.5236 7 -1.3 444.2685 2 14.05 3 4608 AEV_3_3_RA3_01_1233.d 1.35E4 1 1 109 115
K.S(-18.01)N(+.98)GQSVPIGIHPSKVVITK.L Y 23.49 1943.0840 19 -89.5 648.6440 3 76.80 1 39293 AEV 2_3_RA2_01_1224.d 2.26E5 1 1 90 108 Dehydration; Deamidation (NQ)
R.ESILER.M Y 22.46 745.3970 6 -15.5 746.3927 1 35.46 3 16609 AEV_3_3_RA3_01_1233.d 6.11E4 1 1 116 121
K.ELREKHNVRSIPIR.K Y 19.24 1746.0012 14 -73.9 350.1817 5 56.00 2 23569 AEV_1_3_RA2_01_1232.d 0 1 1 38 51
R.RVIM(+15.99)SAPLSKELR.E Y 18.42 1514.8602 13 -3.2 379.7211 4 52.13 3 27140 AEV_3_3_RA3_01_1233.d 1.96E5 1 1 28 40 Oxidation (M)
R.V(+42.01)IM(+15.99)SAPLSK.E Y 18.40 1002.5419 9 -90.2 502.2330 2 45.26 1 17425 AEV 2_3_RA2_01_1224.d 6.19E4 1 1 29 37 Acetylation (N-term); Oxidation (M)
K.GREGKITSVYR.L Y 16.46 1264.6887 11 30.7 317.1891 4 28.92 3 12750 AEV_3_3_RA3_01_1233.d 0 1 1 65 75
R.K(+14.02)AHFS(-18.01)APSSER.R Y 15.43 1211.6046 11 6.3 404.8780 3 18.02 3 6766 AEV_3_3_RA3_01_1233.d 0 1 1 17 27 Methylation(KR); Dehydration
K.A(+163.05)HFSAPSSER.R Y 15.35 1250.5502 10 78.2 417.8899 3 20.92 2 6789 AEV_1_3_RA2_01_1232.d 3.37E5 1 1 18 27 Phenethyl isothiocyanate
total 77 peptides
A0A0A0HU84
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TGTGGGGGGGGAAAAAAAVAAR.E Y 137.39 1627.8026 22 3.3 814.9113 2 60.27 2 26084 AEV_1_3_RA2_01_1232.d 1.75E6 7 7 270 291
K.GSAEQQQQQQQQQQQQQQQQQAATR.D Y 96.30 2938.3625 25 -6.8 980.4548 3 25.98 3 11129 AEV_3_3_RA3_01_1233.d 1.04E5 3 3 99 123
K.ALSSSQSSTSNSKDKPAPATR.S Y 91.01 2119.0505 21 2.5 707.3593 3 18.32 3 6954 AEV_3_3_RA3_01_1233.d 4.81E5 5 5 22 42
K.DVGDVYATAEPGEVFHER.I Y 87.39 1989.9067 18 1.7 664.3107 3 73.81 3 43204 AEV_3_3_RA3_01_1233.d 8.37E4 1 1 587 604
R.GASFSSNLVNLLR.T Y 85.04 1376.7412 13 -15.2 689.3674 2 83.01 2 42886 AEV_1_3_RA2_01_1232.d 2.31E5 2 2 318 330
R.DKALSDIKSNFSLLER.A Y 81.99 1834.9788 16 3.6 459.7536 4 76.23 2 37574 AEV_1_3_RA2_01_1232.d 5.41E5 4 4 177 192
R.AIHPYFILVQAVSIGDLDGFVNTVQK.H Y 68.16 2843.5220 26 2.4 711.8895 4 94.14 2 49025 AEV_1_3_RA2_01_1232.d 8.46E4 2 2 481 506
K.SPSTHTAGGFYQASTK.L Y 67.24 1638.7638 16 4.9 547.2645 3 40.02 3 19413 AEV_3_3_RA3_01_1233.d 1.04E5 1 1 440 455
K.ALSSSQSSTSNSKDKPAPATR(+14.02).S Y 65.35 2133.0662 21 2.7 534.2753 4 22.70 3 9272 AEV_3_3_RA3_01_1233.d 3.72E4 1 1 22 42 Methylation(KR)
R.SIFRQPALER.A Y 63.35 1215.6724 10 -2.4 406.2304 3 61.19 3 33332 AEV_3_3_RA3_01_1233.d 3.75E5 3 3 471 480
R.LSGDPDQNRTDVAMNR.A Y 61.71 1787.8220 16 -1.0 596.9473 3 45.37 3 22804 AEV_3_3_RA3_01_1233.d 3.06E5 3 3 144 159
R.AIQLQYTEAHEHLIGATR.K Y 60.51 2050.0596 18 12.8 513.5287 4 67.47 2 30984 AEV_1_3_RA2_01_1232.d 2.11E5 2 2 421 438
K.SNFSLLER.A Y 54.47 964.4977 8 -3.4 483.2545 2 67.31 3 38169 AEV_3_3_RA3_01_1233.d 3.38E5 2 2 185 192
R.YLYYLGR.I Y 49.85 946.4912 7 2.3 474.2540 2 69.74 2 32657 AEV_1_3_RA2_01_1232.d 1.87E5 1 1 412 418
K.AIRDGVIEASLDHER.G Y 49.29 1679.8590 15 -7.7 420.9688 4 61.91 3 33902 AEV_3_3_RA3_01_1233.d 1.38E5 1 1 566 580
R.DGTFTLILR.L Y 44.76 1034.5760 9 -30.2 518.2797 2 80.43 2 40975 AEV_1_3_RA2_01_1232.d 1.3E5 2 2 514 522
R.ISLRDIC(+57.02)LR.L Y 44.47 1144.6387 9 -20.2 382.5458 3 70.71 3 40787 AEV_3_3_RA3_01_1233.d 7.75E4 3 3 542 550 Carbamidomethylation
R.KSPSTHTAGGFYQASTK.L Y 37.66 1766.8588 17 41.7 589.9847 3 34.08 2 12631 AEV_1_3_RA2_01_1232.d 6.29E4 2 2 439 455
R.LGLDSEESAEYIVAK.A Y 37.50 1622.8038 15 -3.9 812.4061 2 75.12 3 44219 AEV_3_3_RA3_01_1233.d 1.75E5 1 1 551 565
R.AVSQFDPR.F Y 36.54 918.4559 8 3.1 460.2366 2 43.24 2 17076 AEV_1_3_RA2_01_1232.d 2.42E6 8 8 193 200
R.DGGDGDEEMTVVVPPSK.S Y 33.89 1730.7668 17 -87.3 866.3152 2 71.82 1 35362 AEV 2_3_RA2_01_1224.d 8.36E4 1 1 124 140
K.LSAK(+14.02)TGT(-18.01)GGGGGGGGAAAAAAAVAAR.E Y 24.11 2023.0558 26 54.4 506.7987 4 46.49 3 23497 AEV_3_3_RA3_01_1233.d 0 1 1 266 291 Methylation(KR); Dehydration
R.ASVALAR.L Y 23.93 686.4075 7 -37.6 687.3889 1 109.78 1 58698 AEV 2_3_RA2_01_1224.d 5.15E5 1 1 925 931
K.NAQEARERER.E Y 23.88 1257.6173 10 6.0 420.2156 3 26.44 3 11386 AEV_3_3_RA3_01_1233.d 1.11E5 1 1 632 641
R.LS(-2.02)GDPDQNRTDVAMNR.A Y 23.64 1785.8064 16 48.4 596.3049 3 45.40 3 22822 AEV_3_3_RA3_01_1233.d 0 1 1 144 159 2-amino-3-oxo-butanoic_acid
R.DGVIEASLDHER.G Y 23.09 1339.6367 12 35.4 670.8494 2 92.44 1 51369 AEV 2_3_RA2_01_1224.d 1.59E5 1 1 569 580
K.GSTTSSPNNNMTADEK.H Y 22.37 1652.6948 16 3.7 827.3577 2 90.83 1 50225 AEV 2_3_RA2_01_1224.d 1.27E4 1 1 55 70
K.SDPSANGEK.A Y 22.07 903.3934 9 -24.1 904.3789 1 95.48 1 53443 AEV 2_3_RA2_01_1224.d 5.16E4 1 1 13 21
R.D(+42.01)KALSDIKSNFSLLER.A Y 21.80 1876.9894 16 -30.4 626.6514 3 78.55 3 46939 AEV_3_3_RA3_01_1233.d 1.1E5 1 1 177 192 Acetylation (N-term)
K.DKPAPATR.S Y 21.26 854.4610 8 41.0 855.5033 1 85.42 2 44617 AEV_1_3_RA2_01_1232.d 1.91E5 3 3 35 42
R.LSGDPDQNR.T Y 20.71 1000.4573 9 -4.4 501.2338 2 54.84 1 23069 AEV 2_3_RA2_01_1224.d 3.08E4 2 2 144 152
R.QPLLSALR.T Y 19.56 896.5443 8 -6.3 299.8535 3 26.71 2 9247 AEV_1_3_RA2_01_1232.d 3.14E5 1 1 371 378
M(+15.99)PAER.R Y 18.51 618.2795 5 39.3 619.3111 1 57.04 2 24127 AEV_1_3_RA2_01_1232.d 9.37E4 1 1 1 5 Oxidation (M)
R.DK(+42.01)ALSDIKSNFSLLER.A Y 18.12 1876.9894 16 -27.7 626.6531 3 78.94 2 39716 AEV_1_3_RA2_01_1232.d 1.36E5 2 2 177 192 Acetylation (K)
K.AMRFPM(+15.99)NQHR.I Y 17.97 1302.6074 10 50.8 326.6757 4 75.33 1 38141 AEV 2_3_RA2_01_1224.d 1E5 1 1 618 627 Oxidation (M)
R.GNPELGALVGR.K Y 17.87 1081.5880 11 -34.3 1082.5582 1 93.22 2 48674 AEV_1_3_RA2_01_1232.d 8.21E4 1 1 1059 1069
R.A(+27.99)SVALAR(+14.02).L Y 17.60 728.4180 7 1.6 365.2169 2 33.19 3 15252 AEV_3_3_RA3_01_1233.d 0 1 1 925 931 Formylation; Methylation(KR)
R.QIVAQSDGLEQTR.A Y 17.34 1443.7317 13 -65.2 482.2198 3 71.59 1 35172 AEV 2_3_RA2_01_1224.d 0 1 1 1082 1094
R.QPALER.A Y 17.04 712.3868 6 34.1 357.2128 2 36.06 3 16980 AEV_3_3_RA3_01_1233.d 0 2 2 475 480
K.SSRLSGDPDQNR.T Y 16.61 1330.6226 12 -23.9 333.6550 4 58.51 1 25441 AEV 2_3_RA2_01_1224.d 1.65E5 1 1 141 152
R.FPM(+15.99)NQHRIELK.N Y 16.58 1427.7344 11 0.4 357.9410 4 62.91 3 34668 AEV_3_3_RA3_01_1233.d 0 1 1 621 631 Oxidation (M)
K.GSTTSSPNNNM(+15.99)TADEK.H Y 16.52 1668.6897 16 -0.5 835.3517 2 89.50 1 49258 AEV 2_3_RA2_01_1224.d 6.62E4 1 1 55 70 Oxidation (M)
R.KDQDIQATTSSSPVR.N Y 16.33 1631.8114 15 -26.3 544.9301 3 38.06 2 14545 AEV_1_3_RA2_01_1232.d 5.29E4 1 1 384 398
R.TISSMR.K Y 16.17 693.3480 6 -23.5 694.3389 1 71.29 3 41243 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 208 213
K.K(+27.99)N(+.98)IQQLLGSGHPLLDRIAK.Y Y 15.93 2129.1956 19 10.5 533.3118 4 70.13 2 32942 AEV_1_3_RA2_01_1232.d 0 1 1 761 779 Formylation; Deamidation (NQ)
R.RSSVSANLEFGNK.M Y 15.30 1407.7106 13 -12.3 470.2383 3 40.46 2 15683 AEV_1_3_RA2_01_1232.d 5.15E5 1 1 900 912
total 46 peptides
C1GHE4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.HGYIGEFEEVDDHR.S Y 126.36 1701.7383 14 -0.1 568.2533 3 62.71 3 34508 AEV_3_3_RA3_01_1233.d 1.54E6 10 10 44 57
M.VKTSVLNDALNAINNAEK.S Y 113.96 1913.0217 18 0.3 638.6814 3 79.31 2 40007 AEV_1_3_RA2_01_1232.d 1.55E6 6 6 2 19
K.TSVLNDALNAINNAEK.S Y 111.79 1685.8584 16 4.1 843.9399 2 82.66 2 42653 AEV_1_3_RA2_01_1232.d 8.8E5 4 4 4 19
R.YNVQLRDLEK.W Y 80.78 1276.6775 10 -1.9 426.5656 3 61.69 3 33729 AEV_3_3_RA3_01_1233.d 5.65E5 5 5 79 88
K.LLPSRQFGYIVLTTSAGIMDHEEAR.R Y 76.72 2803.4326 25 7.2 701.8705 4 84.85 2 44213 AEV_1_3_RA2_01_1232.d 1.04E5 1 1 93 117
K.TSVLNDALNAINNAEK(+14.02).S Y 71.38 1699.8740 16 -2.0 850.9426 2 86.50 2 45299 AEV_1_3_RA2_01_1232.d 2.8E5 3 3 4 19 Methylation(KR)
M.VKTSVLNDALNAINNAEK(+14.02).S Y 70.21 1927.0375 18 -26.0 964.5009 2 82.51 3 49963 AEV_3_3_RA3_01_1233.d 7.34E5 5 5 2 19 Methylation(KR)
R.Q(-17.03)VLIRPSSK.V Y 69.56 1009.5920 9 -0.1 505.8032 2 56.53 3 29885 AEV_3_3_RA3_01_1233.d 1.93E6 4 4 24 32 Pyro-glu from Q
R.YNVQLRDLEKWVVK.L Y 69.41 1788.9886 14 -2.9 597.3351 3 78.72 3 47067 AEV_3_3_RA3_01_1233.d 4.91E5 3 3 79 92
K.VIGFFY Y 62.19 744.3846 6 -94.4 745.3217 1 90.61 1 50069 AEV 2_3_RA2_01_1224.d 1.15E6 1 1 125 130
M.VKTSVLNDALNAINNAEKSGKR.Q Y 59.03 2341.2712 22 -1.5 469.2608 5 75.64 3 44630 AEV_3_3_RA3_01_1233.d 2.33E5 3 3 2 23
K.IVIQLNGR.L Y 56.58 911.5552 8 -6.6 456.7819 2 61.94 3 33918 AEV_3_3_RA3_01_1233.d 8.79E5 4 4 61 68
R.QVLIRPSSK.V Y 56.56 1026.6185 9 -18.6 514.3070 2 29.05 3 12876 AEV_3_3_RA3_01_1233.d 3.09E5 5 5 24 32
R.Q(-17.03)FGYIVLTTSAGIMDHEEAR.R Y 54.98 2220.0520 20 2.0 1111.0355 2 90.55 2 47487 AEV_1_3_RA2_01_1232.d 6.67E4 1 1 98 117 Pyro-glu from Q
R.YNVQLR.D Y 54.64 791.4290 6 -86.4 396.6876 2 58.51 1 25478 AEV 2_3_RA2_01_1224.d 1.48E6 6 6 79 84
K.IVIQLN(+.98)GRLNK.T Y 52.37 1267.7612 11 1.9 423.5952 3 69.32 2 32342 AEV_1_3_RA2_01_1232.d 1.41E5 1 1 61 71 Deamidation (NQ)
M.V(+43.01)K(+14.02)TSVLNDALNAINNAEK.S Y 49.71 1970.0432 18 -2.1 657.6870 3 79.63 3 47817 AEV_3_3_RA3_01_1233.d 1.3E5 1 1 2 19 Carbamylation; Methylation(KR)
R.QFGY(-18.01)IVLTTSAGIMDHEEAR.R Y 45.28 2219.0681 20 3.2 1110.5449 2 90.34 3 54889 AEV_3_3_RA3_01_1233.d 0 1 1 98 117 Dehydration
K.TGVISPR.Y Y 42.89 728.4181 7 -3.1 365.2152 2 25.24 3 10754 AEV_3_3_RA3_01_1233.d 5.33E6 14 14 72 78
K.TSVLNDALNAINN(+.98)AEK(+226.08).S Y 42.35 1912.9200 16 -42.2 638.6204 3 88.26 1 48308 AEV 2_3_RA2_01_1224.d 1.14E5 1 1 4 19 Deamidation (NQ); Biotinylation
K.TSVLNDALNAINNAEKSGK.R Y 40.26 1958.0068 19 -10.9 653.6691 3 80.69 3 48599 AEV_3_3_RA3_01_1233.d 4.18E4 1 1 4 22
R.YNVQLRDLEKWVVKLLPSR.Q Y 39.51 2355.3425 19 5.8 472.0785 5 87.41 3 53246 AEV_3_3_RA3_01_1233.d 5.16E4 1 1 79 97
R.LNKTGVISPR.Y Y 39.42 1083.6400 10 2.7 362.2216 3 33.55 2 12377 AEV_1_3_RA2_01_1232.d 3.39E5 4 4 69 78
K.HGYIGEFEEVDDHRSGK.I Y 39.37 1973.8867 17 -86.2 494.4364 4 70.61 1 34427 AEV 2_3_RA2_01_1224.d 1.61E5 3 3 44 60
K.IVIQLN(+.98)GR.L Y 39.05 912.5392 8 -10.9 457.2719 2 66.18 2 30076 AEV_1_3_RA2_01_1232.d 0 2 2 61 68 Deamidation (NQ)
K.TGVISPR(+14.02).Y Y 37.82 742.4337 7 3.2 372.2253 2 36.30 2 13679 AEV_1_3_RA2_01_1232.d 6.57E5 4 4 72 78 Methylation(KR)
K.LLPSRQ(+.98)FGYIVLTTSAGIMDHEEAR.R Y 37.47 2804.4167 25 5.9 702.1156 4 84.35 3 51268 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 93 117 Deamidation (NQ)
R.Q(-17.03)FGYIVLTTSAGIMDHEEAR(+14.02).R Y 35.73 2234.0676 20 -7.3 1118.0330 2 93.05 2 48604 AEV_1_3_RA2_01_1232.d 1.49E5 2 2 98 117 Pyro-glu from Q; Methylation(KR)
K.T(+226.08)SVLNDALNAINNAEKSGK.R Y 35.47 2184.0845 19 33.2 547.0465 4 77.76 3 46308 AEV_3_3_RA3_01_1233.d 0 1 1 4 22 Biotinylation
K.RQVLIRPSSK.V Y 33.51 1182.7196 10 -5.2 395.2451 3 25.06 3 10611 AEV_3_3_RA3_01_1233.d 1.05E5 1 1 23 32
K.FLSVM(+15.99)QK.H Y 30.95 867.4524 7 1.1 434.7339 2 43.43 3 21551 AEV_3_3_RA3_01_1233.d 7.61E5 5 5 37 43 Oxidation (M)
K.FLSVMQK.H Y 28.15 851.4575 7 -67.6 426.7073 2 70.31 1 34199 AEV 2_3_RA2_01_1224.d 0 1 1 37 43
K.T(+42.01)GVISPR.Y Y 26.93 770.4286 7 -24.8 386.2120 2 26.02 3 11154 AEV_3_3_RA3_01_1233.d 4.99E5 1 1 72 78 Acetylation (N-term)
R.RKHVAGKVIGFFY Y 23.76 1520.8616 13 -8.9 381.2193 4 69.18 3 39600 AEV_3_3_RA3_01_1233.d 9.57E4 1 1 118 130
R.DLEKWVVK.L Y 21.73 1015.5702 8 -0.7 339.5304 3 64.92 3 36208 AEV_3_3_RA3_01_1233.d 1.47E5 1 1 85 92
K.IVIQLNGRLNK.T Y 21.61 1266.7772 11 -13.7 423.2606 3 63.71 3 35283 AEV_3_3_RA3_01_1233.d 3E5 1 1 61 71
K.T(+114.04)GVISPR.Y Y 19.02 842.4610 7 -21.5 422.2287 2 72.21 2 34506 AEV_1_3_RA2_01_1232.d 2.14E5 1 1 72 78 Ubiquitin
K.T(-2.02)SVLNDALNAINNAEKSGK.R Y 17.92 1955.9912 19 16.7 653.0153 3 80.75 3 48645 AEV_3_3_RA3_01_1233.d 0 1 1 4 22 2-amino-3-oxo-butanoic_acid
K.T(+136.03)GVISPR.Y Y 16.84 864.4470 7 -68.6 433.2011 2 67.27 1 31850 AEV 2_3_RA2_01_1224.d 0 1 1 72 78 O-Diethylphosphorylation
total 39 peptides
C1GEU2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.AYPSSFDPAEDFSDIIGGTEQK.I Y 135.81 2373.0647 22 1.4 1187.5413 2 86.55 2 45366 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 606 627
K.VVFHPEFLNSSNPVLPLDYDDFVR.G Y 129.54 2818.3965 24 4.0 940.4766 3 88.26 2 46328 AEV_1_3_RA2_01_1232.d 1.66E5 1 1 465 488
K.APVTTAEYGER.Y Y 89.44 1192.5724 11 -0.3 597.2933 2 38.65 3 18601 AEV_3_3_RA3_01_1233.d 1.75E5 3 3 38 48
K.SKAPVTTAEYGER.Y Y 70.44 1407.6993 13 3.1 470.2418 3 34.16 2 12668 AEV_1_3_RA2_01_1232.d 1.99E5 3 3 36 48
K.GVDMFIESLAR.L Y 69.47 1236.6172 11 3.8 619.3182 2 82.97 2 42853 AEV_1_3_RA2_01_1232.d 6.1E4 1 1 324 334
R.NKGVDMFIESLAR.L Y 67.37 1478.7551 13 -7.5 493.9220 3 78.94 2 39721 AEV_1_3_RA2_01_1232.d 1.49E5 2 2 322 334
R.VVLIDTGAGYK.Y Y 62.49 1134.6284 11 -5.5 568.3184 2 66.19 3 37215 AEV_3_3_RA3_01_1233.d 3.16E5 3 3 101 111
R.VQLFNHPSDR.V Y 43.47 1211.6047 10 0.2 606.8098 2 50.28 2 20579 AEV_1_3_RA2_01_1232.d 1.52E5 2 2 453 462
R.WLIEGAPR.V Y 42.76 940.5130 8 -8.0 471.2600 2 69.28 3 39673 AEV_3_3_RA3_01_1233.d 4.05E5 3 3 93 100
K.SLRDTLEM(+15.99)VEQGIGKR.L Y 40.26 1846.9570 16 9.5 462.7509 4 77.50 2 38572 AEV_1_3_RA2_01_1232.d 3.64E4 1 1 374 389 Oxidation (M)
K.APVTTAEYGER(+14.02).Y Y 34.68 1206.5880 11 -17.4 604.2908 2 49.35 2 20117 AEV_1_3_RA2_01_1232.d 9.8E4 1 1 38 48 Methylation(KR)
R.EVTANGDV Y 32.33 803.3661 8 32.2 804.3992 1 83.02 2 42896 AEV_1_3_RA2_01_1232.d 9.88E4 1 1 701 708
R.VQLFNHPSDRVK.V Y 32.25 1438.7681 12 7.9 360.7021 4 48.87 3 24998 AEV_3_3_RA3_01_1233.d 4.8E5 1 1 453 464
R.YC(+57.02)IER.A N 26.26 739.3323 5 -87.5 370.6411 2 40.20 1 14520 AEV 2_3_RA2_01_1224.d 3.4E5 2 2 228 232 Carbamidomethylation
R.NKGVDM(+15.99)FIESLAR.L Y 25.45 1494.7500 13 -0.5 499.2570 3 71.25 3 41210 AEV_3_3_RA3_01_1233.d 1.36E5 1 1 322 334 Oxidation (M)
R.YTLIGPLNR.S Y 23.16 1045.5920 9 -87.5 523.7576 2 78.93 1 40995 AEV 2_3_RA2_01_1224.d 1.55E5 3 3 49 57
R.DTLEMVEQGIGKR.L Y 22.84 1474.7450 13 9.6 738.3868 2 73.26 2 35319 AEV_1_3_RA2_01_1232.d 0 1 1 377 389
R.DRTGM(+15.99)M(+15.99)TPGDFGSLQEGR.E Y 21.62 1985.8571 18 -22.4 662.9448 3 78.69 1 40797 AEV 2_3_RA2_01_1224.d 5.15E4 1 1 640 657 Oxidation (M)
K.INDFVR.G Y 21.10 762.4024 6 -11.5 382.2041 2 78.22 1 40428 AEV 2_3_RA2_01_1224.d 1.31E5 1 1 290 295
R.VKVVFHPEFLNSSNPVLPLDYDDFVR.G Y 19.90 3045.5598 26 -3.9 762.3942 4 85.83 3 52255 AEV_3_3_RA3_01_1233.d 0 1 1 463 488
K.I(+42.01)SR(+31.99)PFSVPGSPR.D Y 19.34 1372.7098 12 47.8 344.2011 4 11.94 3 3472 AEV_3_3_RA3_01_1233.d 0 1 1 628 639 Acetylation (N-term); Dihydroxy
K.ISRPFSVPGSPRDR.T Y 17.95 1569.8375 14 5.0 524.2891 3 62.98 3 34721 AEV_3_3_RA3_01_1233.d 0 1 1 628 641
R.TGMMTPGDFGSLQEGR.E Y 16.63 1682.7393 16 -60.4 561.8865 3 60.90 1 27146 AEV 2_3_RA2_01_1224.d 0 1 1 642 657
R.LFAMK.R Y 15.80 608.3356 5 -26.1 609.3270 1 41.38 2 16164 AEV_1_3_RA2_01_1232.d 5.18E4 1 1 422 426
R.LFAM(+15.99)KR.H Y 15.42 780.4316 6 4.0 391.2246 2 31.77 2 11543 AEV_1_3_RA2_01_1232.d 0 1 1 422 427 Oxidation (M)
R.LSDLLDWKRM(+15.99)GMEYVK.A Y 15.01 1998.9907 16 -31.9 667.3163 3 30.72 3 13807 AEV_3_3_RA3_01_1233.d 4.83E4 1 1 582 597 Oxidation (M)
total 26 peptides
C1GLJ7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.NMVESAAIRDISDASVFPDYAVPK.M Y 139.02 2594.2686 24 -1.2 865.7624 3 83.48 2 43241 AEV_1_3_RA2_01_1232.d 1.52E6 6 6 43 66
K.LQYC(+57.02)VSC(+57.02)AIHGK.I Y 109.56 1434.6748 12 3.9 479.2341 3 59.38 2 25475 AEV_1_3_RA2_01_1232.d 3.64E6 12 12 71 82 Carbamidomethylation
R.DISDASVFPDYAVPK.M Y 101.36 1622.7827 15 12.8 812.4090 2 80.47 2 40973 AEV_1_3_RA2_01_1232.d 4.25E6 7 7 52 66
R.NM(+15.99)VESAAIRDISDASVFPDYAVPK.M Y 100.41 2610.2634 24 6.4 871.1006 3 81.56 3 49291 AEV_3_3_RA3_01_1233.d 6.3E5 3 3 43 66 Oxidation (M)
R.DISDASVFPDYAVPK(+14.02).M Y 74.41 1636.7983 15 3.1 819.4090 2 82.26 2 42318 AEV_1_3_RA2_01_1232.d 5.46E5 3 3 52 66 Methylation(KR)
K.GRGHVKPIR.C Y 72.86 1018.6148 9 2.6 340.5464 3 12.19 3 3595 AEV_3_3_RA3_01_1233.d 5.82E5 5 5 14 22
R.NMVESAAIRDISDASVFPDYAVPK(+14.02).M Y 71.60 2608.2842 24 0.2 870.4355 3 84.34 2 43871 AEV_1_3_RA2_01_1232.d 1.68E5 1 1 43 66 Methylation(KR)
R.DISDASVFPDYAVPKM(+15.99)YLK.L Y 70.08 2174.0605 19 -5.3 725.6903 3 80.77 3 48665 AEV_3_3_RA3_01_1233.d 1.59E5 2 2 52 70 Oxidation (M)
R.DISDASVFPDYAVPKMYLKLQYC(+57.02)VSC(+57.02)AIHGK.I Y 67.93 3574.7297 31 -5.3 715.9495 5 87.26 3 53156 AEV_3_3_RA3_01_1233.d 1.81E5 1 1 52 82 Carbamidomethylation
K.LQYC(+57.02)VSC(+57.02)AIHGK(+14.02).I Y 62.46 1448.6904 12 -0.8 483.9037 3 60.87 3 33079 AEV_3_3_RA3_01_1233.d 9.47E5 5 5 71 82 Carbamidomethylation; Methylation(KR)
R.GHVKPIR.C Y 61.54 805.4922 7 0.0 403.7534 2 11.25 3 3131 AEV_3_3_RA3_01_1233.d 1.13E6 3 3 16 22
R.NM(+15.99)VESAAIR.D Y 55.03 1005.4913 9 2.3 503.7541 2 31.66 3 14367 AEV_3_3_RA3_01_1233.d 3.26E6 26 26 43 51 Oxidation (M)
K.KSNPTQAAK(+14.02).A Y 53.01 957.5243 9 3.6 479.7711 2 9.99 2 2485 AEV_1_3_RA2_01_1232.d 5.9E4 2 2 109 117 Methylation(KR)
K.KSNPTQAAK.A Y 49.45 943.5087 9 5.0 472.7639 2 7.88 2 1850 AEV_1_3_RA2_01_1232.d 1.59E4 2 2 109 117
R.NRAPPPR.I Y 49.40 806.4510 7 -0.6 404.2325 2 9.19 3 2249 AEV_3_3_RA3_01_1233.d 4.08E5 7 7 94 100
K.MYLKLQYC(+57.02)VSC(+57.02)AIHGK.I Y 48.66 1969.9576 16 0.8 493.4971 4 72.11 3 41883 AEV_3_3_RA3_01_1233.d 1.75E5 2 2 67 82 Carbamidomethylation
K.LQ(+.98)YC(+57.02)VSC(+57.02)AIHGK.I Y 48.64 1435.6588 12 10.1 479.5650 3 58.23 3 31112 AEV_3_3_RA3_01_1233.d 9.29E5 3 3 71 82 Deamidation (NQ); Carbamidomethylation
R.NMVESAAIR.D Y 48.56 989.4964 9 -1.1 495.7549 2 49.62 3 25497 AEV_3_3_RA3_01_1233.d 2.27E6 7 7 43 51
R.DAKKSNPTQAAK.A Y 46.59 1257.6677 12 2.8 420.2310 3 8.62 2 2041 AEV_1_3_RA2_01_1232.d 2.39E4 2 2 106 117
K.SNPTQAAKAAQA Y 44.47 1156.5836 12 -5.1 579.2961 2 23.74 2 7947 AEV_1_3_RA2_01_1232.d 1.39E5 2 2 110 121
R.NM(-48.00)VESAAIR.D Y 44.45 941.4930 9 0.5 471.7540 2 17.15 3 6323 AEV_3_3_RA3_01_1233.d 1E6 3 3 43 51 Dethiomethyl
R.NMVESAAIR(+14.02).D Y 40.34 1003.5120 9 -3.7 502.7614 2 60.25 3 32619 AEV_3_3_RA3_01_1233.d 3.14E5 1 1 43 51 Methylation(KR)
R.GHVKPIR(+14.02).C Y 40.16 819.5079 7 -2.9 410.7600 2 15.41 3 5341 AEV_3_3_RA3_01_1233.d 7.45E4 1 1 16 22 Methylation(KR)
R.DISDASVFPD(+14.02)YAVPK.M Y 39.69 1636.7983 15 2.4 819.4084 2 81.84 2 42003 AEV_1_3_RA2_01_1232.d 2.32E5 1 1 52 66 Methylation(others)
R.RNRAPPPR.I Y 37.06 962.5522 8 4.6 321.8595 3 9.46 3 2333 AEV_3_3_RA3_01_1233.d 1.3E5 2 2 93 100
R.DISDASVFPDYAVP(+13.98)K.M Y 33.61 1636.7620 15 -66.3 819.3340 2 85.62 1 46309 AEV 2_3_RA2_01_1224.d 4.53E5 1 1 52 66 Proline oxidation to pyroglutamic acid
K.SNPTQAAK(+14.02).A Y 26.93 829.4294 8 6.7 415.7248 2 13.07 2 3615 AEV_1_3_RA2_01_1232.d 4E4 1 1 110 117 Methylation(KR)
R.N(+42.01)M(+15.99)VESAAIR.D Y 25.53 1047.5018 9 -53.5 350.1559 3 36.40 1 12396 AEV 2_3_RA2_01_1224.d 1.19E5 1 1 43 51 Acetylation (N-term); Oxidation (M)
R.N(+.98)MVESAAIR.D Y 24.23 990.4804 9 24.3 496.2595 2 51.37 2 21142 AEV_1_3_RA2_01_1232.d 7.04E4 2 2 43 51 Deamidation (NQ)
R.NMVE(+14.02)SAAIRDISDASVFPDYAVPK.M Y 21.90 2608.2842 24 3.2 870.4381 3 81.67 3 49347 AEV_3_3_RA3_01_1233.d 3.46E4 1 1 43 66 Methylation(others)
R.N(+43.01)MVESAAIR(+14.02)DISDASVFPDYAVPK.M Y 17.98 2651.2900 24 -2.0 663.8285 4 77.81 3 46351 AEV_3_3_RA3_01_1233.d 4.71E5 1 1 43 66 Carbamylation; Methylation(KR)
K.KSNPTQAAKAAQA Y 15.40 1284.6786 13 6.7 429.2364 3 16.28 2 4857 AEV_1_3_RA2_01_1232.d 3.91E4 1 1 109 121
total 32 peptides
C1GN78
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AIGIQPTEEGTIAVTTK.K Y 120.03 1727.9305 17 1.1 864.9735 2 72.59 2 34820 AEV_1_3_RA2_01_1232.d 1.23E6 5 5 56 72
K.SNVSDDLVWEITR.S Y 113.21 1532.7471 13 2.5 767.3828 2 81.35 2 41628 AEV_1_3_RA2_01_1232.d 9.21E5 4 4 7 19
K.KPATIHKPASSTTTNTYSSTATNR.K Y 101.22 2534.2725 24 0.8 634.5759 4 32.16 3 14707 AEV_3_3_RA3_01_1233.d 9.6E5 4 4 73 96
K.YAGFVNC(+57.02)K.A Y 77.16 957.4378 8 0.9 479.7266 2 44.25 3 22076 AEV_3_3_RA3_01_1233.d 3.66E5 3 3 48 55 Carbamidomethylation
R.KYAGFVNC(+57.02)K.A Y 76.21 1085.5327 9 2.6 543.7750 2 33.50 3 15461 AEV_3_3_RA3_01_1233.d 9.84E5 5 5 47 55 Carbamidomethylation
K.AIGIQPTE(+14.02)EGTIAVTTK.K Y 76.20 1741.9462 17 0.5 871.9808 2 75.26 3 44357 AEV_3_3_RA3_01_1233.d 1.51E5 1 1 56 72 Methylation(others)
K.IYKGIANTAAK.S Y 66.55 1148.6553 11 -1.5 575.3340 2 30.92 3 13917 AEV_3_3_RA3_01_1233.d 3.31E5 4 4 98 108
K.AIGIQPTEEGTIAVTTK(+14.02).K Y 66.39 1741.9462 17 -1.8 871.9788 2 73.25 3 42781 AEV_3_3_RA3_01_1233.d 8E4 2 2 56 72 Methylation(KR)
M.S(+42.01)YVGKSNVSDDLVWEITR.S Y 65.82 2109.0378 18 -1.2 1055.5249 2 83.67 3 50788 AEV_3_3_RA3_01_1233.d 6.67E4 2 2 2 19 Acetylation (Protein N-term)
K.AIGIQPTEE(+14.02)GTIAVTTK.K Y 62.80 1741.9462 17 3.1 871.9831 2 75.72 2 37240 AEV_1_3_RA2_01_1232.d 1.05E5 1 1 56 72 Methylation(others)
K.C(+57.02)AGAQFSRDPLNLVNK.H Y 61.57 1788.8940 16 -3.7 597.3031 3 70.29 3 40452 AEV_3_3_RA3_01_1233.d 1.47E5 2 2 28 43 Carbamidomethylation
K.KPATIHKPASSTTTNTYSSTATNRK.I Y 59.76 2662.3674 25 8.4 533.4852 5 32.00 2 11643 AEV_1_3_RA2_01_1232.d 9.62E4 1 1 73 97
R.SQNSFLVK.C Y 56.30 921.4919 8 0.0 461.7532 2 48.70 2 19827 AEV_1_3_RA2_01_1232.d 2.35E6 6 6 20 27
K.SNVSDDLVWEITR(+14.02).S Y 55.48 1546.7627 13 4.5 774.3921 2 83.61 3 50746 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 7 19 Methylation(KR)
K.C(+57.02)AGAQ(+.98)FS(-18.01)RDPLNLVNKHSR.K Y 53.05 2152.0596 19 -2.6 539.0208 4 70.63 3 40723 AEV_3_3_RA3_01_1233.d 1.95E5 1 1 28 46 Carbamidomethylation; Deamidation (NQ); Dehydration
R.ADLRAEAVGR.A Y 51.33 1056.5675 10 2.5 529.2924 2 34.36 3 15943 AEV_3_3_RA3_01_1233.d 6.1E5 4 4 113 122
K.I(+42.01)YKGIANTAAK.S Y 45.34 1190.6659 11 6.8 397.8986 3 30.93 3 13918 AEV_3_3_RA3_01_1233.d 1.13E5 1 1 98 108 Acetylation (N-term)
K.C(+57.02)AGAQ(+.98)FS(-18.01)RDPLNLVNK.H Y 43.17 1771.8676 16 8.3 886.9484 2 78.88 3 47347 AEV_3_3_RA3_01_1233.d 2.37E4 1 1 28 43 Carbamidomethylation; Deamidation (NQ); Dehydration
K.C(+57.02)AGAQ(+.98)FSRD(-18.01)PLNLVNKHSR.K Y 38.64 2152.0596 19 -0.6 539.0219 4 71.42 2 33938 AEV_1_3_RA2_01_1232.d 2.08E5 1 1 28 46 Carbamidomethylation; Deamidation (NQ); Dehydration
K.KEVPEKKPR.G Y 35.89 1109.6556 9 5.2 370.8944 3 9.33 3 2277 AEV_3_3_RA3_01_1233.d 5.7E4 2 2 134 142
R.KIYKGIANTAAK.S Y 35.65 1276.7502 12 -9.9 639.3761 2 28.28 3 12405 AEV_3_3_RA3_01_1233.d 1.48E4 1 1 97 108
R.DPLNLVNK.H Y 28.95 911.5076 8 11.2 456.7662 2 64.23 2 28718 AEV_1_3_RA2_01_1232.d 7.17E4 1 1 36 43
R.AEAVGR.A Y 28.92 601.3184 6 -51.3 602.2948 1 17.32 3 6382 AEV_3_3_RA3_01_1233.d 2.08E4 1 1 117 122
K.GIANTAAK.S Y 28.30 744.4130 8 -90.1 373.1802 2 25.39 1 6749 AEV 2_3_RA2_01_1224.d 1.77E5 3 3 101 108
K.SNVSDDLVW(+13.98)EITR.S Y 28.11 1546.7263 13 -66.5 774.3190 2 88.73 1 48702 AEV 2_3_RA2_01_1224.d 5.82E4 1 1 7 19 Tryptophan oxidation to oxolactone
K.C(+57.02)AGAQFSR.D Y 28.04 895.3970 8 -73.2 448.6730 2 33.63 1 10996 AEV 2_3_RA2_01_1224.d 0 1 1 28 35 Carbamidomethylation
K.AIGIQ(+.98)PTEEGTIAVTTK.K Y 25.11 1728.9146 17 -89.2 865.3875 2 78.45 1 40608 AEV 2_3_RA2_01_1224.d 3.04E4 1 1 56 72 Deamidation (NQ)
K.SNVSDDLVWEIT(-18.01)R(+14.02).S Y 25.04 1528.7522 13 17.6 765.3969 2 81.14 3 48946 AEV_3_3_RA3_01_1233.d 6.84E4 1 1 7 19 Dehydration; Methylation(KR)
K.AAEESS Y 18.64 592.2340 6 25.0 593.2561 1 70.08 1 34020 AEV 2_3_RA2_01_1224.d 6.88E4 1 1 149 154
R.ASAIRMSQRPK.K Y 18.36 1243.6819 11 -8.9 311.9250 4 19.59 3 7627 AEV_3_3_RA3_01_1233.d 2.17E5 1 1 123 133
R.GAKARKAAEESS Y 17.24 1203.6207 12 0.5 402.2144 3 34.65 3 16116 AEV_3_3_RA3_01_1233.d 3.79E6 1 1 143 154
K.SGYRADLRAEAVGR.A Y 15.54 1519.7855 14 -7.8 380.9507 4 47.67 3 24240 AEV_3_3_RA3_01_1233.d 2.11E5 1 1 109 122
R.KAAEESS Y 15.46 720.3290 7 -62.0 361.1494 2 19.36 1 4608 AEV 2_3_RA2_01_1224.d 0 1 1 148 154
total 33 peptides
C1GIP8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.TVTSLDVVYALKR.Q N 98.75 1463.8347 13 2.0 732.9261 2 74.36 3 43662 AEV_3_3_RA3_01_1233.d 2.76E6 9 9 126 138
R.TLYGFGG Y 94.30 713.3384 7 -0.8 714.3452 1 73.70 3 43120 AEV_3_3_RA3_01_1233.d 1.65E6 2 2 142 148
K.ILRDNIQGITKPAIR.R N 91.67 1707.0155 15 1.5 570.0133 3 63.72 3 35297 AEV_3_3_RA3_01_1233.d 6.18E4 3 3 67 81
R.DNIQGITKPAIR.R N 90.07 1324.7462 12 4.4 442.5913 3 59.52 2 25601 AEV_1_3_RA2_01_1232.d 3.12E6 8 8 70 81
R.DNIQGITKPAIRR.L N 89.31 1480.8474 13 4.0 494.6251 3 52.60 2 21781 AEV_1_3_RA2_01_1232.d 2.8E6 7 7 70 82
R.ISAMIYEETRGVLK.S N 87.29 1608.8545 14 1.7 537.2930 3 73.66 2 35620 AEV_1_3_RA2_01_1232.d 4.26E5 2 2 92 105
K.TVTSLDVVYALK.R N 74.92 1307.7336 12 -2.7 654.8723 2 79.10 3 47382 AEV_3_3_RA3_01_1233.d 2.06E5 2 2 126 137
R.ISAM(+15.99)IYEETR.G N 70.49 1227.5806 10 3.1 614.7994 2 59.20 3 31854 AEV_3_3_RA3_01_1233.d 3.09E5 3 3 92 101 Oxidation (M)
K.TVTSLDVVYALK(+14.02)R.Q N 69.90 1477.8503 13 0.6 493.6243 3 75.43 3 44459 AEV_3_3_RA3_01_1233.d 1.6E5 1 1 126 138 Methylation(KR)
K.SFLESVIRDAVTYTEHAK.R Y 66.45 2065.0479 18 1.5 517.2700 4 87.03 3 53027 AEV_3_3_RA3_01_1233.d 3.92E5 3 3 106 123
R.DAVTYTEHAK.R N 62.48 1133.5353 10 0.7 567.7753 2 24.77 3 10461 AEV_3_3_RA3_01_1233.d 6.6E5 4 4 114 123
K.RKTVTSLDVVYALKR.Q N 61.31 1748.0308 15 -6.3 438.0122 4 64.86 3 36166 AEV_3_3_RA3_01_1233.d 6.84E4 1 1 124 138
R.ISAMIYEETR.G N 58.18 1211.5856 10 -1.1 606.7994 2 64.92 3 36211 AEV_3_3_RA3_01_1233.d 2.42E5 1 1 92 101
R.ISAM(+15.99)IYEETRGVLK.S N 52.61 1624.8494 14 -3.8 813.4289 2 69.00 3 39458 AEV_3_3_RA3_01_1233.d 3.18E5 3 3 92 105 Oxidation (M)
R.K(+42.01)ILRDNIQGITKPAIR.R N 50.98 1877.1210 16 38.7 376.4460 5 62.22 3 34139 AEV_3_3_RA3_01_1233.d 0 1 1 66 81 Acetylation (N-term)
R.KTVTSLDVVYALKR.Q N 49.22 1591.9297 14 -3.1 398.9885 4 68.35 3 38958 AEV_3_3_RA3_01_1233.d 3.5E5 3 3 125 138
K.SFLESVIR.D Y 47.61 949.5233 8 4.3 475.7709 2 76.55 2 37831 AEV_1_3_RA2_01_1232.d 3.56E5 3 3 106 113
R.TLYGFGG(+14.02) Y 42.90 727.3541 7 -89.0 728.2966 1 80.27 1 42049 AEV 2_3_RA2_01_1224.d 1.28E5 1 1 142 148 Methylation(C-term)
R.KILRDNIQGITKPAIR.R N 25.55 1835.1105 16 -36.0 368.0161 5 62.15 3 34080 AEV_3_3_RA3_01_1233.d 0 1 1 66 81
R.ISAMIYEETR(+.98)GVLK.S N 23.63 1609.8385 14 13.4 537.6273 3 73.69 2 35644 AEV_1_3_RA2_01_1232.d 8.28E4 1 1 92 105 Deamidation (R)
K.G(+42.01)LGK(+42.01)GGAK.R Y 22.39 770.4286 8 -38.4 386.2068 2 15.20 2 4416 AEV_1_3_RA2_01_1232.d 1E5 1 1 55 62 Acetylation (N-term); Acetylation (K)
R.DAVTYTEHAKR.K N 18.76 1289.6364 11 4.4 430.8879 3 21.73 3 8789 AEV_3_3_RA3_01_1233.d 1.73E5 1 1 114 124
R.ISAMIY(-18.01)EETRGVLK.S N 18.37 1590.8439 14 -0.8 796.4286 2 86.92 2 45568 AEV_1_3_RA2_01_1232.d 2.85E4 1 1 92 105 Dehydration
total 23 peptides
C1GL73
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.SNHTANNSTSTITATANDAR.Q Y 101.47 2045.9363 20 3.7 682.9886 3 41.18 2 16041 AEV_1_3_RA2_01_1232.d 2.12E5 2 2 1923 1942
R.GYLVAPPSLLAGLTSVK.G Y 92.58 1684.9763 17 -11.5 843.4857 2 87.83 2 46103 AEV_1_3_RA2_01_1232.d 6.63E4 2 2 49 65
K.NHIYEDNSVINSSSITASR.A Y 85.94 2105.9978 19 8.9 703.0128 3 65.38 3 36579 AEV_3_3_RA3_01_1233.d 8.34E4 1 1 2124 2142
K.TDGADAVSVTPSR.A Y 83.65 1274.6102 13 3.0 638.3143 2 46.12 2 18492 AEV_1_3_RA2_01_1232.d 9.64E4 3 3 1962 1974
R.SLSQSSDSVTAKPNKPDTPGKEPTVIR.T Y 67.84 2838.4722 27 4.9 568.7045 5 56.30 3 29720 AEV_3_3_RA3_01_1233.d 1.12E5 1 1 479 505
R.LLQATPDSQQSR.N Y 62.84 1342.6841 12 15.1 672.3594 2 40.80 2 15848 AEV_1_3_RA2_01_1232.d 5.86E4 2 2 907 918
R.TVSGGTHGNNGNN(+.98)NVTSASNAHPVTSER.L Y 57.80 2779.2505 28 -3.1 695.8177 4 36.16 3 17049 AEV_3_3_RA3_01_1233.d 5.91E4 1 1 2076 2103 Deamidation (NQ)
R.NNPTSLHNVAQTKR.I Y 57.11 1578.8226 14 -21.3 527.2703 3 26.03 3 11160 AEV_3_3_RA3_01_1233.d 1.92E5 2 2 589 602
R.SDIYITINR.A Y 54.42 1093.5768 9 -0.5 547.7954 2 67.67 2 31128 AEV_1_3_RA2_01_1232.d 1.2E5 2 2 614 622
K.TIYTTAEPFPNILR.R Y 51.84 1634.8668 14 -7.8 818.4343 2 81.55 3 49253 AEV_3_3_RA3_01_1233.d 3.15E4 1 1 1685 1698
R.GSGLEVGKEPSR.S Y 43.44 1214.6255 12 -3.0 608.3182 2 31.57 3 14316 AEV_3_3_RA3_01_1233.d 2.27E4 1 1 467 478
R.TSDANDQYRDQVR.L Y 43.43 1566.7023 13 4.3 523.2436 3 25.23 3 10700 AEV_3_3_RA3_01_1233.d 1.97E5 3 3 1065 1077
R.NNPTSLHNVAQTK.R Y 35.05 1422.7216 13 5.0 712.3716 2 30.34 3 13583 AEV_3_3_RA3_01_1233.d 1.51E5 2 2 589 601
R.IGFTGAPTKPR.S Y 29.59 1143.6400 11 2.6 382.2216 3 49.50 2 20188 AEV_1_3_RA2_01_1232.d 7.12E4 1 1 603 613
R.ISLNPFKR.S Y 26.25 973.5709 8 3.9 325.5322 3 66.82 2 30530 AEV_1_3_RA2_01_1232.d 2.85E4 1 1 1915 1922
R.SWFGGGGGNDTHK.N Y 24.59 1318.5691 13 -40.5 1319.5229 1 79.07 1 41105 AEV 2_3_RA2_01_1224.d 1.82E5 2 2 1993 2005
K.IYDQIVKDTNPPQR.Y Y 24.17 1685.8737 14 8.2 562.9698 3 61.07 2 26578 AEV_1_3_RA2_01_1232.d 3.52E4 1 1 1554 1567
K.TAMGGTATSSQNNHGK.N Y 24.10 1560.6951 16 -62.0 521.2067 3 52.85 1 21876 AEV 2_3_RA2_01_1224.d 4.22E4 2 2 2108 2123
K.S(+42.01)TGGVVISSISNAAAK.M Y 23.00 1502.7939 16 30.2 376.7171 4 22.28 2 7343 AEV_1_3_RA2_01_1232.d 0 1 1 2054 2069 Acetylation (N-term)
R.C(+57.02)LALYSRPAYQATQAELTR.R Y 22.86 2211.1106 19 -14.4 553.7770 4 53.65 3 28143 AEV_3_3_RA3_01_1233.d 0 1 1 1815 1833 Carbamidomethylation
K.AGRKATRLNVR.D Y 22.47 1240.7476 11 17.6 311.1996 4 59.83 3 32294 AEV_3_3_RA3_01_1233.d 2.2E4 1 1 2173 2183
K.STGGVVISSISNAAAK.M Y 19.89 1460.7834 16 -92.5 731.3314 2 75.71 1 38439 AEV 2_3_RA2_01_1224.d 4.77E4 1 1 2054 2069
R.IGFTGAPTKPRSDIYITINR.A Y 19.24 2219.2063 20 -19.4 444.8399 5 67.08 2 30720 AEV_1_3_RA2_01_1232.d 5.21E4 1 1 603 622
R.GGDTPSK.R Y 18.53 660.3079 7 49.0 331.1774 2 39.10 1 13886 AEV 2_3_RA2_01_1224.d 1.95E5 1 1 1984 1990
K.QFNFPFATSC(+57.02)LIR.S Y 18.43 1599.7867 13 -26.1 800.8798 2 85.45 2 44624 AEV_1_3_RA2_01_1232.d 7.02E4 1 1 890 902 Carbamidomethylation
K.Q(-17.03)FNFPFATSC(+57.02)LIR.S Y 18.33 1582.7603 13 1.9 792.3889 2 93.10 2 48625 AEV_1_3_RA2_01_1232.d 4.86E4 1 1 890 902 Pyro-glu from Q; Carbamidomethylation
R.LSTEPVPR.R Y 18.21 897.4919 8 -27.0 449.7411 2 40.13 2 15532 AEV_1_3_RA2_01_1232.d 0 1 1 100 107
R.EWHSTNIHQLLLAR.Q Y 17.80 1716.9060 14 -4.5 430.2318 4 66.11 3 37182 AEV_3_3_RA3_01_1233.d 0 1 1 215 228
K.NESAK.D Y 16.76 547.2602 5 24.0 548.2806 1 28.14 2 9870 AEV_1_3_RA2_01_1232.d 7.93E3 1 1 772 776
R.DPNTTKPPAPVPM(+15.99)LK.I Y 16.75 1620.8545 15 -9.4 406.2171 4 35.26 2 13198 AEV_1_3_RA2_01_1232.d 1.41E5 1 1 178 192 Oxidation (M)
R.TTVTQR.G Y 16.31 704.3817 6 11.7 705.3972 1 99.17 3 58797 AEV_3_3_RA3_01_1233.d 0 1 1 682 687
R.TWESIGWDTTADEQER.Y Y 16.31 1922.8282 16 -20.8 481.7043 4 80.11 1 41928 AEV 2_3_RA2_01_1224.d 0 1 1 1282 1297
K.QFNFPFATSC(+57.02)LIRSYC(+57.02)R.L Y 15.52 2166.0139 17 -62.8 722.9666 3 92.49 1 51406 AEV 2_3_RA2_01_1224.d 0 1 1 890 906 Carbamidomethylation
K.LEEDGTR.R Y 15.42 818.3770 7 -57.9 410.1721 2 25.38 1 6726 AEV 2_3_RA2_01_1224.d 0 1 1 153 159
total 34 peptides
C1G6F6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IINEPTAAAIAYGLGSGR.S Y 110.17 1772.9420 18 -2.0 591.9868 3 79.89 2 40471 AEV_1_3_RA2_01_1232.d 4.21E5 6 6 176 193
K.AVITVPAYFNDNQR.Q Y 87.92 1606.8103 14 -4.1 536.6085 3 76.75 3 45532 AEV_3_3_RA3_01_1233.d 4.61E5 4 4 146 159
K.AFSGTLEPVQQVLK.D Y 85.90 1515.8296 14 -2.0 758.9205 2 77.47 3 46078 AEV_3_3_RA3_01_1233.d 5.89E4 1 1 314 327
K.VVDQGGNPVVQVQYLGETK.T Y 78.98 2029.0480 19 -13.0 677.3478 3 74.67 3 43875 AEV_3_3_RA3_01_1233.d 5.1E4 2 2 98 116
K.DAGAIAGLNVLR.I Y 67.53 1168.6564 12 -4.9 585.3326 2 78.20 2 39199 AEV_1_3_RA2_01_1232.d 1.19E5 2 2 164 175
R.TLSNATQTTIEIDSLFDGEDFNSQITR.A Y 66.07 3015.4309 27 3.0 1006.1539 3 88.50 3 53892 AEV_3_3_RA3_01_1233.d 1.58E5 2 2 278 304
K.AFSGTLEPVQQVLKDANIDK.S Y 56.81 2172.1426 20 18.4 725.0681 3 81.71 3 49375 AEV_3_3_RA3_01_1233.d 0 1 1 314 333
K.LSSTEIENMINDAAK.F Y 53.44 1634.7821 15 -1.4 818.3972 2 81.13 3 48940 AEV_3_3_RA3_01_1233.d 3.6E4 1 1 516 530
R.SANITISNAVGKLSSTEIENMINDAAK.F Y 49.87 2790.4070 27 10.5 931.1527 3 85.74 2 44807 AEV_1_3_RA2_01_1232.d 5.97E4 1 1 504 530
R.ARFEDLNAK.A Y 48.46 1062.5458 9 0.8 355.1895 3 35.47 3 16615 AEV_3_3_RA3_01_1233.d 1.14E6 5 5 305 313
R.SANITISNAVGK.L Y 47.02 1173.6354 12 3.7 587.8271 2 58.39 2 24869 AEV_1_3_RA2_01_1232.d 1.93E5 2 2 504 515
R.Q(-17.03)ATK(+42.01)DAGAIAGLNVLR.I Y 44.31 1621.8788 16 -67.3 541.5972 3 87.33 1 47589 AEV 2_3_RA2_01_1224.d 1.89E5 1 1 160 175 Pyro-glu from Q; Acetylation (K)
R.LRTAC(+57.02)ER.A N 36.66 904.4549 7 4.9 453.2369 2 11.28 2 2944 AEV_1_3_RA2_01_1232.d 9.04E4 2 2 268 274 Carbamidomethylation
R.IINEPTAAAIAYGLGSGR(+14.02).S Y 36.06 1786.9576 18 -74.0 894.4200 2 80.41 1 42162 AEV 2_3_RA2_01_1224.d 2.6E4 1 1 176 193 Methylation(KR)
R.Q(+42.01)ATKDAGAIAGLNVLR.I Y 35.31 1638.9053 16 -68.8 547.2714 3 83.31 1 44444 AEV 2_3_RA2_01_1224.d 1.27E5 1 1 160 175 Acetylation (N-term)
R.GQTVPTIK.K Y 33.17 842.4861 8 -89.2 422.2128 2 51.56 1 21071 AEV 2_3_RA2_01_1224.d 1.27E5 1 1 423 430
R.QATKDAGAIAGLNVLR.I Y 32.51 1596.8947 16 -54.0 533.2767 3 69.05 3 39497 AEV_3_3_RA3_01_1233.d 0 1 1 160 175
K.LLSDFFNGK.K Y 28.26 1039.5338 9 8.3 520.7785 2 77.60 2 38656 AEV_1_3_RA2_01_1232.d 4.56E4 1 1 354 362
K.KDLSGDPR.A Y 27.67 886.4508 8 6.0 444.2354 2 10.88 3 2937 AEV_3_3_RA3_01_1233.d 0 4 4 256 263
K.VTATEK.S Y 21.86 647.3490 6 -121.2 648.2778 1 38.33 1 13461 AEV 2_3_RA2_01_1224.d 1.28E4 2 2 494 499
R.LIGEAAK.N Y 21.28 700.4119 7 -84.0 351.1838 2 35.91 1 12142 AEV 2_3_RA2_01_1224.d 1.19E5 2 2 54 60
R.Q(+.98)ATK(+14.02)DAGAIAGLNVLR.I Y 19.66 1611.8944 16 -14.1 538.2979 3 76.91 3 45622 AEV_3_3_RA3_01_1233.d 2.32E4 1 1 160 175 Deamidation (NQ); Methylation(KR)
K.AM(+15.99)ATR Y 19.10 564.2690 5 46.3 565.3024 1 53.47 2 22231 AEV_1_3_RA2_01_1232.d 0 1 1 611 615 Oxidation (M)
K.DVESWPFK.V Y 18.54 1006.4760 8 -23.1 504.2336 2 80.54 1 42261 AEV 2_3_RA2_01_1224.d 0 1 1 90 97
K.VDEIVLVGGSTR.I Y 18.07 1243.6772 12 56.2 1244.7544 1 100.76 2 51228 AEV_1_3_RA2_01_1232.d 2.48E4 1 1 336 347
K.ELALK.R N 18.02 572.3533 5 3.9 573.3629 1 104.19 1 57068 AEV 2_3_RA2_01_1224.d 0 1 1 601 605
K.TFSPQEISSM(+15.99)VLM(+15.99)KM(+15.99)K.E Y 15.69 1903.9093 16 -5.5 476.9820 4 86.23 1 46743 AEV 2_3_RA2_01_1224.d 1.44E5 1 1 117 132 Oxidation (M)
total 27 peptides
C1GDA8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.Q(-17.03)SGYGGQTK(+14.02)PVFR.K Y 94.37 1420.7098 13 1.4 711.3632 2 60.56 2 26273 AEV_1_3_RA2_01_1232.d 5.87E6 4 4 73 85 Pyro-glu from Q; Methylation(KR)
R.KQSGYGGQTK(+14.02)PVFR.K Y 85.42 1565.8314 14 -4.7 783.9193 2 33.03 3 15198 AEV_3_3_RA3_01_1233.d 3.69E6 10 10 72 85 Methylation(KR)
K.Q(-17.03)SGYGGQTK(+14.02)PVFRK.K Y 79.84 1548.8048 14 -1.9 775.4082 2 47.22 3 24006 AEV_3_3_RA3_01_1233.d 2.38E6 3 3 73 86 Pyro-glu from Q; Methylation(KR)
K.QSGYGGQTK(+14.02)PVFR.K Y 79.63 1437.7365 13 0.5 719.8759 2 42.94 3 21278 AEV_3_3_RA3_01_1233.d 3.57E6 7 7 73 85 Methylation(KR)
K.AGKASLFAQGK.R Y 79.34 1076.5978 11 1.3 539.3069 2 30.64 3 13761 AEV_3_3_RA3_01_1233.d 9.5E4 1 1 56 66
K.VVLRLEC(+57.02)TVC(+57.02)K.T Y 75.36 1375.7316 11 -3.0 688.8710 2 62.57 3 34405 AEV_3_3_RA3_01_1233.d 1.21E6 4 4 94 104 Carbamidomethylation
K.HFELGGDKK.T Y 73.71 1029.5243 9 1.4 515.7701 2 20.85 3 8321 AEV_3_3_RA3_01_1233.d 1.8E6 7 7 116 124
K.HTQHKVTQYK.A Y 70.59 1268.6626 10 -0.4 635.3383 2 11.12 3 3072 AEV_3_3_RA3_01_1233.d 2.15E5 4 4 46 55
K.KHTQHKVTQYK.A Y 68.19 1396.7576 11 2.2 699.3876 2 11.23 3 3123 AEV_3_3_RA3_01_1233.d 1.91E5 2 2 45 55
R.C(+57.02)KHFELGGDKK.T Y 61.48 1317.6499 11 1.5 440.2246 3 18.68 3 7125 AEV_3_3_RA3_01_1233.d 3.93E5 3 3 114 124 Carbamidomethylation
K.AGKASLFAQGKR.R Y 57.04 1232.6989 12 1.3 411.9074 3 24.85 3 10485 AEV_3_3_RA3_01_1233.d 8.35E4 1 1 56 67
R.LEC(+57.02)TVC(+57.02)K.T Y 56.90 908.4095 7 -88.6 455.1718 2 32.00 1 10145 AEV 2_3_RA2_01_1224.d 1.34E6 7 7 98 104 Carbamidomethylation
K.QSGYGGQTK(+14.02)PVFR(+14.02).K Y 56.49 1451.7521 13 -1.1 726.8825 2 51.12 3 26458 AEV_3_3_RA3_01_1233.d 2.66E4 1 1 73 85 Methylation(KR)
K.HFELGGDKKTK.G Y 51.87 1258.6670 11 -24.3 630.3255 2 17.22 3 6334 AEV_3_3_RA3_01_1233.d 0 1 1 116 126
K.ASLFAQGK.R Y 51.52 820.4443 8 -0.8 411.2291 2 40.44 3 19658 AEV_3_3_RA3_01_1233.d 8.82E6 14 14 59 66
R.KQSGYGGQ(+.98)TK(+14.02)PVFR.K Y 50.03 1566.8154 14 4.1 523.2812 3 36.58 3 17310 AEV_3_3_RA3_01_1233.d 1.38E5 1 1 72 85 Deamidation (NQ); Methylation(KR)
K.ASLFAQGK(+14.02).R Y 49.95 834.4599 8 3.4 835.4700 1 53.04 2 22001 AEV_1_3_RA2_01_1232.d 1.27E6 6 6 59 66 Methylation(KR)
K.ASLFAQGKR.R Y 48.88 976.5453 9 -1.0 489.2794 2 30.36 3 13592 AEV_3_3_RA3_01_1233.d 7.18E6 11 11 59 67
K.TKAQLALKR.C Y 45.93 1027.6501 9 6.9 514.8359 2 22.61 2 7492 AEV_1_3_RA2_01_1232.d 9.54E5 5 5 105 113
K.KVVLRLEC(+57.02)TVC(+57.02)K.T Y 45.63 1503.8265 12 0.7 502.2831 3 60.00 2 25876 AEV_1_3_RA2_01_1232.d 7.69E5 3 3 93 104 Carbamidomethylation
R.KQSGYGGQTKP(+13.98)VFR.K Y 41.39 1565.7950 14 -62.8 392.4315 4 58.47 1 25413 AEV 2_3_RA2_01_1224.d 8.75E5 2 2 72 85 Proline oxidation to pyroglutamic acid
K.QSGYGGQTK(+14.02)PVFRK.K Y 38.91 1565.8314 14 2.0 522.9521 3 32.29 3 14745 AEV_3_3_RA3_01_1233.d 1.86E5 2 2 73 86 Methylation(KR)
K.QSGYGGQTKPVFR(+14.02).K Y 38.15 1437.7365 13 4.5 480.2549 3 43.84 3 21802 AEV_3_3_RA3_01_1233.d 1.94E6 1 1 73 85 Methylation(KR)
R.C(+58.01)KHFELGGDKK.T Y 37.84 1318.6339 11 20.7 660.3379 2 22.87 3 9373 AEV_3_3_RA3_01_1233.d 5.56E4 1 1 114 124 Carboxymethyl
R.KQSGYGGQTK(+14.02)PVFR(+14.02).K Y 37.15 1579.8470 14 2.7 527.6244 3 41.16 3 20106 AEV_3_3_RA3_01_1233.d 7.34E4 1 1 72 85 Methylation(KR)
K.QSGYGGQTKP(+13.98)VFR.K Y 35.73 1437.7001 13 -62.8 719.8122 2 60.52 1 26906 AEV 2_3_RA2_01_1224.d 1.5E6 2 2 73 85 Proline oxidation to pyroglutamic acid
K.A(+42.01)SLFAQGKR.R Y 33.67 1018.5559 9 25.3 340.5345 3 30.08 3 13435 AEV_3_3_RA3_01_1233.d 2.2E5 2 2 59 67 Acetylation (N-term)
K.ASLFAQ(+.98)GK.R Y 33.20 821.4283 8 0.3 411.7216 2 45.69 3 23012 AEV_3_3_RA3_01_1233.d 6.6E5 4 4 59 66 Deamidation (NQ)
R.LE(+14.02)C(+57.02)TVC(+57.02)K.T Y 30.71 922.4252 7 8.0 462.2236 2 29.36 2 10421 AEV_1_3_RA2_01_1232.d 1.06E5 1 1 98 104 Methylation(others); Carbamidomethylation
K.ASLFAQGKR(+14.02).R Y 30.34 990.5610 9 -14.2 496.2808 2 40.46 2 15687 AEV_1_3_RA2_01_1232.d 1.78E5 2 2 59 67 Methylation(KR)
K.ASLFAQGK(+14.02)R.R Y 29.78 990.5610 9 -23.5 496.2762 2 36.84 3 17480 AEV_3_3_RA3_01_1233.d 0 2 2 59 67 Methylation(KR)
K.AQLALKR.C Y 26.31 798.5076 7 -1.1 400.2606 2 25.11 2 8570 AEV_1_3_RA2_01_1232.d 1.86E6 4 4 107 113
K.QSGYGGQTK(+71.04)PVFR.K Y 24.55 1494.7579 13 6.5 499.2632 3 41.98 3 20633 AEV_3_3_RA3_01_1233.d 2.5E4 1 1 73 85 Propionamide (K, X@N-term)
K.Q(+.98)SGYGGQTK(+14.02)PVFR.K Y 22.09 1438.7205 13 -6.2 720.3630 2 47.81 2 19338 AEV_1_3_RA2_01_1232.d 4.7E4 1 1 73 85 Deamidation (NQ); Methylation(KR)
K.ASLFAQ(+.98)GKR.R Y 21.09 977.5294 9 3.4 489.7736 2 33.84 3 15634 AEV_3_3_RA3_01_1233.d 1.16E5 1 1 59 67 Deamidation (NQ)
K.QSGYGGQTK(+54.01)PVFR.K Y 20.14 1477.7313 13 -0.2 739.8728 2 59.15 3 31779 AEV_3_3_RA3_01_1233.d 2.07E5 1 1 73 85 MDA adduct +54
K.AQLALK.R Y 18.73 642.4064 6 0.1 643.4138 1 29.49 3 13096 AEV_3_3_RA3_01_1233.d 3.33E4 1 1 107 112
R.LEC(+57.02)TVC(+57.02)KTK.A Y 16.13 1137.5522 9 4.3 380.1930 3 16.46 3 5949 AEV_3_3_RA3_01_1233.d 9.45E4 1 1 98 106 Carbamidomethylation
total 38 peptides
C1G373
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.RPGGQQFGGGALGGAIKA Y 113.01 1640.8746 18 5.1 547.9683 3 65.25 2 29424 AEV_1_3_RA2_01_1232.d 8.66E4 1 1 847 864
R.AIRPEDLLGDEDEGFAIVGR.G Y 107.09 2171.0857 20 5.6 724.7065 3 83.05 2 42914 AEV_1_3_RA2_01_1232.d 1.68E4 1 1 218 237
R.LSDEQSLYTSIVR.S Y 92.33 1509.7675 13 -3.2 755.8886 2 74.99 3 44113 AEV_3_3_RA3_01_1233.d 1.28E5 1 1 394 406
R.YSSVSPEQEKLER.Q Y 83.16 1550.7576 13 5.8 517.9294 3 46.68 2 18812 AEV_1_3_RA2_01_1232.d 3.65E5 4 4 585 597
K.TLC(+57.02)NYLFELSDGIIR.A Y 53.34 1812.9080 15 7.8 907.4683 2 90.59 3 55035 AEV_3_3_RA3_01_1233.d 2.51E5 2 2 481 495 Carbamidomethylation
K.AIADLEDFMNETITEQK.S Y 42.00 1966.9193 17 6.9 984.4738 2 85.90 3 52306 AEV_3_3_RA3_01_1233.d 1.42E5 3 3 141 157
R.TLQYTPESILK.H Y 39.87 1291.7024 11 -4.1 646.8558 2 74.24 3 43537 AEV_3_3_RA3_01_1233.d 1.74E5 2 2 241 251
K.ALAAGDWKK.A Y 28.78 958.5236 9 -17.9 480.2605 2 33.94 3 15695 AEV_3_3_RA3_01_1233.d 1.38E5 2 2 675 683
R.GGGGGGLPR.R Y 28.67 726.3773 9 -27.7 727.3644 1 80.77 3 48662 AEV_3_3_RA3_01_1233.d 1.01E6 4 4 838 846
K.S(+42.01)M(+15.99)SLLEANEK.T Y 25.04 1178.5488 10 -29.2 393.8454 3 61.65 1 27723 AEV 2_3_RA2_01_1224.d 3.62E5 1 1 792 801 Acetylation (N-term); Oxidation (M)
R.GGRGGGRGGGGGGLPR.R Y 23.67 1323.6868 16 -56.8 662.8130 2 73.44 1 36637 AEV 2_3_RA2_01_1224.d 4.51E4 1 1 831 846
R.DPGHGGRGGR.G Y 22.44 964.4587 10 0.9 483.2370 2 31.48 3 14258 AEV_3_3_RA3_01_1233.d 1.79E5 1 1 817 826
R.SLQHIDPHTAEYIER.L Y 22.06 1807.8853 15 2.8 603.6374 3 61.90 3 33894 AEV_3_3_RA3_01_1233.d 3.17E4 1 1 379 393
R.DPGHGGR.G Y 18.93 694.3146 7 -37.0 348.1517 2 30.15 1 9047 AEV 2_3_RA2_01_1224.d 6.34E4 1 1 817 823
K.A(+42.01)STTLNSIK(+28.03).I Y 17.47 1003.5550 9 43.5 335.5402 3 60.34 3 32664 AEV_3_3_RA3_01_1233.d 1.06E6 1 1 684 692 Acetylation (N-term); Dimethylation(KR)
K.KM(+15.99)NASNAK.G Y 17.05 878.4280 8 8.8 879.4430 1 95.88 2 49641 AEV_1_3_RA2_01_1232.d 5.28E4 1 1 162 169 Oxidation (M)
K.VEKNEAR.Q Y 16.59 844.4402 7 -70.2 423.1978 2 30.21 1 9077 AEV 2_3_RA2_01_1224.d 5.25E4 1 1 417 423
R.TQGM(+15.99)ANAFQR.D Y 16.45 1138.5189 10 -100.9 570.2093 2 37.71 1 13124 AEV 2_3_RA2_01_1224.d 0 1 1 807 816 Oxidation (M)
R.GGRGGGR.G N 16.36 615.3201 7 -29.3 616.3093 1 45.40 3 22821 AEV_3_3_RA3_01_1233.d 0 1 1 824 830
total 19 peptides
C1G7C1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.Q(-17.03)DSTPLEAGGEDAGADAGEVPLVIQR.G Y 90.06 2577.2195 26 2.2 1289.6199 2 83.85 2 43509 AEV_1_3_RA2_01_1232.d 6.87E4 1 1 171 196 Pyro-glu from Q
K.VILC(+57.02)ASEDEKQQEASSR.S Y 87.63 1948.9160 17 0.0 650.6459 3 44.36 3 22153 AEV_3_3_RA3_01_1233.d 6.8E4 1 1 238 254 Carbamidomethylation
K.FGGALALGIIDAGGR.N Y 81.34 1386.7618 15 -1.9 694.3869 2 84.00 3 51016 AEV_3_3_RA3_01_1233.d 1.55E5 2 2 828 842
R.ESMDIDQTPTTPK.V Y 78.86 1461.6658 13 -1.7 731.8389 2 59.04 3 31704 AEV_3_3_RA3_01_1233.d 9.18E4 2 2 953 965
K.TAVLSTTAQAK.R Y 76.52 1089.6030 11 2.8 545.8103 2 34.34 3 15936 AEV_3_3_RA3_01_1233.d 2.46E5 4 4 930 940
K.VGC(+57.02)ELQNMSR.V Y 68.02 1192.5328 10 -0.4 597.2734 2 48.00 3 24449 AEV_3_3_RA3_01_1233.d 2.47E5 2 2 1009 1018 Carbamidomethylation
K.ETDSLFQNQESR.S Y 62.56 1452.6481 12 -9.3 727.3246 2 56.90 3 30147 AEV_3_3_RA3_01_1233.d 3.35E5 3 3 378 389
K.VGC(+57.02)ELQNM(+15.99)SR.V Y 62.32 1208.5278 10 4.6 605.2740 2 28.20 3 12363 AEV_3_3_RA3_01_1233.d 3.46E4 1 1 1009 1018 Carbamidomethylation; Oxidation (M)
R.ESM(+15.99)DIDQTPTTPK.V Y 54.46 1477.6606 13 2.3 739.8393 2 42.98 3 21273 AEV_3_3_RA3_01_1233.d 4.06E4 1 1 953 965 Oxidation (M)
R.ETKQPAGGETIQDR.I Y 47.43 1528.7480 14 -83.9 510.5472 3 36.25 1 12313 AEV 2_3_RA2_01_1224.d 8.31E4 1 1 1066 1079
R.M(+15.99)VELLSESYNPHVR.Y Y 41.71 1688.8192 14 -2.4 563.9457 3 67.22 3 38069 AEV_3_3_RA3_01_1233.d 2.93E5 2 2 736 749 Oxidation (M)
R.VLPAQLK.Y Y 39.92 767.4905 7 -0.2 768.4976 1 45.09 3 22613 AEV_3_3_RA3_01_1233.d 2.41E4 1 1 1019 1025
R.FHSNTRPSLFDYPPEIQVK.A Y 37.60 2274.1433 19 -11.2 569.5367 4 76.23 2 37571 AEV_1_3_RA2_01_1232.d 6.15E5 3 3 902 920
K.VVGDRHEDAMAK.F Y 36.47 1326.6350 12 -10.1 664.3181 2 60.58 1 26915 AEV 2_3_RA2_01_1224.d 5.87E5 6 6 816 827
R.LLAPYLPK.D Y 35.73 913.5637 8 -5.6 457.7866 2 71.54 3 41440 AEV_3_3_RA3_01_1233.d 3.75E5 3 3 517 524
K.YLTFPDPR.Y Y 35.25 1007.5076 8 6.5 504.7643 2 70.34 3 40491 AEV_3_3_RA3_01_1233.d 5.11E5 3 3 1026 1033
K.LEVPVFR.F Y 26.17 858.4963 7 -93.6 430.2152 2 79.58 1 41506 AEV 2_3_RA2_01_1224.d 0 1 1 895 901
K.VVGDR.H Y 26.17 544.2969 5 -115.2 545.2415 1 48.93 1 19610 AEV 2_3_RA2_01_1224.d 2.13E5 1 1 816 820
R.QVVGIAVEAK.N Y 25.83 1012.5917 10 -66.2 507.2696 2 49.90 2 20432 AEV_1_3_RA2_01_1232.d 2.25E5 4 4 221 230
R.SLGSEGVK.H Y 23.05 775.4075 8 -107.8 776.3312 1 91.20 1 50494 AEV 2_3_RA2_01_1224.d 1.64E5 1 1 397 404
K.M(+15.99)DVDENVVKAEEDGK.E Y 23.04 1692.7512 15 -74.0 565.2159 3 32.45 1 10330 AEV 2_3_RA2_01_1224.d 0 1 1 974 988 Oxidation (M)
K.FTATAALGVIHRGNLTQGQR.L Y 22.95 2110.1396 20 -36.3 423.0199 5 24.73 3 10424 AEV_3_3_RA3_01_1233.d 0 1 1 497 516
R.E(+42.01)LAALVAAK(+27.99).V Y 20.78 954.5386 9 18.7 319.1927 3 38.47 2 14735 AEV_1_3_RA2_01_1232.d 0 1 1 60 68 Acetylation (N-term); Formylation
R.HEDAMAK.F Y 20.28 800.3487 7 27.1 401.1925 2 48.57 1 19401 AEV 2_3_RA2_01_1224.d 0 1 1 821 827
R.GNLTQGQR.L Y 20.17 872.4464 8 -8.1 437.2270 2 13.01 2 3591 AEV_1_3_RA2_01_1232.d 1.27E4 1 1 509 516
K.NLDVLR.K N 19.88 728.4181 6 18.4 729.4388 1 101.28 1 56140 AEV 2_3_RA2_01_1224.d 1.39E6 5 5 231 236
R.YEPVK.R N 18.95 634.3326 5 11.5 318.1772 2 34.63 2 12910 AEV_1_3_RA2_01_1232.d 0 1 1 1034 1038
K.FTATAALGVIHR.G Y 18.58 1255.7036 12 -8.5 419.5716 3 69.43 3 39790 AEV_3_3_RA3_01_1233.d 6.81E4 1 1 497 508
R.EIIELR.A N 17.97 771.4490 6 -57.2 386.7097 2 69.56 1 33608 AEV 2_3_RA2_01_1224.d 2.46E4 1 1 1057 1062
K.NPSEPR.E Y 17.96 698.3347 6 -114.0 699.2624 1 45.54 1 17575 AEV 2_3_RA2_01_1224.d 0 1 1 1051 1056
K.IKDSLEAR.N Y 17.63 930.5134 8 -17.1 311.1731 3 37.06 3 17631 AEV_3_3_RA3_01_1233.d 0 1 1 449 456
K.AD(-18.01)EAPEK.V Y 17.41 740.3340 7 -35.9 371.1610 2 25.04 1 6566 AEV 2_3_RA2_01_1224.d 3.8E4 1 1 921 927 Dehydration
K.LILELLNEIPSPDYFSIAK.C Y 17.21 2174.1875 19 -20.4 1088.0789 2 95.24 2 49433 AEV_1_3_RA2_01_1232.d 0 1 1 283 301
K.SSNAAQVSK.S Y 16.16 890.4457 9 -7.9 446.2266 2 30.45 3 13649 AEV_3_3_RA3_01_1233.d 6.78E4 1 1 119 127
R.YAHDTQHEK.I Y 15.48 1127.4995 9 11.0 564.7632 2 80.93 1 42558 AEV 2_3_RA2_01_1224.d 1.17E4 1 1 635 643
R.KYQSVPR.M Y 15.47 876.4817 7 -16.7 439.2408 2 11.90 3 3456 AEV_3_3_RA3_01_1233.d 3.4E4 1 1 729 735
K.DGPQTEAPKRKM(+15.99)EK.E Y 15.46 1629.8145 14 -89.3 544.2302 3 77.21 1 39646 AEV 2_3_RA2_01_1224.d 0 1 1 993 1006 Oxidation (M)
R.HEDAMAKFGGALALGIIDAGGR.N Y 15.10 2169.1001 22 -24.4 543.2690 4 51.25 3 26541 AEV_3_3_RA3_01_1233.d 0 1 1 821 842
total 38 peptides
C1G3D9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.ASVGGAPINNSLGSGGSSGGYGGR.S Y 129.43 2077.9775 24 4.3 693.6694 3 64.02 2 28589 AEV_1_3_RA2_01_1232.d 3.04E5 3 3 218 241
R.SYNRTGNGADFSDQTGGYSR.R Y 92.69 2151.9207 20 19.6 718.3282 3 51.20 3 26512 AEV_3_3_RA3_01_1233.d 0 1 1 242 261
R.SYNRTGN(+.98)GADFSDQTGGYSR.R Y 92.00 2152.9045 20 -2.3 718.6405 3 56.37 3 29776 AEV_3_3_RA3_01_1233.d 8.53E4 1 1 242 261 Deamidation (NQ)
R.TGNGADFSDQTGGYSR.R Y 77.90 1631.6812 16 0.5 816.8483 2 50.53 3 26059 AEV_3_3_RA3_01_1233.d 9.49E4 2 2 246 261
R.VLTVTGPLQGAAK.A Y 68.86 1253.7343 13 -18.1 627.8630 2 67.17 3 38015 AEV_3_3_RA3_01_1233.d 7.27E4 2 2 91 103
R.GTGTVLYNPAVR.A Y 68.00 1246.6670 12 -5.0 624.3376 2 63.23 3 34916 AEV_3_3_RA3_01_1233.d 1.83E5 2 2 206 217
R.TGN(+.98)GADFSDQTGGYSR.R Y 55.51 1632.6652 16 -2.1 817.3381 2 55.86 3 29440 AEV_3_3_RA3_01_1233.d 5.4E4 1 1 246 261 Deamidation (NQ)
K.YIQDASGVR.M Y 31.10 1007.5036 9 1.4 504.7598 2 34.85 2 13005 AEV_1_3_RA2_01_1232.d 1.34E5 2 2 155 163
K.A(+42.01)GKNVADLR.D Y 28.08 984.5352 9 -22.4 493.2639 2 72.30 3 42023 AEV_3_3_RA3_01_1233.d 9.6E4 1 1 63 71 Acetylation (N-term)
R.SSGAR.I N 27.10 476.2343 5 28.1 477.2549 1 67.74 3 38451 AEV_3_3_RA3_01_1233.d 6.4E4 3 3 311 315
MASNESR.D Y 24.61 793.3389 7 -227.0 794.1660 1 14.79 1 3496 AEV 2_3_RA2_01_1224.d 0 1 1 1 7
M(+15.99)ASNESR.D Y 19.39 809.3337 7 -119.5 405.6258 2 23.40 1 5885 AEV 2_3_RA2_01_1224.d 6.47E4 1 1 1 7 Oxidation (M)
R.MVAQKEMLPQSTER.I Y 19.12 1646.8120 14 -16.7 549.9354 3 75.33 3 44385 AEV_3_3_RA3_01_1233.d 2.18E4 1 1 164 177
R.IVEVQGTPEGIEK.A Y 19.07 1397.7401 13 -91.3 699.8135 2 67.32 1 31888 AEV 2_3_RA2_01_1224.d 1.12E5 1 1 178 190
R.GGSKISEIR.R Y 17.57 945.5243 9 31.7 946.5615 1 97.98 2 50360 AEV_1_3_RA2_01_1232.d 8.43E3 1 1 301 309
K.AGVSK.V N 17.37 460.2645 5 -41.4 461.2527 1 65.17 2 29376 AEV_1_3_RA2_01_1232.d 1.59E5 1 1 78 82
K.SLLEGAPQLGMGGVVSNNGTHPVR.L Y 17.21 2389.2173 24 -6.8 598.3076 4 81.14 2 41459 AEV_1_3_RA2_01_1232.d 2.99E4 1 1 111 134
K.AYAIVAK.S Y 16.59 734.4326 7 -130.3 368.1758 2 52.00 1 21362 AEV 2_3_RA2_01_1224.d 0 1 1 104 110
R.M(+15.99)VAQK.E Y 15.77 591.3051 5 72.5 592.3552 1 99.28 2 50785 AEV_1_3_RA2_01_1232.d 0 1 1 164 168 Oxidation (M)
K.IKYIQDASGVR.M Y 15.59 1248.6826 11 -11.9 417.2299 3 37.84 2 14443 AEV_1_3_RA2_01_1232.d 0 1 1 153 163
R.V(+226.08)LTVTGPLQGAAK(+42.01).A Y 15.31 1521.8225 13 -21.8 508.2704 3 66.50 3 37461 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 91 103 Biotinylation; Acetylation (K)
R.DETGVK.A Y 15.17 647.3126 6 -52.3 648.2861 1 45.54 1 17576 AEV 2_3_RA2_01_1224.d 0 1 1 72 77
total 22 peptides
C1FYJ7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.FQSSAIGALQESVEAYLVSLFEDTNLC(+57.02)AIHAK.R Y 118.18 3510.7339 32 2.8 1171.2551 3 97.69 3 58322 AEV_3_3_RA3_01_1233.d 1.38E5 2 2 85 116 Carbamidomethylation
K.RVTIQSKDIQLAR.R Y 74.53 1526.8893 13 1.0 382.7300 4 53.38 3 27962 AEV_3_3_RA3_01_1233.d 3.62E5 4 4 117 129
R.YKPGTVALR.E Y 64.58 1003.5814 9 -1.8 502.7971 2 38.92 3 18756 AEV_3_3_RA3_01_1233.d 5.4E6 12 12 42 50
R.YKPGTVALREIR.R Y 62.45 1401.8092 12 -0.7 468.2767 3 56.10 3 29595 AEV_3_3_RA3_01_1233.d 8.76E5 3 3 42 53
K.AAPSTGGVKK(+14.02)PHR.Y Y 56.92 1318.7469 13 -6.5 660.3765 2 12.85 3 3965 AEV_3_3_RA3_01_1233.d 1.58E4 1 1 29 41 Methylation(KR)
R.EIAQDFK(+14.02)SDLR.F Y 56.71 1334.6830 11 1.0 445.9020 3 61.62 3 33686 AEV_3_3_RA3_01_1233.d 4.75E5 2 2 74 84 Methylation(KR)
R.YQKSTELLIR.K Y 55.79 1249.7030 10 -2.0 417.5741 3 53.73 3 28188 AEV_3_3_RA3_01_1233.d 1.48E5 2 2 55 64
R.VTIQSKDIQLAR.R Y 54.85 1370.7881 12 6.2 457.9395 3 59.54 3 32092 AEV_3_3_RA3_01_1233.d 3.04E5 3 3 118 129
R.EIAQDFKSDLR.F Y 53.89 1320.6674 11 21.1 441.2390 3 60.89 3 33100 AEV_3_3_RA3_01_1233.d 0 2 2 74 84
K.AAPSTGGVK(+42.02)KPHR.Y Y 53.10 1346.7531 13 19.5 337.7021 4 12.74 3 3891 AEV_3_3_RA3_01_1233.d 3.54E5 2 2 29 41 Guanidination
R.KAAPSTGGVK(+14.02)KPHR.Y Y 51.91 1446.8419 14 -30.0 483.2734 3 11.74 3 3378 AEV_3_3_RA3_01_1233.d 0 1 1 28 41 Methylation(KR)
R.YQK(+42.01)STELLIR.K Y 46.81 1291.7136 10 0.5 646.8644 2 70.70 2 33375 AEV_1_3_RA2_01_1232.d 6.17E4 1 1 55 64 Acetylation (K)
R.K(+42.01)AAPSTGGVK.K Y 45.15 956.5291 10 -5.1 479.2693 2 25.59 2 8763 AEV_1_3_RA2_01_1232.d 2.25E5 3 3 28 37 Acetylation (N-term)
K.STELLIR.K Y 40.59 830.4861 7 -1.2 416.2498 2 58.84 3 31550 AEV_3_3_RA3_01_1233.d 1.97E6 5 5 58 64
R.KAAPSTGGVK(+42.02)KPHR.Y Y 39.85 1474.8480 14 19.9 369.7266 4 11.66 3 3364 AEV_3_3_RA3_01_1233.d 2.32E5 2 2 28 41 Guanidination
R.EIAQDFK(+28.03)SDLR.F Y 38.12 1348.6986 11 -5.7 450.5709 3 61.83 3 33835 AEV_3_3_RA3_01_1233.d 6.02E5 2 2 74 84 Dimethylation(KR)
R.KSTGGKVPR.K Y 36.53 928.5454 9 -3.4 465.2784 2 9.33 3 2280 AEV_3_3_RA3_01_1233.d 1.43E5 4 4 10 18
R.KSTGGK(+42.01)VPR.K Y 35.24 970.5560 9 4.7 486.2875 2 14.35 3 4751 AEV_3_3_RA3_01_1233.d 1.46E5 1 1 10 18 Acetylation (K)
K.STGGK(+42.01)VPR.K Y 33.95 842.4610 8 -1.0 422.2374 2 20.81 3 8255 AEV_3_3_RA3_01_1233.d 2.29E5 1 1 11 18 Acetylation (K)
R.K(+42.01)QLASK(+42.01)VAR.K Y 32.07 1083.6400 9 -7.2 542.8234 2 51.57 3 26759 AEV_3_3_RA3_01_1233.d 4.39E5 1 1 19 27 Acetylation (Protein N-term); Acetylation (K)
K.AAPSTGGVK(+28.03)KPHR.Y Y 31.59 1332.7626 13 -19.4 667.3756 2 12.97 3 4025 AEV_3_3_RA3_01_1233.d 2.67E4 2 2 29 41 Dimethylation(KR)
R.EIAQDFK.S Y 29.08 849.4232 7 -87.5 425.6817 2 53.41 1 22184 AEV 2_3_RA2_01_1224.d 4.01E5 1 1 74 80
R.KAAPSTGGVK.K Y 28.02 914.5185 10 -14.4 458.2599 2 10.45 3 2744 AEV_3_3_RA3_01_1233.d 3.11E3 1 1 28 37
K.DIQLAR.R N 27.79 714.4024 6 -87.2 358.1773 2 51.23 1 20897 AEV 2_3_RA2_01_1224.d 2.53E6 7 7 124 129
R.Y(+41.03)KPGTVALR.E Y 27.44 1044.6080 9 -5.1 349.2082 3 41.75 2 16332 AEV_1_3_RA2_01_1232.d 2.38E5 2 2 42 50 Amidination of lysines or N-terminal amines with methyl acetimidate
K.AAPSTGGVKKPHR.Y Y 26.20 1304.7313 13 -19.8 435.9091 3 13.20 2 3667 AEV_1_3_RA2_01_1232.d 3.81E3 1 1 29 41
K.LPFQR.L N 23.57 659.3755 5 -0.2 330.6949 2 38.10 3 18253 AEV_3_3_RA3_01_1233.d 1.83E5 1 1 66 70
K.STGGKVPR.K Y 22.49 800.4504 8 -13.0 401.2273 2 10.24 2 2588 AEV_1_3_RA2_01_1232.d 7.02E3 1 1 11 18
R.K(+42.01)STGGK(+42.01)VPR.K Y 22.40 1012.5665 9 -13.3 507.2838 2 32.37 2 11818 AEV_1_3_RA2_01_1232.d 0 1 1 10 18 Acetylation (Protein N-term); Acetylation (K)
K.RVTIQSK.D Y 22.18 830.4974 7 0.0 416.2560 2 12.44 3 3742 AEV_3_3_RA3_01_1233.d 1.36E5 2 2 117 123
R.KQLASK(+42.01)VAR.K Y 22.17 1041.6294 9 -0.4 521.8218 2 27.68 3 12060 AEV_3_3_RA3_01_1233.d 2.33E5 2 2 19 27 Acetylation (K)
R.VT(-2.02)IQSKDIQLAR.R Y 20.98 1368.7725 12 -71.0 457.2324 3 59.53 3 32066 AEV_3_3_RA3_01_1233.d 7.09E4 1 1 118 129 2-amino-3-oxo-butanoic_acid
R.EIAQDFK(+27.99)SDLR.F Y 18.20 1348.6622 11 -53.2 450.5374 3 70.05 1 34153 AEV 2_3_RA2_01_1224.d 0 1 1 74 84 Formylation
R.Y(+43.01)K(+14.02)PGTVALR.E Y 17.37 1060.6029 9 -4.5 354.5400 3 43.71 3 21726 AEV_3_3_RA3_01_1233.d 1.46E5 1 1 42 50 Carbamylation; Methylation(KR)
R.VTIQSK.D Y 17.29 674.3963 6 -5.6 675.3998 1 96.17 2 49742 AEV_1_3_RA2_01_1232.d 0 1 1 118 123
R.KLPFQR.L Y 17.04 787.4704 6 0.1 394.7425 2 43.53 3 21615 AEV_3_3_RA3_01_1233.d 1.32E6 1 1 65 70
K.STGGK.V Y 15.47 448.2281 5 -31.3 449.2214 1 36.94 2 13993 AEV_1_3_RA2_01_1232.d 0 1 1 11 15
total 37 peptides
C1GH49
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.VIGNTFIEVFQEEAKKIAAAAK.G Y 85.17 2376.3052 22 -4.8 595.0807 4 88.56 3 53933 AEV_3_3_RA3_01_1233.d 8.12E4 1 1 319 340
R.HPFPGPGIAIR.I Y 83.02 1160.6454 11 4.0 387.8906 3 66.61 2 30374 AEV_1_3_RA2_01_1232.d 4.26E5 5 5 419 429
K.LVGEKGQVIGAVSGGVDSTVAAK.L Y 79.08 2141.1692 23 -19.1 714.7167 3 69.34 3 39726 AEV_3_3_RA3_01_1233.d 0 1 1 231 253
R.HLGVNLTVVDASER.F Y 76.34 1508.7947 14 14.2 503.9460 3 68.47 3 39022 AEV_3_3_RA3_01_1233.d 1.58E5 2 2 288 301
K.GQVIGAVSGGVDSTVAAK.L Y 64.39 1614.8577 18 -3.3 808.4335 2 66.26 3 37274 AEV_3_3_RA3_01_1233.d 2.54E4 1 1 236 253
K.ISQAFAALLPVK.A Y 62.23 1256.7493 12 -33.9 629.3606 2 81.85 2 42009 AEV_1_3_RA2_01_1232.d 0 2 2 462 473
R.LRELNIYSEMLPC(+57.02)TQK.I Y 60.84 1993.9965 16 -25.0 665.6561 3 77.73 2 38756 AEV_1_3_RA2_01_1232.d 0 1 1 36 51 Carbamidomethylation
K.AQQNWTMGEFVSQEIER.I Y 54.40 2051.9370 17 27.0 685.0048 3 81.96 2 42097 AEV_1_3_RA2_01_1232.d 0 1 1 211 227
R.LNEAAIVKETLTR.H Y 54.21 1456.8250 13 0.1 486.6156 3 71.09 2 33713 AEV_1_3_RA2_01_1232.d 1.77E5 2 2 275 287
R.EYGHANLTVK.R Y 51.81 1130.5720 10 -0.2 566.2932 2 34.96 3 16310 AEV_3_3_RA3_01_1233.d 2.09E5 4 4 115 124
K.VIGNTFIEVFQEEAKK.I Y 51.44 1850.9778 16 4.3 618.0025 3 81.68 2 41879 AEV_1_3_RA2_01_1232.d 3.52E4 1 1 319 334
R.ILGEVTPEQVR.I Y 50.89 1239.6823 11 -32.8 620.8281 2 64.66 3 36083 AEV_3_3_RA3_01_1233.d 3.79E5 3 3 430 440
K.LIEPLRELFKDEVR.E Y 43.78 1755.9883 14 -4.2 440.0025 4 80.04 3 48101 AEV_3_3_RA3_01_1233.d 1.05E5 2 2 390 403
R.VVYDITSKPPGTIEM(+15.99)E Y 43.63 1793.8757 16 -3.6 897.9419 2 70.89 3 40927 AEV_3_3_RA3_01_1233.d 4.74E4 1 1 528 543 Oxidation (M)
R.EADHIFIEEIKAAGLYR.K Y 42.56 1974.0210 17 8.1 494.5165 4 80.32 2 40814 AEV_1_3_RA2_01_1232.d 1.45E5 2 2 444 460
R.KLVGEKGQVIGAVSGGVDSTVAAK.L Y 41.91 2269.2642 24 0.5 568.3236 4 67.62 2 31091 AEV_1_3_RA2_01_1232.d 4.77E4 1 1 230 253
R.ELGVQLGIPEELVWR.H Y 40.02 1736.9460 15 -5.6 869.4755 2 88.03 3 53632 AEV_3_3_RA3_01_1233.d 5.04E3 1 1 404 418
K.G(+42.01)IKDDPER.K Y 37.22 970.4719 8 -66.6 486.2109 2 67.46 1 32048 AEV 2_3_RA2_01_1224.d 0 1 1 308 315 Acetylation (N-term)
R.VHDQVIALR.A Y 35.55 1049.5981 9 -72.8 350.8478 3 64.65 1 29995 AEV 2_3_RA2_01_1224.d 1.08E5 3 3 483 491
R.KISQAFAALLPVK.A Y 29.03 1384.8441 13 -85.6 462.5825 3 87.71 1 47884 AEV 2_3_RA2_01_1224.d 1.08E5 1 1 461 473
R.HLGVNLTVVDASERFLGK.L Y 26.42 1954.0636 18 -81.3 489.4835 4 87.58 1 47788 AEV 2_3_RA2_01_1224.d 1.29E5 1 1 288 305
K.AVGVM(+15.99)GDQR.V Y 24.14 947.4495 9 -117.8 474.6762 2 26.60 1 7266 AEV 2_3_RA2_01_1224.d 9.43E4 2 2 474 482 Oxidation (M)
K.SVSAGDK.R Y 24.02 662.3235 7 42.8 663.3591 1 42.55 3 20997 AEV_3_3_RA3_01_1233.d 0 1 1 107 113
R.NFAVR.I Y 22.59 605.3285 5 -86.8 303.6453 2 41.20 1 15108 AEV 2_3_RA2_01_1224.d 5.42E4 1 1 203 207
K.EAIGDRFHAVLVDNGVLR.L Y 20.22 1980.0541 18 13.5 496.0275 4 78.72 2 39536 AEV_1_3_RA2_01_1232.d 6.22E4 1 1 257 274
K.EAIGDR.F N 18.12 659.3239 6 53.6 660.3665 1 67.64 2 31107 AEV_1_3_RA2_01_1232.d 0 1 1 257 262
K.AVGVMGDQR.V Y 18.09 931.4545 9 0.2 466.7346 2 31.47 3 14248 AEV_3_3_RA3_01_1233.d 1.25E5 1 1 474 482
K.AAGLYR.K Y 17.45 649.3547 6 -34.5 325.6734 2 33.69 1 11027 AEV 2_3_RA2_01_1224.d 5.62E5 1 1 455 460
K.IADLSWKPK.G Y 16.85 1056.5967 9 -0.6 353.2060 3 60.31 3 32640 AEV_3_3_RA3_01_1233.d 1.86E5 1 1 52 60
R.IVNEVKGVC(+57.02)R.V Y 16.73 1172.6335 10 -23.2 587.3104 2 34.28 3 15895 AEV_3_3_RA3_01_1233.d 0 1 1 518 527 Carbamidomethylation
K.ETLTR.H Y 15.39 618.3337 5 -11.0 619.3342 1 63.16 2 27990 AEV_1_3_RA2_01_1232.d 0 1 1 283 287
total 31 peptides
A0A0A0HV89
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.SYEDLIALHEIGEYPLGR.M Y 122.83 2074.0371 18 7.8 692.3584 3 83.05 2 42930 AEV_1_3_RA2_01_1232.d 6.24E5 6 6 211 228
R.NTLNAYLDGTGK.G Y 78.59 1265.6251 12 2.8 633.8216 2 65.50 3 36678 AEV_3_3_RA3_01_1233.d 5.08E5 3 3 427 438
R.TGEADALLTGER.T Y 64.30 1231.6044 12 -15.5 616.7999 2 62.84 3 34608 AEV_3_3_RA3_01_1233.d 5.83E4 3 3 19 30
R.LLNNVYPSLEEMTR.M Y 63.26 1677.8396 14 -0.1 839.9270 2 80.29 3 48291 AEV_3_3_RA3_01_1233.d 2.1E5 2 2 305 318
R.Q(-17.03)FESHLPVDDILVLDKHHIGTSR.T Y 56.54 2638.3503 23 -40.2 528.6561 5 79.88 3 47972 AEV_3_3_RA3_01_1233.d 0 1 1 113 135 Pyro-glu from Q
R.NTLNAYLDGTGKGASGPER.Q Y 55.60 1919.9337 19 5.7 640.9888 3 63.52 2 28238 AEV_1_3_RA2_01_1232.d 7.23E4 2 2 427 445
K.GSC(+57.02)RADDIDVVK.L Y 55.35 1333.6296 12 1.4 667.8230 2 41.23 3 20154 AEV_3_3_RA3_01_1233.d 1.93E5 2 2 248 259 Carbamidomethylation
K.M(+15.99)GENVDLPLLGLLAPK.D Y 55.18 1694.9276 16 -10.5 848.4622 2 90.58 2 47506 AEV_1_3_RA2_01_1232.d 2.9E4 1 1 280 295 Oxidation (M)
R.SYEDLIALHE(+14.02)IGEYPLGR.M Y 51.60 2088.0527 18 5.3 697.0286 3 84.55 2 44008 AEV_1_3_RA2_01_1232.d 1.43E4 1 1 211 228 Methylation(others)
K.LGPGEKPTGK.R Y 42.57 982.5447 10 -45.1 492.2574 2 16.85 3 6122 AEV_3_3_RA3_01_1233.d 4.49E4 1 1 80 89
K.MGENVDLPLLGLLAPK.D Y 40.12 1678.9327 16 -2.3 840.4717 2 91.93 2 48138 AEV_1_3_RA2_01_1232.d 5.06E4 1 1 280 295
K.G(+42.01)ASGPER.Q Y 33.72 714.3297 7 40.3 715.3657 1 78.33 3 46763 AEV_3_3_RA3_01_1233.d 0 1 1 439 445 Acetylation (N-term)
R.M(+15.99)VDLM(+15.99)IGGGR.C Y 28.61 1079.5104 10 -30.6 540.7460 2 78.12 1 40346 AEV 2_3_RA2_01_1224.d 1.42E5 1 1 229 238 Oxidation (M)
K.RDGLRQSYC(+57.02)S Y 21.83 1240.5619 10 -69.8 621.2449 2 50.88 1 20703 AEV 2_3_RA2_01_1224.d 0 1 1 589 598 Carbamidomethylation
K.NASGPGK.L Y 21.27 629.3132 7 4.6 630.3234 1 70.32 3 40476 AEV_3_3_RA3_01_1233.d 0 1 1 73 79
K.LDTYHGDFK.R Y 20.87 1094.5033 9 -48.7 548.2323 2 72.34 1 35833 AEV 2_3_RA2_01_1224.d 2.02E5 1 1 577 585
K.QAGYMTGLVVTTR.I Y 20.38 1395.7180 13 -26.0 698.8481 2 71.87 2 34250 AEV_1_3_RA2_01_1232.d 6.09E4 1 1 182 194
K.DSTPGILVATSDHETGGLSIAR.Q Y 20.36 2196.1023 22 19.8 733.0558 3 76.78 2 38003 AEV_1_3_RA2_01_1232.d 0 1 1 377 398
K.DIPYEIDRR.L Y 19.37 1175.5934 9 0.1 588.8040 2 59.66 3 32164 AEV_3_3_RA3_01_1233.d 9.5E4 2 2 296 304
R.ADDIDVVKLAK.A Y 17.84 1185.6604 11 -147.1 1186.4933 1 112.50 1 59482 AEV 2_3_RA2_01_1224.d 2.7E4 1 1 252 262
total 20 peptides
C1G647
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AYTIENTSIPVNPR.T Y 109.34 1573.8099 14 0.0 787.9122 2 70.60 2 33298 AEV_1_3_RA2_01_1232.d 3.39E5 5 5 63 76
R.KPEPAEHKGDAVSGGEGTSGGESR.K Y 102.08 2338.0784 24 4.6 585.5295 4 19.87 2 6354 AEV_1_3_RA2_01_1232.d 1.3E6 6 6 118 141
R.LYIGNLAYATTEGELKDFFK.A Y 80.49 2292.1677 20 11.6 765.0720 3 87.77 3 53482 AEV_3_3_RA3_01_1233.d 1.83E5 1 1 43 62
K.VAIDSPGKEDDASFEER.S Y 71.68 1863.8486 17 2.8 622.2919 3 60.15 3 32526 AEV_3_3_RA3_01_1233.d 9.17E4 2 2 304 320
R.VHKEN(+.98)GEHAEAATEGAPLADVTNETGDASKDSK.G Y 59.95 3378.5447 33 -5.3 676.7126 5 59.23 2 25385 AEV_1_3_RA2_01_1232.d 2.07E4 1 1 165 197 Deamidation (NQ)
R.GPPEDGIPSK.T Y 59.16 995.4923 10 4.1 498.7555 2 37.47 2 14267 AEV_1_3_RA2_01_1232.d 9.95E5 6 6 207 216
K.IALRPIPR.F Y 44.20 934.6075 8 -1.3 312.5427 3 53.20 3 27891 AEV_3_3_RA3_01_1233.d 3.74E5 3 3 247 254
K.AVAEMHGK.E Y 42.27 841.4116 8 -60.6 421.6876 2 68.73 1 32996 AEV 2_3_RA2_01_1224.d 5.2E5 1 1 286 293
K.I(+42.01)ALRPIPR.F Y 38.52 976.6182 8 -73.0 326.5229 3 53.22 3 27862 AEV_3_3_RA3_01_1233.d 4.82E5 1 1 247 254 Acetylation (N-term)
R.GPPEDGIPSKTK.V Y 37.77 1224.6350 12 -88.3 409.1829 3 40.76 1 14850 AEV 2_3_RA2_01_1224.d 3.13E5 2 2 207 218
K.GDAVSGGEGTSGGESR.K Y 33.20 1421.6018 16 -81.8 711.7500 2 24.77 1 6446 AEV 2_3_RA2_01_1224.d 2.47E4 1 1 126 141
R.KPEPAEHK.G Y 28.39 934.4872 8 -101.3 468.2036 2 99.39 1 55468 AEV 2_3_RA2_01_1224.d 2.35E5 2 2 118 125
K.GRGFGFVTLGSEALQAK.A Y 18.71 1736.9209 17 -14.4 435.2313 4 36.22 3 17078 AEV_3_3_RA3_01_1233.d 4.27E5 1 1 269 285
K.VAIDSPGK.E Y 18.17 785.4283 8 37.8 786.4652 1 108.95 1 58458 AEV 2_3_RA2_01_1224.d 0 1 1 304 311
K.EDDASFEER.S Y 16.62 1096.4309 9 -60.5 549.1896 2 52.19 1 21471 AEV 2_3_RA2_01_1224.d 0 1 1 312 320
K.KLLAR.G N 15.80 599.4119 5 -4.8 600.4163 1 15.12 3 5183 AEV_3_3_RA3_01_1233.d 1.08E4 1 1 259 263
total 16 peptides
A0A0A0HT57
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.HTC(+57.02)SSC(+57.02)GYPSAK.T Y 130.44 1353.5442 12 8.2 452.1924 3 16.02 2 4748 AEV_1_3_RA2_01_1232.d 2.28E6 13 13 77 88 Carbamidomethylation
K.HTC(+57.02)SSC(+57.02)GYPSAK(+14.02).T Y 87.47 1367.5598 12 3.1 684.7893 2 20.87 3 8294 AEV_3_3_RA3_01_1233.d 8.2E4 1 1 77 88 Carbamidomethylation; Methylation(KR)
R.SLHIQKHTC(+57.02)SSC(+57.02)GYPSAK.T Y 84.07 2059.9568 18 1.3 687.6604 3 33.68 3 15551 AEV_3_3_RA3_01_1233.d 9.02E5 7 7 71 88 Carbamidomethylation
K.FKNGFQTGTPK.G Y 82.15 1223.6299 11 2.3 612.8236 2 36.53 3 17307 AEV_3_3_RA3_01_1233.d 1.87E6 9 9 119 129
K.FKN(+.98)GFQTGTPK.G Y 77.04 1224.6139 11 2.8 613.3159 2 41.73 3 20482 AEV_3_3_RA3_01_1233.d 3.04E6 5 5 119 129 Deamidation (NQ)
K.NGFQTGTPK.G Y 65.80 948.4665 9 0.5 475.2408 2 26.07 3 11175 AEV_3_3_RA3_01_1233.d 1.98E6 11 11 121 129
K.N(+.98)GFQTGTPK.G Y 58.25 949.4505 9 -0.4 475.7323 2 31.98 3 14557 AEV_3_3_RA3_01_1233.d 2.52E6 11 11 121 129 Deamidation (NQ)
R.HNKTHTLC(+57.02)R.R Y 49.99 1165.5775 9 2.1 583.7972 2 10.49 3 2759 AEV_3_3_RA3_01_1233.d 1.66E5 4 4 57 65 Carbamidomethylation
K.YNWGEK.A Y 41.30 795.3551 6 3.3 398.6862 2 35.36 3 16564 AEV_3_3_RA3_01_1233.d 1.2E6 4 4 92 97
K.YNWGEK(+14.02).A Y 33.57 809.3708 6 0.9 405.6930 2 47.74 3 24278 AEV_3_3_RA3_01_1233.d 1.54E5 1 1 92 97 Methylation(KR)
R.SLHIQK.H Y 31.81 724.4232 6 -0.7 363.2186 2 15.65 3 5484 AEV_3_3_RA3_01_1233.d 8.71E5 4 4 71 76
K.THTLC(+57.02)R.R Y 30.17 786.3807 6 -61.4 394.1735 2 25.57 1 6789 AEV 2_3_RA2_01_1224.d 5.62E4 2 2 60 65 Carbamidomethylation
K.THTLC(+57.02)RR.C Y 26.65 942.4818 7 -1.1 472.2476 2 10.23 2 2568 AEV_1_3_RA2_01_1232.d 5.63E4 2 2 60 66 Carbamidomethylation
R.KFK(+71.04)NGFQTGTPK.G Y 26.25 1422.7620 12 -37.5 475.2435 3 32.19 3 14689 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 118 129 Propionamide (K, X@N-term)
R.KYNWGEK.A Y 24.64 923.4501 7 0.0 462.7323 2 22.67 3 9248 AEV_3_3_RA3_01_1233.d 4.23E5 2 2 91 97
R.RSLHIQK.H Y 23.53 880.5243 7 -26.2 441.2579 2 14.09 3 4627 AEV_3_3_RA3_01_1233.d 0 1 1 70 76
K.NGFQTGTPK(+14.02).G Y 22.88 962.4821 9 -0.3 482.2482 2 38.26 3 18347 AEV_3_3_RA3_01_1233.d 1.18E5 1 1 121 129 Methylation(KR)
K.F(+42.01)KNGFQTGTPK.G Y 22.62 1265.6404 11 8.5 422.8910 3 40.80 3 19877 AEV_3_3_RA3_01_1233.d 8.65E4 1 1 119 129 Acetylation (N-term)
R.HNK(+14.02)T(-18.01)HTLC(+57.02)R.R Y 20.27 1161.5825 9 32.1 388.2139 3 10.53 3 2777 AEV_3_3_RA3_01_1233.d 1.06E4 1 1 57 65 Methylation(KR); Dehydration; Carbamidomethylation
R.GPEKH Y 17.64 566.2812 5 -18.5 567.2781 1 20.31 3 7975 AEV_3_3_RA3_01_1233.d 1.46E5 3 3 133 137
K.FKN(+.98)GFQT(+79.97)GTPK.G Y 15.50 1304.5802 11 48.7 327.1682 4 25.57 2 8753 AEV_1_3_RA2_01_1232.d 0 1 1 119 129 Deamidation (NQ); Phosphorylation (STY)
total 21 peptides
C1GE59
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.ALEELNYLAC(+57.02)LDDDGNLTPLGR.L Y 95.15 2461.1794 22 1.9 1231.5994 2 88.31 3 53779 AEV_3_3_RA3_01_1233.d 2.34E3 1 1 499 520 Carbamidomethylation
R.THPVEIFYTPEPEQDYVEAAIR.T Y 85.23 2603.2544 22 -7.3 868.7524 3 81.28 3 49047 AEV_3_3_RA3_01_1233.d 9.26E4 1 1 274 295
K.TTQIPQFVLFDDLPHQR.G Y 80.01 2054.0586 17 2.3 685.6951 3 83.08 3 50370 AEV_3_3_RA3_01_1233.d 2.17E5 2 2 126 142
R.IRVESLLVSPISK.A Y 77.77 1439.8711 13 2.6 480.9656 3 77.00 2 38184 AEV_1_3_RA2_01_1232.d 4.74E4 1 1 411 423
K.SPEAQANPR.Q Y 44.24 968.4675 9 13.8 485.2477 2 13.44 2 3754 AEV_1_3_RA2_01_1232.d 2.58E4 2 2 596 604
K.TETADMDPR.Q Y 28.99 1034.4338 9 72.3 1035.5159 1 100.08 1 55722 AEV 2_3_RA2_01_1224.d 8.7E5 8 8 20 28
R.EAM(+15.99)HDHDLK.R Y 28.28 1110.4764 9 -7.9 556.2411 2 58.80 1 25634 AEV 2_3_RA2_01_1224.d 2.49E4 1 1 202 210 Oxidation (M)
R.A(+42.01)LQSADNVR.Q Y 27.12 1014.5094 9 9.2 508.2667 2 18.04 3 6779 AEV_3_3_RA3_01_1233.d 1.13E4 1 1 616 624 Acetylation (N-term)
R.VAAM(+15.99)SVAER.V Y 26.03 948.4698 9 -133.4 475.1789 2 26.52 1 7231 AEV 2_3_RA2_01_1224.d 5.19E4 1 1 154 162 Oxidation (M)
K.ISLEVDEM(+15.99)IREADAGPMK.V Y 23.53 2018.9652 18 11.5 674.0034 3 62.50 3 34349 AEV_3_3_RA3_01_1233.d 7.63E3 1 1 326 343 Oxidation (M)
K.VYNPR.I N 23.30 647.3391 5 -10.7 648.3395 1 25.48 2 8720 AEV_1_3_RA2_01_1232.d 2.48E6 3 3 406 410
R.IFEPAPPPR.K Y 22.13 1022.5549 9 -16.1 341.8534 3 27.19 3 11795 AEV_3_3_RA3_01_1233.d 0 1 1 359 367
R.QKTETADM(+15.99)DPRQNK.Y Y 20.37 1676.7788 14 -56.2 420.1784 4 39.53 1 14139 AEV 2_3_RA2_01_1224.d 8.88E4 1 1 18 31 Oxidation (M)
K.ELIEQTYPEILR.S Y 20.25 1502.7980 12 -36.2 752.3790 2 78.39 3 46857 AEV_3_3_RA3_01_1233.d 5.69E4 1 1 453 464
K.EGGRPGR.K Y 20.00 727.3725 7 -21.2 364.6858 2 34.33 1 11342 AEV 2_3_RA2_01_1224.d 3.61E5 3 3 369 375
R.RVAAM(+15.99)SVAER.V Y 20.00 1104.5709 10 3.7 553.2948 2 41.91 3 20600 AEV_3_3_RA3_01_1233.d 1.84E4 1 1 153 162 Oxidation (M)
K.LVAC(+57.02)TQPR.R Y 18.79 943.4909 8 -74.4 315.4808 3 44.56 1 17040 AEV 2_3_RA2_01_1224.d 2.66E5 1 1 145 152 Carbamidomethylation
R.ALQSADNVR.Q Y 17.78 972.4988 9 -44.3 487.2352 2 41.13 1 15068 AEV 2_3_RA2_01_1224.d 0 1 1 616 624
R.VAAEMDVKLGEEVGYSIR.F Y 17.66 1964.9877 18 -4.7 492.2519 4 69.43 3 39794 AEV_3_3_RA3_01_1233.d 8.44E4 1 1 163 180
R.KEKM(+15.99)RADK.E Y 17.44 1020.5386 8 -6.8 511.2731 2 56.02 2 23548 AEV_1_3_RA2_01_1232.d 1.93E5 1 1 756 763 Oxidation (M)
R.RVAAMSVAER.V Y 16.35 1088.5760 10 -2.5 363.8651 3 41.74 3 20492 AEV_3_3_RA3_01_1233.d 0 1 1 153 162
M(+15.99)GDQR.L Y 16.29 621.2540 5 4.5 622.2641 1 24.07 3 10037 AEV_3_3_RA3_01_1233.d 3.13E4 1 1 1 5 Oxidation (M)
R.ALVAGFFM(+15.99)QVAK.K Y 15.79 1296.6899 12 -57.4 649.3151 2 92.36 1 51321 AEV 2_3_RA2_01_1224.d 2.34E4 1 1 655 666 Oxidation (M)
K.TTAAMAR.E Y 15.73 720.3589 7 -43.7 361.1710 2 56.30 1 24006 AEV 2_3_RA2_01_1224.d 2.13E5 1 1 61 67
R.RALVAGFFM(+15.99)QVAK.K Y 15.31 1452.7911 13 -2.3 364.2042 4 49.54 2 20214 AEV_1_3_RA2_01_1232.d 0 1 1 654 666 Oxidation (M)
total 25 peptides
C1G4K3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.VLGTNPNPSQAPR.A Y 129.36 1349.7051 13 3.0 675.8618 2 47.94 2 19448 AEV_1_3_RA2_01_1232.d 1.08E6 7 7 21 33
R.APLPHQVNSQANAGR.T Y 127.43 1558.7964 15 3.1 520.6077 3 35.46 2 13342 AEV_1_3_RA2_01_1232.d 1.22E6 9 9 34 48
R.APLPHQVNSQ(+.98)ANAGR.T Y 58.24 1559.7804 15 -3.7 520.9321 3 37.38 3 17819 AEV_3_3_RA3_01_1233.d 0 1 1 34 48 Deamidation (NQ)
R.VLGTNPNPSQ(+.98)APR.A Y 56.39 1350.6891 13 1.2 676.3526 2 49.22 3 25232 AEV_3_3_RA3_01_1233.d 5.01E4 1 1 21 33 Deamidation (NQ)
R.VLGTNPNPSQAPR(+14.02).A Y 56.20 1363.7208 13 -1.2 682.8669 2 57.34 2 24274 AEV_1_3_RA2_01_1232.d 1.96E4 1 1 21 33 Methylation(KR)
R.NAAAR.A Y 25.49 501.2659 5 -0.3 502.2731 1 54.90 3 28929 AEV_3_3_RA3_01_1233.d 1.1E5 2 2 65 69
R.TLGGSQGSSR.G Y 24.19 948.4625 10 7.8 949.4771 1 94.64 3 57068 AEV_3_3_RA3_01_1233.d 7.9E4 2 2 49 58
R.GNDDPR.N Y 21.29 672.2827 6 -31.4 673.2689 1 21.02 1 5057 AEV 2_3_RA2_01_1224.d 7.54E3 1 1 59 64
R.TLGGSQGSSRGNDDPR.N Y 20.18 1602.7346 16 -52.3 802.3326 2 79.12 1 41190 AEV 2_3_RA2_01_1224.d 2.47E4 1 1 49 64
R.APLPHQVN(+.98)SQANAGR.T Y 19.45 1559.7804 15 -85.7 520.8895 3 50.73 1 20616 AEV 2_3_RA2_01_1224.d 6.91E4 1 1 34 48 Deamidation (NQ)
K.AYNPTEPFAHPGR.V Y 16.85 1455.6895 13 31.9 486.2526 3 60.20 3 32558 AEV_3_3_RA3_01_1233.d 0 1 1 8 20
R.LAAQK.A N 16.34 529.3224 5 -385.5 530.1256 1 17.04 1 4030 AEV 2_3_RA2_01_1224.d 0 1 1 91 95
K.Q(+42.01)ASAAK.K Y 16.17 616.3180 6 90.3 617.3809 1 100.55 1 55893 AEV 2_3_RA2_01_1224.d 0 1 1 78 83 Acetylation (N-term)
R.AAEERAVK.Q Y 16.11 872.4716 8 -25.8 437.2318 2 23.79 2 7966 AEV_1_3_RA2_01_1232.d 0 1 1 70 77
total 14 peptides
C1GCV9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AAFPFVDC(+57.02)ETGDTSDVVQDMLR.G Y 102.63 2472.0938 22 -3.5 1237.0498 2 88.41 3 53837 AEV_3_3_RA3_01_1233.d 1.07E5 2 2 108 129 Carbamidomethylation
K.YGLLYHSSFIGR.A Y 81.53 1411.7249 12 6.3 471.5852 3 74.28 2 36086 AEV_1_3_RA2_01_1232.d 1.4E5 2 2 355 366
K.YPASTVQILGAEK.A Y 74.19 1375.7347 13 1.8 688.8759 2 69.62 2 32562 AEV_1_3_RA2_01_1232.d 1.14E5 2 2 328 340
R.IDNFSETPSTK.F Y 58.17 1237.5826 11 1.2 619.7993 2 48.57 2 19734 AEV_1_3_RA2_01_1232.d 2.54E5 4 4 389 399
R.KSDSAAEVETPK.K Y 52.20 1260.6198 12 -68.1 421.1852 3 33.13 1 10697 AEV 2_3_RA2_01_1224.d 0 1 1 493 504
R.VLLFVK.S Y 31.82 717.4789 6 -5.5 359.7448 2 71.22 2 33758 AEV_1_3_RA2_01_1232.d 8.38E4 2 2 219 224
M.A(+42.01)DYLLFEGPMGYSLFK.V Y 30.17 1891.9066 16 2.9 946.9633 2 97.76 3 58326 AEV_3_3_RA3_01_1233.d 3.27E4 1 1 2 17 Acetylation (Protein N-term)
R.EGDLNTAQLGLGHAYSR.A Y 22.69 1800.8755 17 -82.1 601.2498 3 73.87 1 36991 AEV 2_3_RA2_01_1224.d 1.48E5 1 1 144 160
R.LISHAGSLTNLSK.Y Y 21.94 1339.7460 13 -32.5 335.9329 4 15.18 3 5213 AEV_3_3_RA3_01_1233.d 1.71E5 1 1 315 327
K.SDSAAEVETPK.K Y 21.21 1132.5248 11 -101.9 378.4771 3 25.35 1 6697 AEV 2_3_RA2_01_1224.d 4.08E5 2 2 494 504
R.FLANK.C Y 20.54 591.3380 5 -124.6 592.2716 1 33.58 1 10962 AEV 2_3_RA2_01_1224.d 0 1 1 378 382
K.R(+42.01)DSEAGSSK(+42.01).K Y 20.53 1019.4519 9 15.2 510.7410 2 30.08 3 13433 AEV_3_3_RA3_01_1233.d 1.81E5 1 1 509 517 Acetylation (N-term); Acetylation (K)
R.THAGK.L Y 20.27 512.2707 5 -14.0 513.2708 1 48.84 3 24976 AEV_3_3_RA3_01_1233.d 2.71E5 3 3 133 137
R.IVSDNQR.Y Y 19.47 830.4246 7 -50.5 416.1986 2 70.24 1 34180 AEV 2_3_RA2_01_1224.d 0 1 1 209 215
K.NEVAM(+15.99)K.N Y 17.83 706.3320 6 38.8 707.3666 1 81.08 3 48901 AEV_3_3_RA3_01_1233.d 0 1 1 424 429 Oxidation (M)
K.G(+42.01)NTPK.Y Y 16.05 557.2809 5 17.8 558.2981 1 30.95 2 11150 AEV_1_3_RA2_01_1232.d 2.86E3 1 1 350 354 Acetylation (N-term)
R.LEFYATGAAPTKNEVAMK.N Y 15.56 1939.9713 18 1.8 647.6655 3 82.42 2 42441 AEV_1_3_RA2_01_1232.d 0 1 1 412 429
total 17 peptides
C1G4T5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.SLDPLMEVALTSVPR.E Y 102.33 1626.8651 15 -5.5 814.4354 2 86.97 3 52977 AEV_3_3_RA3_01_1233.d 0 1 1 182 196
K.GGAGLSAYANDPVAAAK.S Y 84.46 1531.7631 17 3.9 766.8918 2 67.28 2 30847 AEV_1_3_RA2_01_1232.d 1.77E5 2 2 165 181
R.EYQAC(+57.02)SPVAVK.A Y 69.05 1250.5964 11 -0.6 626.3051 2 51.84 3 26947 AEV_3_3_RA3_01_1233.d 3.02E5 5 5 197 207 Carbamidomethylation
R.SSVPATINTPVSSTK.C Y 51.94 1487.7831 15 -24.6 744.8805 2 60.44 3 32742 AEV_3_3_RA3_01_1233.d 0 1 1 97 111
R.ETIHQAVVEAK.H Y 42.77 1223.6510 11 -23.7 612.8183 2 36.26 3 17106 AEV_3_3_RA3_01_1233.d 0 1 1 341 351
K.VVEVNMTGPK.D Y 38.62 1072.5587 10 -7.1 537.2828 2 55.22 2 23140 AEV_1_3_RA2_01_1232.d 1.04E5 2 2 392 401
K.VVEVNMTGPKDIPSAAQC(+57.02)R.G Y 29.41 2071.0190 19 34.8 518.7800 4 80.73 3 48701 AEV_3_3_RA3_01_1233.d 0 2 2 392 410 Carbamidomethylation
MPTGVNSR.N Y 29.14 860.4174 8 -78.6 861.3571 1 95.58 1 53510 AEV 2_3_RA2_01_1224.d 1.36E5 1 1 1 8
K.DIPSAAQC(+57.02)R.G Y 25.87 1016.4709 9 -83.7 509.2002 2 42.51 1 15888 AEV 2_3_RA2_01_1224.d 1.32E5 1 1 402 410 Carbamidomethylation
R.DPFEKADR.H Y 23.37 976.4614 8 -3.6 489.2362 2 29.06 3 12849 AEV_3_3_RA3_01_1233.d 1.61E6 4 4 37 44
K.A(+42.01)TAGLR.F Y 23.24 629.3497 6 8.9 315.6849 2 47.94 1 19049 AEV 2_3_RA2_01_1224.d 2.86E5 2 2 208 213 Acetylation (N-term)
K.SVNGAAPEQLAEGAHK.F Y 21.01 1577.7798 16 -84.8 526.8893 3 77.38 1 39760 AEV 2_3_RA2_01_1224.d 0 1 1 299 314
R.GGIEIMDGK.Y Y 18.96 918.4481 9 0.6 460.2316 2 20.24 3 7948 AEV_3_3_RA3_01_1233.d 5.88E4 1 1 245 253
K.TFAQEDLYIMSYFYDR.T Y 18.89 2060.9189 16 -9.6 516.2321 4 82.67 1 43926 AEV 2_3_RA2_01_1224.d 7.31E4 1 1 441 456
K.VVEVNM(+15.99)TGPK.D Y 18.76 1088.5536 10 11.2 545.2902 2 32.88 3 15085 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 392 401 Oxidation (M)
K.SVRDPFEKADR.H Y 17.24 1318.6628 11 2.9 660.3406 2 65.95 3 37023 AEV_3_3_RA3_01_1233.d 0 1 1 34 44
R.VGIWSYLPFGSSPRR.R Y 15.53 1720.9049 15 37.3 431.2495 4 30.46 3 13656 AEV_3_3_RA3_01_1233.d 0 1 1 11 25
total 17 peptides
C1GLM4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.IVDSAFTIAFDPVYDNLLAAVKDATNTGIK.Q Y 98.11 3181.6545 30 -0.5 1061.5582 3 95.62 3 57486 AEV_3_3_RA3_01_1233.d 1.68E5 2 2 224 253
R.ALTGYPGLEEGDNLR.G Y 73.94 1603.7842 15 0.8 802.9000 2 72.73 2 34912 AEV_1_3_RA2_01_1232.d 3.33E5 4 4 164 178
K.AIKPGQTLTEIAEGIEESVR.A Y 73.82 2140.1375 20 -0.3 714.3862 3 86.30 2 45177 AEV_1_3_RA2_01_1232.d 1.2E5 1 1 144 163
M.A(+42.01)AQVASGVGNLNLNSEDGAAAK.N Y 66.43 2098.0291 22 -0.2 1050.0216 2 78.61 3 46987 AEV_3_3_RA3_01_1233.d 8.17E4 2 2 2 23 Acetylation (Protein N-term)
K.IPDAPNVPLR.L Y 57.49 1090.6134 10 -41.3 546.2914 2 66.97 3 37838 AEV_3_3_RA3_01_1233.d 0 2 2 353 362
K.NLLNVITK.N Y 40.71 913.5596 8 -6.2 457.7842 2 72.92 2 35055 AEV_1_3_RA2_01_1232.d 1.25E5 2 2 368 375
K.SVPIVK.G N 25.77 641.4112 6 -21.3 642.4048 1 31.16 3 14066 AEV_3_3_RA3_01_1233.d 0 1 1 310 315
R.IVDSAFTIAFDPVYDNLLAAVK.D Y 24.61 2381.2517 22 -14.0 1191.6165 2 94.91 2 49303 AEV_1_3_RA2_01_1232.d 2.65E4 1 1 224 245
K.V(+42.01)QT(+79.97)EPPR.V Y 20.76 947.4113 7 180.2 948.5894 1 110.88 1 59006 AEV 2_3_RA2_01_1224.d 0 1 1 74 80 Acetylation (N-term); Phosphorylation (STY)
K.VQTEPPR.V Y 19.41 825.4344 7 -119.8 826.3428 1 88.29 1 48331 AEV 2_3_RA2_01_1224.d 9.91E4 1 1 74 80
K.M(+15.99)VLQYEDVM(+15.99)K.V Y 18.05 1286.5886 10 -13.6 644.2928 2 75.64 1 38381 AEV 2_3_RA2_01_1224.d 1.86E5 1 1 204 213 Oxidation (M)
K.NISAQGSPENEAR.E Y 16.96 1371.6378 13 -30.4 458.2060 3 85.23 1 45966 AEV 2_3_RA2_01_1224.d 0 1 1 24 36
total 12 peptides
C1GG77
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.SC(+57.02)YDIESTFTC(+57.02)LPASIYC(+57.02)NNALIGPYQK.T Y 126.46 3284.4827 28 6.3 1095.8417 3 88.94 2 46706 AEV_1_3_RA2_01_1232.d 3.69E5 3 3 349 376 Carbamidomethylation
K.AVDPSDLGIDKVK.Q Y 77.85 1355.7296 13 -2.0 678.8707 2 64.40 3 35802 AEV_3_3_RA3_01_1233.d 9.47E5 5 5 132 144
R.LVPSLLAR.I Y 42.97 867.5541 8 -1.2 434.7838 2 69.66 2 32594 AEV_1_3_RA2_01_1232.d 4.13E5 3 3 445 452
R.I(+42.01)K(+226.08)AVDPSDLGIDKVK.Q Y 38.36 1864.9968 15 -2.4 467.2553 4 64.53 3 35905 AEV_3_3_RA3_01_1233.d 0 1 1 130 144 Acetylation (N-term); Biotinylation
K.SC(+57.02)YDIE(+14.02)STFTC(+57.02)LPASIYC(+57.02)NNALIGPYQK.T Y 35.04 3298.4985 28 13.1 1100.5212 3 90.57 2 47502 AEV_1_3_RA2_01_1232.d 1.69E4 1 1 349 376 Carbamidomethylation; Methylation(others)
K.TGRNPYDVR.T Y 31.20 1076.5363 9 0.4 539.2756 2 24.81 3 10503 AEV_3_3_RA3_01_1233.d 9.04E5 4 4 377 385
R.NPYDVR.T Y 18.21 762.3660 6 -83.1 382.1586 2 37.06 1 12738 AEV 2_3_RA2_01_1224.d 1.31E5 1 1 380 385
total 7 peptides
C1G1P0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.TTILIDDLADTSNTITR.A Y 84.44 1861.9633 17 -0.5 931.9884 2 81.10 3 48915 AEV_3_3_RA3_01_1233.d 1.87E5 3 3 353 369
K.RVTAVLPLFPYSR.Q Y 80.23 1517.8718 13 5.0 506.9671 3 79.51 2 40169 AEV_1_3_RA2_01_1232.d 3.59E4 1 1 85 97
R.VTAVLPLFPYSR.Q Y 61.77 1361.7706 12 1.5 681.8936 2 83.46 2 43222 AEV_1_3_RA2_01_1232.d 1.17E5 2 2 86 97
R.SDNSANYTFESTPPTPHAGKAESIGLTSDGLQK.G Y 57.98 3419.6116 33 7.1 855.9162 4 71.61 3 41492 AEV_3_3_RA3_01_1233.d 1.25E5 2 2 118 150
R.SDTIDTTKSDTSNR.S Y 57.68 1539.7013 14 0.2 514.2411 3 19.35 3 7485 AEV_3_3_RA3_01_1233.d 1.03E5 1 1 184 197
R.INASALDKVVVTNTVAQDVHK.V Y 53.33 2221.2065 21 -13.7 556.3013 4 71.20 3 41167 AEV_3_3_RA3_01_1233.d 3.61E4 1 1 399 419
K.E(+42.01)RRPTKITDR.Q Y 28.09 1312.7211 10 10.8 329.1911 4 22.15 2 7281 AEV_1_3_RA2_01_1232.d 0 1 1 329 338 Acetylation (N-term)
K.VLC(+57.02)PK.L Y 23.61 615.3414 5 37.6 616.3718 1 46.38 3 23433 AEV_3_3_RA3_01_1233.d 2.3E4 1 1 420 424 Carbamidomethylation
K.GRTTILIDDLADTSNTITR.A Y 22.16 2075.0859 19 -24.5 692.6857 3 81.02 3 48860 AEV_3_3_RA3_01_1233.d 9.79E4 1 1 351 369
R.INASALDK.V Y 17.94 830.4498 8 -0.8 416.2318 2 52.56 2 21761 AEV_1_3_RA2_01_1232.d 7.06E4 1 1 399 406
R.ESIIVSPD(+43.99)AGGAKR.A Y 17.84 1442.7365 14 -70.0 481.8857 3 73.63 1 36789 AEV 2_3_RA2_01_1224.d 3.25E4 1 1 298 311 Carboxylation (DKW)
R.ESIIVSPDAGGAK.R Y 15.52 1242.6455 13 11.4 311.6722 4 30.78 3 13834 AEV_3_3_RA3_01_1233.d 1.14E5 1 1 298 310
total 12 peptides
C1G5X0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.GSGHIVAISSDAGR.K Y 84.97 1325.6687 14 -13.2 663.8329 2 41.24 3 20158 AEV_3_3_RA3_01_1233.d 2.05E5 2 2 1162 1175
R.FNDPSGEDGPSGVAR.I Y 63.37 1503.6589 15 5.1 752.8406 2 53.66 2 22321 AEV_1_3_RA2_01_1232.d 2.71E5 3 3 679 693
R.GGDGAFTVDILR.S Y 57.54 1219.6196 12 2.7 610.8187 2 78.33 2 39231 AEV_1_3_RA2_01_1232.d 2.72E5 2 2 950 961
R.ADSTLEENLRPSGAK.I Y 53.28 1586.7899 15 3.7 794.4052 2 51.76 3 26892 AEV_3_3_RA3_01_1233.d 4.1E4 1 1 624 638
R.YAFVSYSSGTTGRPK.G Y 51.91 1619.7943 15 11.8 540.9451 3 60.91 2 26469 AEV_1_3_RA2_01_1232.d 8.87E4 1 1 155 169
R.EGAHVALGAR.R Y 41.15 979.5199 10 -17.3 490.7587 2 27.64 2 9656 AEV_1_3_RA2_01_1232.d 1.36E4 1 1 1058 1067
R.ITETLMTPTLLAAVLSR.H Y 28.87 1829.0332 17 -17.7 915.5077 2 91.20 2 47809 AEV_1_3_RA2_01_1232.d 0 1 1 240 256
R.T(+42.01)(+79.97)VDVNC(+57.02)K.G Y 18.78 956.3674 7 32.3 479.2065 2 58.87 1 25683 AEV 2_3_RA2_01_1224.d 0 1 1 1139 1145 Acetylation (N-term); Phosphorylation (STY); Carbamidomethylation
K.GIVNSHR.A Y 17.75 781.4195 7 -119.1 782.3337 1 92.60 1 51487 AEV 2_3_RA2_01_1224.d 0 1 1 170 176
R.GSSRGGDGAFT(+14.02)VDILR.S Y 16.80 1620.8219 16 -16.8 325.1662 5 67.87 1 32333 AEV 2_3_RA2_01_1224.d 7.66E4 1 1 946 961 Methylation(others)
R.AEMTPVDFVSR.A Y 16.17 1250.5964 11 65.4 417.9000 3 61.74 2 27016 AEV_1_3_RA2_01_1232.d 1.02E5 1 1 879 889
total 11 peptides
C1GDK4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
R.GGTTLYVTGFGHGTR.A Y 95.21 1522.7528 15 1.6 762.3849 2 63.26 3 34951 AEV_3_3_RA3_01_1233.d 8.72E5 6 6 4 18
R.IGRDDLLKIEWAR.T Y 71.62 1583.8783 13 -9.8 396.9730 4 75.06 3 44168 AEV_3_3_RA3_01_1233.d 1.27E5 1 1 71 83
R.ARELAYEFER.Y Y 52.69 1282.6305 10 -93.2 428.5109 3 70.06 1 34005 AEV 2_3_RA2_01_1224.d 2.31E5 2 2 19 28
R.ELAYEFER.Y Y 36.85 1055.4923 8 -87.1 528.7075 2 71.66 1 35309 AEV 2_3_RA2_01_1224.d 3.39E5 3 3 21 28
R.TPPSASWR.F Y 36.40 900.4453 8 2.0 451.2308 2 37.34 3 17792 AEV_3_3_RA3_01_1233.d 6.13E5 2 2 84 91
R.C(+57.02)DIPAPR.T Y 27.29 827.3959 7 46.4 414.7244 2 37.33 2 14188 AEV_1_3_RA2_01_1232.d 0 2 2 35 41 Carbamidomethylation
R.DRDRSRSPGVR.D Y 19.12 1299.6755 11 -60.9 434.2061 3 75.45 1 38232 AEV 2_3_RA2_01_1224.d 8.97E4 1 1 136 146
R.SPSPR.R N 18.32 542.2812 5 -0.1 543.2885 1 63.92 3 35440 AEV_3_3_RA3_01_1233.d 6.6E4 3 3 110 114
R.D(+42.01)RSPLR.R Y 16.02 784.4191 6 14.1 393.2224 2 46.09 3 23245 AEV_3_3_RA3_01_1233.d 1.57E5 1 1 101 106 Acetylation (N-term)
R.GGT(-2.02)TLYVTGFGHGTR.A Y 15.45 1520.7372 15 80.4 507.9604 3 63.20 3 34892 AEV_3_3_RA3_01_1233.d 0 1 1 4 18 2-amino-3-oxo-butanoic_acid
total 10 peptides
A0A0A0HRM2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.AISDASGSIYIPR.G Y 73.25 1348.6986 13 -2.2 675.3551 2 70.59 2 33289 AEV_1_3_RA2_01_1232.d 4.83E5 5 5 283 295
R.VLDALFPSVQGGTVC(+57.02)IPGAFGC(+57.02)GK.T Y 68.74 2449.2134 24 4.8 817.4156 3 87.87 2 46130 AEV_1_3_RA2_01_1232.d 1.9E5 1 1 408 431 Carbamidomethylation
R.LGEMPADQGFPAYLGAK.L Y 55.62 1763.8552 17 -2.7 882.9325 2 79.35 3 47565 AEV_3_3_RA3_01_1233.d 1.98E5 2 2 540 556
K.HFPSINTSVSYSK.Y Y 51.33 1465.7201 13 6.5 489.5838 3 57.70 3 30729 AEV_3_3_RA3_01_1233.d 3.54E5 2 2 619 631
R.APRPVNEK.L Y 35.65 909.5032 8 -18.4 455.7505 2 10.50 2 2662 AEV_1_3_RA2_01_1232.d 0 1 1 388 395
K.LASDSPFIVGQR.V Y 30.58 1288.6775 12 2.0 645.3473 2 68.88 3 39362 AEV_3_3_RA3_01_1233.d 6E3 1 1 396 407
K.SIALGSPK.R Y 30.29 771.4490 8 -109.4 772.3719 1 52.32 1 21546 AEV 2_3_RA2_01_1224.d 1.78E4 1 1 567 574
K.LASFYER.A Y 28.04 884.4392 7 14.3 443.2332 2 53.93 3 28310 AEV_3_3_RA3_01_1233.d 1.66E5 1 1 557 563
R.EATAEIQNMLR.G Y 24.69 1274.6289 11 0.7 638.3222 2 71.22 3 41208 AEV_3_3_RA3_01_1233.d 0 1 1 741 751
R.GISIP(+31.99)ALDR.E Y 22.72 972.5240 9 -5.8 487.2664 2 60.23 2 26031 AEV_1_3_RA2_01_1232.d 1.46E4 1 1 296 304 Dihydroxy
K.SALGDPDK.I Y 20.50 801.3868 8 22.5 802.4122 1 88.05 2 46219 AEV_1_3_RA2_01_1232.d 7.67E4 1 1 674 681
R.KHFPSINTSVSYSK.Y Y 18.93 1593.8151 14 -1.1 399.4606 4 57.17 3 30344 AEV_3_3_RA3_01_1233.d 4.63E4 1 1 618 631
R.TGLSKDPPLTPQPNLR.Q Y 17.42 1732.9471 16 -6.7 434.2412 4 70.21 2 33005 AEV_1_3_RA2_01_1232.d 1.66E5 1 1 102 117
R.GISIPALDR.E Y 16.13 940.5341 9 -95.7 471.2293 2 71.79 1 35340 AEV 2_3_RA2_01_1224.d 0 1 1 296 304
R.IAGPGSYTVDEK.L Y 16.03 1235.6034 12 -66.5 309.8876 4 36.22 1 12295 AEV 2_3_RA2_01_1224.d 0 1 1 354 365
K.DPPLTPQPNLR.Q Y 15.57 1246.6670 11 35.9 312.6852 4 35.09 2 13115 AEV_1_3_RA2_01_1232.d 2.84E5 1 1 107 117
K.L(+42.01)ASDSPFIVGQR.V Y 15.16 1330.6881 12 50.8 444.5925 3 68.73 3 39233 AEV_3_3_RA3_01_1233.d 2.76E4 1 1 396 407 Acetylation (N-term)
total 17 peptides
C1GLU1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area Atenuado #Spec #Spec Atenuado Start End PTM
K.LC(+57.02)FTPDTGSGGWLAGSPAVK.L Y 95.92 2019.9724 20 -1.0 1010.9924 2 81.05 3 48880 AEV_3_3_RA3_01_1233.d 1.22E5 2 2 111 130 Carbamidomethylation
R.FTFSAADAGQHK.L Y 62.18 1278.5992 12 6.9 640.3113 2 52.53 3 27404 AEV_3_3_RA3_01_1233.d 6.88E5 7 7 99 110
R.FTFSAADAGQHKLC(+57.02)FTPDTGSGGWLAGSPAVK.L Y 48.81 3280.5610 32 -23.5 821.1283 4 80.37 3 48355 AEV_3_3_RA3_01_1233.d 0 1 1 99 130 Carbamidomethylation
R.F(+42.01)TFSAADAGQHK.L Y 26.09 1320.6099 12 51.4 441.2332 3 54.75 2 22878 AEV_1_3_RA2_01_1232.d 0 1 1 99 110 Acetylation (N-term)
K.IESEDK.S Y 23.70 719.3337 6 -37.4 720.3141 1 91.53 1 50733 AEV 2_3_RA2_01_1224.d 3.24E4 2 2 143 148
K.IESEDKSKM(+15.99)EDMAQR.V Y 19.67 1811.8030 15 38.0 453.9752 4 58.48 1 25418 AEV 2_3_RA2_01_1224.d 0 1 1 143 157 Oxidation (M)
total 6 peptides
Peptide List


 


Prepared with PEAKS ™ (bioinfor.com)